3B2KA

Iodide derivative of human lfabp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
GSSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Fatty acid-binding protein, liver
publication title Utility of anion and cation combinations for phasing of protein structures.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2011-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3b2kA00
5H9AA 5D47A 5F6ZA 4HPAA 1A57A 1QY1A 3P6FA 1GKAA 1GXAA 4A1HA 1HMRA 1BRPA 1X89A 2RCQA 3SAOA 1KT7A 3IA8A 3MVFA 3B2JA 1KT5A 3BRNA 4YGGA 3TGBA 4KIIA 1EW3A 5EZ2A 3MBTA 4I3DA 5F7GA 2WQAE 3TF6A 3DSZA 1GT1A 4EXZA 1BBPA 3WJEA 3APWA 1MUPA 2NP1A 2OVEA 5LJEA 5B27A 1KQXA 4TLJA 1TVQA 4WFUA 3CMPA 5LJKA 2DM5A 4AZMA 4K19A 4QYNA 1KXOA 1EPBA 4GNYA 2QM9A 3CR6A 2A2UA 1HMSA 1MX8A 1QABE 4HFOA 3KQ0A 1GT5A 3P6HA 4I9SA 2HYSA 1PM1X 1YWAA 4OS3A 4M7MA 3BU1A 3FEPA 1HN2A 3U9PC 1FENA 2JOZA 2OVDA 1O1VA 2LBAA 3F8AA 4ORRA 1HBPA 1U0XA 2FRSA 1SXYA 3FENA 5L8NA 5HCCC 2WUTA 3L4RA 1B4MA 2L5PA 1VPRA 5B29A 2GJ5A 4DQ4A 3UEUA 4GRJA 2MM3A 1KT4A 4BQUA 4AZRA 3CQRA 1IKEA 3BLGA 1ZNGA 3O22A 4NLJA 1GGLA 1YP6A 1QY2A 1ZNKA 3P6CA 4QYPA 4MVLA 5LKFA 2OZQA 1H91A 1PBOA 1A18A 1ZRYA 4GH7A 4IAXA 5FENA 1S44A 4AYHA 4GETA 1IFCA 4IAWA 1LNMA 1LF7A 4NNSA 5HWZA 3BY0A 1LFOA 4YCEA 5L8IA 1O8VA 2HZRA 5LJGA 1GKAB 1DZKA 1SY2A 1FTPA 1X8PA 2LKKA 2L67A 2AT3X 2W2BA 2QO4A 3D95A 2Q4NA 4IMNA 4ZHCA 1LIFA 1BEBA 1BM5A 4OMXA 1X8NA 1EUOA 3FLLA 5FFHA 1EPAA 2XKLA 1RBPA 2K62A 3K3LA 3VG2A 1TOWA 2RD7C 3WJBA 4TJZA 3CWKA 3BSZE 1E02A 1E00A 1CBQA 3ZQ3A 4AZPA 5FAZA 3FR4A 2E4JA 3BDRA 1JV4A 2HNXA 5EDBA 1JYJA 4HPBA 2NNDA 1VYFA 4WBKA 3UEWA 4ZCBA 1EIIA 3BS2A 3AKNA 1O1UA 2W2AA 4M6SA 4YBPA 1E06A 3TZSA 3FR5A 4A60A 3I17A 1YP7A 4LZUA 2RA6A 1DC9A 2MJIA 2WEXA 3I0AA 5F6BA 1U18A 4TKHA 5HA0A 3APXA 1VYGA 2JU7A 1T8VA 4ORSA 1FDQA 2A13A 3VG4A 4A1YA 5EEEA 2K23A 3BU9A 2GC9A 1QY0A 4YH0A 5BVTA 1OBUA 1I06A 1HMTA 2R56A 1HBQA 2AKQA 5HZ8A 2AT0X 5HA1A 4ZH9A 2FT9A 4TKJA 3STNA 2QO6A 1CBIA 1BRQA 1G85A 4ALOA 5KICA 3FA9A 4ZHFA 4DQ3A 2AT8X 3VG7A 4UU3A 2Q2MA 4ORYA 5KIDA 5DPQA 4YBUA 1MVGA 3C76X 1BSQA 5HZ5A 4YKMA 3O2YA 2X45A 1UREA 1QG5A 3UEVA 2NNQA 4ORUA 3ZUOA 1KT6A 5HTEA 2FS7A 3EBKA 3FIQA 5F1EA 2P8GA 2ACPX 4YMYA 1YIVA 3G7XA 2KTDA 3P6GA 1D2UA 3HWEA 2OFMX 1AVGI 4RUUA 1R0UA 4ZGUA 3OJYC 2AT5X 2F73A 3WXQA 1OEEA 1LIEA 1QFVA 3P6DA 1AQBA 1CBRA 1GX9A 4TKBA 1L6MA 3KFFA 1YWCA 4WFVA 4OMWA 3JSQA 4D6AA 4BVMA 4ZHGA 5HAEA 2OVAA 4CK4A 1YUPA 1BLRA 1ACDA 2CM4A 1DZJA 2WWPA 3C77X 1YWDA 1JBHA 1SXUA 2WR6A 3B2IA 2FR3A 3F9DA 3QKGA 4ES7A 4Y0RA 1KT3A 2CZTA 4NNTA 4IBAA 4AZQA 5EPQA 5AQ6A 1G5WA 5D45A 1EQDA 1S7DA 1JYDA 4ZR2A 4YGHA 3S26A 2JU8A 3PPTA 1DZPA 2HLVA 1GT4A 1QFTA 3WJFA 1G7NA 4PSQA 2QOSC 2PY1A 1MDCA 4IMOA 3CQNA 3VG5A 3CBSA 4OS8A 1IKJA 4A8ZA 1OEKA 3STKA 3FW5A 3STMX 2XSTA 2G78A 5D4AA 4YFQA 1ZNDA 1KZXA 3TGCA 2AL0X 2CM9A 3B2KA 1BWYA 3AKMA 4I9RA 1IW2A 1JJJA 2ANSA 2ALLX 4OS0A 1GX8A 5HZQA 2Q2PA 1T0VA 1ERBA 3WJCA 4ZFXA 2GTFX 2BLGA 3FA6A 1JZUA 2FWVA 4QZTA 4IB6A 2A2GA 4I3CA 4EFGA 1NP1A 3JS1A 3PECA 1N0SA 1I05A 1SA8A 2AT6X 1TOUA 3HWDA 2R74A 1DFVA 5L8OA 5BVQA 1B8EA 1ALBA 4XMGA 2AMMX 1KZWA 1XKIA 1AELA 4NLIA 4YGZA 5DG4A 1XCAA 1TW4A 1EXSA 4XMFA 4UU2A 1MX7A 2WEWA 4GKCA 4N7DA 1EIOA 3B2LA 1ML7A 2G79A 3WJDA 5KHPA 3EMMA 5IO7A 4EDEA 1E5PA 1P6PA 4XMEA 4NYRA 1AB0A 2WQ9A 1CJ5A 1IFBA 1LIDA 4IB9A 4LKPA 4YFRA 1ICNA 2N93A 1S2PA 4ORXA 3ZUIA 2LB6A 3WVMA 4TNNA 2EU7X 3DTQA 5HTDA 3KFHA 3NQ9A 3EBWA 2O62A 4AZOA 1LPJA 1SXXA 2G7BA 5EDCA 4XMDA 1DZMA 1X8UA 3PP6A 4ZHDA 3EM0A 4LZVA 1TXLA 2CZUA 5H9LA 4TQ2A 1SY3A 3VG6A 3CBCA 3NX1A 1NGLA 4RUNA 2X46A 1CRBA 4HPDA 1DV9A 1OPAA 3U0DA 2FLJA 1A3YA 2WSJA 1ADLA 4GE1A 3FR2A 3PH5A 3APVA 4ZHHA 4YDBA 2AH7X 3D96A 4YKOA 4D6BA 4EEJA 5JR8A 2R73A 2LBVA 5C0NA 2JU3A 1HQPA 3NR3A 1FEMA 4LKTA 2QO5A 1EALA 1DF3A 3APUA 1KOIA 5BVSA 1LKEA 2CBRA 5HBSA 5HCEC 3TGAA 4ZJ0A 1ZNEA 3PEDA 3KFIA 4QGWA 4YDAA 3EYCA 2MO5A 2Q39A 5H8TA 3KFGA 1GM6A 2JN3A 3B2HA 3NX2A 5HCDC 1KQWA 5EEDA 2RQ0A 4R0BA 4QGVA 5LKEA 2A3FX 3U03A 4ZH6A 3BX7A 3FW4A 1SY0A 1NP4A 1RLBE 4IB8A 2HMBA 4QZUA 1CBSA 3T1DA 4IB7A 2L9CA 1Z24A 1D3SA 3C78X 1BSYA 1IIUA 1X71A 1QQSA 1GT3A 1ZNHA 2L68A 4I3BA 1G74A 3IFBA 3RSWA 2FR2A 2KT4B 4O9SA 3BX8A 1B0OA 3NP1A 2CBSA 4MVKA 1OBPA 5H9NA 3ELXA 4YCHA 5CE4A 1I04A 4ALBA 4Y0SA 1U17A 3NQ3A 5HZ6A 4NYQA 2OFRX 2Q9SA 4XMHA 3VG3A 3Q6LA 1QWDA 3HK1A 5H9KA 3NADA 5IO5A 5LJCA 5D48A 1LIBA 1B56A 3D97A 4ODDA 4HPCA 4AW8A 1UZ2X 1ZNLA 2ACOA 1BJ7A 4YFPA 3PH6A 1OEJA 5LJDA 1JJXA 1ERXA 3KZAA 2W2FA 3NPOA 4QAEA 3WBGA 1T68X 4QGXA 4ARHA 1OPBA 5K06A 1LICA 1OBQA 2HZQA 4GNWA 4AZNA 1YWBA 4XMCA 3HWFA 3O19A 3FMZA 5F58A 4Y0PA 2YG2A 5D8JA 3FA7A 2A0AA 3FA8A 1SY1A 2ASNX 1FELA 4Y0QA 3UEXA 4NP1A 1X8OA 1I4UA 5LJBA 5IO6A 1A2DA 1BSOA 1FE3A 3HWGA 3P6EA 4ORWA 1KGLA 2NNEA 4MVIA 4BOEA 3RZYA 4N7CA 1PMPA 2FS6A 2FTBA 3FELA 2IFBA 3FEKA 3ELZA 1X8QA 1SXWA 2LFOA 3GAQA 5HZ9A 5LJHA 1ICMA 2POAA 2RCTA 1PEEA 3WJGA
chains in the Genus database with same CATH superfamily
5H9AA 3HOEA 5D47A 5F6ZA 4HPAA 1A57A 1QY1A 3P6FA 3WYPA 1GKAA 1GXAA 4A1HA 1HMRA 3N91A 3GE2A 1SWQA 1BRPA 1X89A 2RCQA 3SAOA 3SZIA 2MHDA 1KT7A 3IA8A 3MVFA 3B2JA 4KC7A 1KT5A 3BRNA 4YGGA 2PI3O 3TGBA 1LCWA 4KIIA 4KC8A 1KL5A 1EW3A 2Z4HA 5EZ2A 3MBTA 2OVSA 2BSZA 4I3DA 5F7GA 2WQAE 3TF6A 2RCTA 3DSZA 1GT1A 4EXZA 1BBPA 3WJEA 3APWA 1MUPA 2IZFB 1Y9LA 2ZAGA 4BX6A 2NP1A 2OVEA 5LJEA 5B27A 1SRHA 1KQXA 4TLJA 1TVQA 4WFUA 3CMPA 5LJKA 4JNJA 4GJVA 4O49A 2DM5A 4AZMA 3HOLA 4K19A 3OD9A 4QYNA 1KXOA 1EPBA 4L3RA 4GNYA 2QM9A 3CR6A 2A2UA 3VHHA 3X00A 1HMSA 2Y3FA 1MX8A 1HQQA 1QABE 4HFOA 3KQ0A 1GT5A 3P6HA 4I9SA 2HYSA 4MISA 1PM1X 1SWAA 4ZGFA 4U8UM 2RTKA 1YWAA 4I60A 4OS3A 4M7MA 3ZW0A 1JIWI 3BU1A 3FEPA 1HN2A 3T2XA 2CAMA 3U9PC 2A5BA 4GU8A 1FENA 2JOZA 2OVDA 1SLEB 1UYOX 1O1VA 2LBAA 3F8AA 3AEHA 4ORRA 1HBPA 1U0XA 2FRSA 1SXYA 3FENA 4BX7B 2OY8A 5HCCC 5L8NA 2JGSA 1VWHB 2WUTA 1VWCB 3L4RA 1B4MA 2L5PA 1VPRA 4GGTA 5B29A 4IRWA 3FDCA 2GJ5A 4DQ4A 3UEUA 1KL4A 2KTSA 4GRJA 2MM3A 1KT4A 4NV8A 4BQUA 3UAQA 3QQ2A 4AZRA 3CQRA 3ZW1A 2RTCB 2IZGB 1IKEA 3BLGA 1ZNGA 3O22A 4IABA 4NLJA 4CDDA 1GGLA 1YP6A 1QY2A 1ZNKA 1VWPB 2F09A 1LDQA 2KD2A 3P6CA 4MVLA 1VWAB 4QYPA 5LKFA 4BBOA 4FBRA 5L3YA 1VYOA 1JQPA 2OZQA 1H91A 1PBOA 3E3CA 3WYQA 1A18A 1ZRYA 4GH7A 4IAXA 5FENA 3FYFA 1S44A 1SWPA 4AYHA 4GETA 1IFCA 4IAWA 4Z6JA 1LNMA 1LF7A 4NNSA 1SWOA 1VWDB 4DCBA 3T6LA 5HWZA 3SOTA 3BY0A 3F6ZB 1LFOA 4YCEA 5L8IA 1O8VA 2HZRA 3JQOA 5LJGA 1GKAB 1DZKA 1SWRA 1SY2A 1SWCA 3WOVA 1FTPA 1DF8A 1X8PA 1SLFB 2LKKA 2L67A 2AT3X 2W2BA 2QO4A 4QZUA 2G8CO 4GUZA 3D95A 2Q4NA 4Z28A 2RTOB 4IMNA 4MVEA 4ZHCA 1LIFA 1BEBA 3CKFA 1BM5A 4ID2A 4GK9A 4OMXA 1X8NA 1EUOA 4LQZA 3FLLA 5FFHA 1EPAA 2XKLA 1RBPA 2K62A 3K3LA 3VG2A 2BC3A 1TOWA 1Y0GA 2RD7C 3WJBA 4TJZA 3CWKA 3BSZE 3HPEA 1LDOA 1E02A 2MWHA 1E00A 1CBQA 5FQ8E 4BX6B 3ZQ3A 1LCZA 5FAZA 3FR4A 4AZPA 2E4JA 1VWEB 3BDRA 4Y5DA 2FKJA 1JV4A 4BJ8A 2HNXA 5EDBA 1JYJA 4HPBA 2NNDA 1VYFA 4WBKA 3UEWA 4ZCBA 2IZIA 1EIIA 3BS2A 4BX7A 3AKNA 1O1UA 4Z27A 1SLGB 2W2AA 2VFBA 4M6SA 5IRWA 2IZAA 4YBPA 4JO6A 2IZCB 1E06A 3TZSA 2LA7A 3FR5A 1W6FA 3ZW2A 1VWIB 2C1SA 4OEMA 4A60A 4O3WA 3I17A 5F2BA 3NBXX 1YP7A 3P24A 3PK2A 4LZUA 2RA6A 5IXGA 1DC9A 1SWLA 2MJIA 2WEXA 3I0AA 4QRLA 1RAVA 5F6BA 1U18A 4TKHA 3RWXA 3T6FA 5HA0A 2OFAA 1STSB 3APXA 1VYGA 2OY7A 2JU7A 1T8VA 4ORSA 1FDQA 1OSPO 2A13A 3EW1A 4O3ZA 3VG4A 3VE1A 1N4JA 3PQUA 5EEEA 2X8FA 2Y3EA 5FQ6E 4GD9A 5B2AO 2K23A 3BU9A 3RDSA 2GC9A 3ZW1B 1QY0A 4YH0A 1LUQA 5BVTA 1OBUA 2UYWA 1I06A 2OY5O 1HMTA 2R56A 1HBQA 2AKQA 2MF6A 4O3YA 3RBYA 4Z2VA 2RTRB 2AT0X 5HA1A 4ZH9A 5HZ8A 2A5CA 2FT9A 4O4XA 4TKJA 3STNA 2QO6A 1CBIA 1BRQA 1SWSA 5JD2A 1G85A 4ALOA 3Q34A 5KICA 2OL8O 2KW1A 3FA9A 2AT8X 4O4UA 2Y32A 3T2WA 4UU3A 2Q2MA 4ORYA 3VG7A 4BX5B 4FBVA 5B5FA 5KIDA 1NBXA 4YBUA 5DPQA 1MEPA 1MVGA 3C76X 4B55A 1BSQA 3MG5A 1SWUA 5HZ5A 5B10O 4YKMA 2RTPB 3O2YA 2X45A 1UREA 1QG5A 3UEVA 3VPJE 2NNQA 2FGSA 2YMSA 4ORUA 1HY2A 3ZUOA 1KT6A 5HTEA 2FS7A 3EBKA 3AUMO 3FIQA 5F1EA 2P8GA 2ACPX 3SZHA 4YMYA 1LELA 1YIVA 3G7XA 5CYBA 4A1YA 2KTDA 2RTIB 1Y52X 2C1QA 3P6GA 1N9MA 3ZZVA 1D2UA 3HWEA 4DNEA 1VWFB 2OFMX 1AVGI 4RUUA 1R0UA 4ZGUA 4KCAA 2GTLN 3OJYC 2AT5X 2F73A 2ZSCA 3WXQA 5B5GA 1JMXA 1LIEA 1OEEA 1QFVA 3P6DA 1AQBA 4DQ3A 1CBRA 1I9HA 1GX9A 4KT5A 4U3QA 4TKBA 1L6MA 3KFFA 1YWCA 4WFVA 4OMWA 4OELA 1UYNX 3JSQA 4D6AA 2X4MA 4BVMA 1JJUA 2OL6O 4ZHGA 4CV7A 5HAEA 2OVAA 3S60A 4CK4A 2OYBO 1YUPA 1BLRA 3KVNA 4WHIA 1ACDA 2CM4A 2X8TA 1DZJA 2WWPA 3C77X 1YWDA 1JBHA 1SXUA 2Z4IA 1NDJA 2WR6A 3B2IA 2FR3A 3F9DA 3QKGA 4ES7A 4Y0RA 2OL7A 1KT3A 2CZTA 2G5LA 4GJSA 1Y9TA 4IBAA 4NNTA 4AZQA 5EPQA 2GTLO 1SWGA 1SWKA 2OY1O 4CDEA 5AQ6A 3RDQA 5D45A 1EQDA 1G5WA 1S7DA 1STPA 1JYDA 3NQKA 4ZR2A 4PJ2A 4O4SA 3EC5A 4YGHA 2JU8A 3PPTA 1DZPA 1SMPI 2HLVA 3S26A 1GT4A 1VWJB 4BX5A 1QFTA 4L1NA 1G7NA 1SWFA 4PSQA 3WJFA 2QOSC 2PY1A 3H3IA 1MDCA 1SWJA 3V8UA 3RDUA 4IMOA 3CQNA 4GDZA 3VG5A 3CBSA 1STRB 2WPUA 1IKJA 4OS8A 4A8ZA 1OEKA 3STKA 3FW5A 3RE5A 3STMX 3D9WA 2IZEB 2G78A 2XSTA 5D4AA 3S5VA 4YFQA 1ZNDA 5B11O 3SLJA 1SWBA 3WZPA 2JMBA 1KZXA 3TGCA 2AL0X 2CM9A 3B2KA 2RTFB 2JW1A 1BWYA 3AKMA 1SWNA 4I9RA 4MIRA 4MEEA 2X32A 3RDMA 1IW2A 2IZLB 2ANSA 4GDAA 2ALLX 4FBOA 1GX8A 4OS0A 1JJJA 3RE6A 5HZQA 2Q2PA 4U9CA 2I5ZO 4CPHB 1T0VA 4Z2OA 1SWTA 1ERBA 4COTA 3CKGA 3WJCA 1RSTB 4ZFXA 2GTFX 2BLGA 3D4RA 4CPIA 3FA6A 1JZUA 2FWVA 3SLOA 1N9YA 2OF9A 2A2GA 4IB6A 4QZTA 2BHVA 4I3CA 4EFGA 1NP1A 2RTNB 3JS1A 3PECA 1N0SA 1I05A 1SA8A 2AT6X 1TOUA 3HWDA 4YVBA 4INNA 2R74A 1DFVA 5L8OA 3OE3A 1VWKB 5BVQA 1B8EA 1ALBA 4XMGA 2AMMX 1KZWA 4ML7B 1XKIA 1AELA 4NLIA 2OF8A 2AF5A 4HWMA 4YGZA 5DG4A 1XCAA 1TW4A 1EXSA 3LV4A 4XMFA 4UU2A 1MX7A 2WEWA 4GKCA 4N7DA 1EIOA 1KL3A 1ML7A 1VWLB 3B2LA 2G79A 4U46A 3WJDA 5KHPA 3EMMA 1KFFA 5IO7A 4EDEA 1E5PA 1EI5A 5CSEA 1P6PA 5K68A 4XMEA 1W5RA 2DJGA 1AB0A 2GTLM 2WQ9A 4NYRA 1IFBA 3SZJA 1CJ5A 2X55A 1LIDA 4IB9A 4LKPA 4ON1A 4YFRA 1ICNA 2N93A 1S2PA 4ORXA 3ZUIA 2LB6A 3WVMA 1PTSA 2VDFA 4TNNA 2RTDB 3VHMA 1GX3A 2EU7X 3DTQA 1PBYA 2DJFA 5IRUA 2QMIA 5HTDA 3HTYA 3KFHA 3NQ9A 3EBWA 2O62A 4AZOA 1LPJA 1SXXA 2G7BA 1HXLA 5EDCA 4XMDA 1DZMA 1X8UA 3PP6A 1SRFA 4ZHDA 1SRIA 1N7YA 1AVEA 3RY1A 2IZHB 3EM0A 1TXLA 4LZVA 2CZUA 1VWBB 5H9LA 3SLTA 4CPHA 1RXJA 4TQ2A 1SY3A 3VG6A 2RTEB 3CBCA 3NX1A 1NGLA 1VWNB 4RUNA 2X46A 1CRBA 1N43A 4HPDA 1DV9A 1SWDA 1OPAA 3U0DA 2FLJA 1A3YA 2WSJA 1ADLA 4CPFA 2BS5A 4GE1A 3FR2A 3PH5A 3APVA 4ZHHA 4YDBA 2AH7X 3D96A 5AJCA 4NW4A 4YKOA 5K67A 4D6BA 4EEJA 5JR8A 2R73A 2LBVA 5C0NA 1VWOB 2JU3A 1HQPA 3NR3A 1FEMA 2RTLA 4GZVA 4CDCA 4LKTA 4GGZA 2QO5A 4O4OA 1EALA 1DF3A 3APUA 1KOIA 5BVSA 1SREA 1LKEA 2CBRA 4FQBB 5HBSA 1FJ1E 1MOYA 5HCEC 3TGAA 4ZJ0A 1ZNEA 3PEDA 2C4IA 4JGLA 1Y55X 3KFIA 2IZJA 4QGWA 4YDAA 3EYCA 2MO5A 3LTWA 4QNIA 3RKGA 1JMZA 2Q39A 3KFGA 3PDFA 1GM6A 5H8TA 2QCBA 2JN3A 3B2HA 3EW2A 3NX2A 3OBLA 3VU1A 5HCDC 1KQWA 5EEDA 2RQ0A 4R0BA 4QGVA 5LKEA 5IRAA 2A3FX 3U03A 1IJ8A 3FIDA 4ZH6A 3BX7A 3FW4A 1SY0A 1NP4A 1RLBE 1LCVA 2FKGA 2HMBA 1CBSA 4IB8A 4OKAA 3T1DA 4IB7A 2L9CA 4FGIB 1Z24A 1D3SA 3C78X 1BSYA 2RN4A 1IIUA 1X71A 1QQSA 1GT3A 1ZNHA 2L68A 4I3BA 1G74A 3IFBA 3RSWA 2FR2A 2KT4B 4O9SA 4Y59A 3BX8A 1B0OA 2GH7A 3NP1A 3WZNA 4CSBA 1AVDA 2CBSA 2IZDB 4MVKA 4QQ1A 4BCSA 4C5PA 1OBPA 5H9NA 5AJBA 3ELXA 4YCHA 4EQAC 3WZOA 1I04A 4ALBA 1NQMA 2RTHB 4Y0SA 2M4LA 4BGFA 5CE4A 1VWQB 1U17A 3NQ3A 4I95A 5HZ6A 4NYQA 1K24A 2OFRX 2Q9SA 4XMHA 3VG3A 3Q6LA 1QWDA 3HK1A 5H9KA 3NADA 5IO5A 5LJCA 5D48A 1LIBA 2X56A 2QOMA 4JHQA 1B56A 1RSUB 3D97A 1MK5A 4ODDA 4HPCA 4AW8A 2HKDA 5FQ7E 4I6SA 1UZ2X 4U8UN 1ZNLA 2ACOA 1BJ7A 2FHLA 2RTAA 3PH6A 1NC9A 4YFPA 1OEJA 5LJDA 1JJXA 1ERXA 3KZAA 2W2FA 2RTGB 3NPOA 3LHNA 4QAEA 3VGWA 3WBGA 2IZKA 1T68X 4QGXA 5B3MO 4ARHA 2I5VO 5CHKA 4NV7A 1OPBA 4CPEA 3RY2A 2VFCA 2RTBB 5K06A 1VWRB 5AEOA 1WBIA 3RDOA 1LICA 1OBQA 2HZQA 4GNWA 4AZNA 1YWBA 3WZQA 4XMCA 3HWFA 3O19A 2F01A 2A8GA 1VWMB 3FMZA 1SWHA 5F58A 3VE2A 1I78A 1SRJA 3ZI8A 4Y0PA 2YG2A 1SWEA 1HXZA 5D8JA 4GGRA 3FA7A 2A0AA 2X34A 2X8SA 3FA8A 1SY1A 4CDFA 2ASNX 4U8UO 2ZAIA 2RTMA 1FELA 4Y0QA 3RDXA 3UEXA 2OFBA 4NP1A 1X8OA 2AVIA 1RXHA 1I4UA 2RTQB 4EKVA 5LJBA 5IO6A 1A2DA 2BT9A 2IZBA 1BSOA 1FE3A 4O3XB 3ZW0B 3HWGA 3P6EA 4ORWA 1KGLA 2NNEA 4MVIA 4BOEA 1SLDB 3RZYA 4Z2PA 3PQSA 3P02A 1PMPA 2FS6A 2FTBA 4N7CA 3FELA 1SRGA 2IFBA 1MM9A 3FEKA 3ELZA 1X8QA 1SXWA 2FHNX 2LFOA 3MX7A 3GAQA 1NQNA 2UZ2A 3S5XA 3ZWEA 4KH8A 4ZHFA 5HZ9A 1RXKA 2BS6A 1W4TA 2RTJA 1K3BA 1VWGB 1ICMA 5LJHA 3MM0A 3VHIA 2POAA 1E2TA 1Y53X 1WUBA 1PEEA 5BYPA 3WJGA
chains in the Genus database with same CATH topology
5H9AA 3HOEA 5D47A 5F6ZA 4HPAA 1A57A 1QY1A 3P6FA 1GKAA 1GXAA 4A1HA 1HMRA 3N91A 3GE2A 1BRPA 1X89A 2RCQA 3SAOA 2MHDA 1KT7A 3IA8A 3MVFA 3B2JA 4KC7A 1KT5A 3BRNA 4YGGA 3TGBA 4KIIA 4KC8A 1EW3A 2Z4HA 5EZ2A 3MBTA 2OVSA 4I3DA 5F7GA 2WQAE 3TF6A 3DSZA 1GT1A 4EXZA 1BBPA 3WJEA 3APWA 1MUPA 1Y9LA 2ZAGA 2NP1A 2OVEA 5LJEA 5B27A 1KQXA 4TLJA 1TVQA 4WFUA 3CMPA 5LJKA 4O49A 2DM5A 4AZMA 3HOLA 4K19A 3OD9A 4QYNA 1KXOA 1EPBA 4L3RA 4GNYA 2QM9A 3CR6A 2A2UA 1HMSA 1MX8A 1QABE 4HFOA 3KQ0A 1GT5A 3P6HA 4I9SA 2HYSA 4MISA 1PM1X 4ZGFA 4U8UM 1YWAA 4OS3A 4M7MA 3ZW0A 1JIWI 3BU1A 3FEPA 1HN2A 3U9PC 4GU8A 1FENA 2JOZA 2OVDA 1O1VA 2LBAA 3F8AA 4ORRA 1HBPA 1U0XA 2FRSA 1SXYA 3FENA 5L8NA 5HCCC 2WUTA 3L4RA 1B4MA 2L5PA 1VPRA 5B29A 2GJ5A 4DQ4A 3UEUA 2KTSA 4GRJA 2MM3A 1KT4A 4BQUA 3UAQA 4AZRA 3CQRA 3ZW1A 4IABA 1IKEA 3BLGA 1ZNGA 3O22A 4NLJA 1GGLA 1YP6A 1QY2A 1ZNKA 2F09A 2KD2A 3P6CA 4QYPA 4MVLA 5LKFA 4FBRA 3E3CA 2OZQA 1H91A 1PBOA 1A18A 1ZRYA 4GH7A 4IAXA 5FENA 3FYFA 1S44A 4AYHA 4GETA 1IFCA 4IAWA 1LNMA 1LF7A 4NNSA 5HWZA 3SOTA 3BY0A 3F6ZB 1LFOA 4YCEA 5L8IA 1O8VA 2HZRA 3JQOA 5LJGA 1GKAB 1DZKA 1SY2A 3WOVA 1FTPA 1X8PA 2LKKA 2L67A 2AT3X 2W2BA 2QO4A 3D95A 2Q4NA 4IMNA 4MVEA 4ZHCA 1LIFA 1BEBA 1BM5A 4ID2A 4GK9A 4OMXA 1X8NA 1EUOA 4LQZA 3FLLA 5FFHA 1EPAA 2XKLA 1RBPA 2K62A 3K3LA 3VG2A 1TOWA 2RD7C 3WJBA 4TJZA 3CWKA 3BSZE 1E02A 2MWHA 1E00A 1CBQA 5FQ8E 3ZQ3A 4AZPA 5FAZA 3FR4A 2E4JA 3BDRA 1JV4A 2HNXA 5EDBA 1JYJA 4HPBA 2NNDA 1VYFA 4WBKA 3UEWA 4ZCBA 1EIIA 3BS2A 3AKNA 1O1UA 2W2AA 4M6SA 4YBPA 1E06A 3TZSA 2LA7A 3FR5A 3ZW2A 4A60A 4O3WA 3I17A 3NBXX 1YP7A 3P24A 4LZUA 2RA6A 1DC9A 2MJIA 2WEXA 3I0AA 4QRLA 5F6BA 1U18A 4TKHA 3RWXA 5HA0A 3APXA 1VYGA 2JU7A 1T8VA 4ORSA 1FDQA 2A13A 3VG4A 4A1YA 4O3ZA 3VE1A 5EEEA 3PQUA 2X8FA 5FQ6E 2K23A 3BU9A 2GC9A 3ZW1B 1QY0A 4YH0A 5BVTA 1OBUA 1I06A 1HMTA 2R56A 1HBQA 2AKQA 4O3YA 5HZ8A 3RBYA 2AT0X 5HA1A 4ZH9A 2FT9A 4O4XA 4TKJA 3STNA 2QO6A 1CBIA 1BRQA 1G85A 4ALOA 5KICA 3FA9A 2KW1A 4O4UA 2AT8X 4DQ3A 4ZHFA 3VG7A 4UU3A 2Q2MA 4ORYA 4FBVA 5KIDA 5DPQA 4YBUA 1MVGA 3C76X 1BSQA 5HZ5A 4YKMA 3O2YA 2X45A 1UREA 1QG5A 3UEVA 3VPJE 2NNQA 2YMSA 4ORUA 3ZUOA 1KT6A 5HTEA 2FS7A 3EBKA 3FIQA 5F1EA 2P8GA 2ACPX 4YMYA 1YIVA 3G7XA 5CYBA 2KTDA 3P6GA 3ZZVA 1D2UA 3HWEA 2OFMX 1AVGI 4RUUA 1R0UA 4ZGUA 4KCAA 2GTLN 3OJYC 2AT5X 2F73A 3WXQA 1OEEA 1LIEA 1QFVA 3P6DA 1AQBA 1CBRA 4U3QA 1GX9A 4KT5A 4TKBA 1L6MA 3KFFA 1YWCA 4WFVA 4OMWA 3JSQA 4D6AA 4BVMA 4ZHGA 4CV7A 5HAEA 2OVAA 3S60A 4CK4A 1YUPA 1BLRA 4WHIA 1ACDA 2CM4A 2X8TA 1DZJA 2WWPA 3C77X 1YWDA 1JBHA 1SXUA 2Z4IA 2WR6A 3B2IA 2FR3A 3F9DA 3QKGA 4ES7A 4Y0RA 1KT3A 2CZTA 4NNTA 1Y9TA 4IBAA 4AZQA 5EPQA 2GTLO 5AQ6A 1G5WA 5D45A 1EQDA 1S7DA 1JYDA 3NQKA 4ZR2A 4PJ2A 4O4SA 4YGHA 3S26A 2JU8A 3PPTA 1DZPA 1SMPI 2HLVA 1GT4A 1QFTA 4L1NA 1G7NA 4PSQA 3WJFA 2QOSC 2PY1A 3H3IA 1MDCA 3V8UA 4IMOA 3CQNA 4GDZA 3VG5A 3CBSA 4OS8A 1IKJA 4A8ZA 1OEKA 3STKA 3FW5A 3STMX 2XSTA 2G78A 5D4AA 3S5VA 4YFQA 1ZNDA 1KZXA 2JMBA 3TGCA 2AL0X 2CM9A 3B2KA 2JW1A 1BWYA 3AKMA 4I9RA 4MIRA 1IW2A 1JJJA 2ANSA 2ALLX 4FBOA 1GX8A 4OS0A 5HZQA 2Q2PA 4U9CA 1T0VA 1ERBA 4COTA 3WJCA 4ZFXA 2GTFX 2BLGA 3D4RA 3FA6A 1JZUA 2FWVA 4QZTA 4IB6A 2A2GA 2BHVA 4I3CA 4EFGA 1NP1A 3JS1A 3PECA 1N0SA 1I05A 1SA8A 2AT6X 1TOUA 3HWDA 4INNA 2R74A 1DFVA 5L8OA 3OE3A 5BVQA 1B8EA 1ALBA 4XMGA 2AMMX 1KZWA 4ML7B 1XKIA 1AELA 4NLIA 4HWMA 4YGZA 5DG4A 1XCAA 1TW4A 1EXSA 3LV4A 4XMFA 4UU2A 1MX7A 2WEWA 4GKCA 4N7DA 1EIOA 3B2LA 1ML7A 2G79A 3WJDA 5KHPA 3EMMA 5IO7A 4EDEA 1E5PA 1EI5A 1P6PA 4XMEA 2GTLM 1AB0A 2WQ9A 4NYRA 1CJ5A 1IFBA 1LIDA 4IB9A 4LKPA 4ON1A 4YFRA 1ICNA 2N93A 1S2PA 4ORXA 3ZUIA 2LB6A 3WVMA 4TNNA 2EU7X 3DTQA 2QMIA 5HTDA 3HTYA 3KFHA 3NQ9A 3EBWA 2O62A 4AZOA 1LPJA 1SXXA 2G7BA 5EDCA 4XMDA 1DZMA 1X8UA 3PP6A 4ZHDA 3EM0A 4LZVA 1TXLA 2CZUA 5H9LA 4TQ2A 1SY3A 3VG6A 3CBCA 3NX1A 1NGLA 4RUNA 2X46A 1CRBA 4HPDA 1DV9A 1OPAA 3U0DA 2FLJA 1A3YA 2WSJA 1ADLA 2BS5A 4GE1A 3FR2A 3PH5A 3APVA 4ZHHA 4YDBA 2AH7X 3D96A 5AJCA 4NW4A 4YKOA 4D6BA 4EEJA 5JR8A 2R73A 2LBVA 5C0NA 2JU3A 1HQPA 3NR3A 1FEMA 4GZVA 4LKTA 2QO5A 4O4OA 1EALA 1DF3A 3APUA 1KOIA 5BVSA 1LKEA 2CBRA 4FQBB 5HBSA 5HCEC 3TGAA 4ZJ0A 1ZNEA 3PEDA 4JGLA 3KFIA 4QGWA 4YDAA 3EYCA 2MO5A 3RKGA 4QNIA 2Q39A 5H8TA 3KFGA 1GM6A 2JN3A 3B2HA 3NX2A 3OBLA 3VU1A 5HCDC 1KQWA 5EEDA 2RQ0A 4R0BA 4QGVA 5LKEA 2A3FX 3U03A 4ZH6A 3BX7A 3FW4A 1SY0A 1NP4A 1RLBE 4IB8A 2HMBA 4QZUA 1CBSA 3T1DA 4IB7A 2L9CA 4FGIB 1Z24A 1D3SA 3C78X 1BSYA 2RN4A 1IIUA 1X71A 1QQSA 1GT3A 1ZNHA 2L68A 4I3BA 1G74A 3IFBA 3RSWA 2FR2A 2KT4B 4O9SA 3BX8A 1B0OA 3NP1A 4CSBA 2CBSA 4MVKA 4QQ1A 1OBPA 5H9NA 5AJBA 3ELXA 4YCHA 4EQAC 5CE4A 1I04A 4ALBA 4Y0SA 2M4LA 4I95A 1U17A 3NQ3A 5HZ6A 4NYQA 2OFRX 2Q9SA 4XMHA 3VG3A 3Q6LA 1QWDA 3HK1A 5H9KA 3NADA 5IO5A 5LJCA 5D48A 1LIBA 1B56A 3D97A 4ODDA 4HPCA 4AW8A 5FQ7E 4I6SA 1UZ2X 4U8UN 1ZNLA 2ACOA 1BJ7A 4YFPA 3PH6A 1OEJA 5LJDA 1JJXA 1ERXA 3KZAA 2W2FA 3NPOA 3LHNA 4QAEA 3WBGA 1T68X 4QGXA 4ARHA 1OPBA 5K06A 5AEOA 1LICA 1OBQA 2HZQA 4GNWA 4AZNA 1YWBA 4XMCA 3HWFA 3O19A 3VE2A 3FMZA 5F58A 3ZI8A 4Y0PA 2YG2A 5D8JA 3FA7A 2A0AA 2X8SA 3FA8A 1SY1A 2ASNX 4U8UO 2ZAIA 1FELA 4Y0QA 3UEXA 4NP1A 1X8OA 1I4UA 5LJBA 5IO6A 1A2DA 2BT9A 1BSOA 1FE3A 4O3XB 3ZW0B 3HWGA 3P6EA 4ORWA 1KGLA 2NNEA 4MVIA 4BOEA 3RZYA 3PQSA 3P02A 1PMPA 2FS6A 2FTBA 4N7CA 3FELA 2IFBA 3FEKA 3ELZA 1X8QA 1SXWA 2LFOA 3MX7A 3S5XA 3GAQA 3ZWEA 4KH8A 5HZ9A 2BS6A 5LJHA 1ICMA 2POAA 2RCTA 1PEEA 5BYPA 3WJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H9A A;  5D47 A;  5F6Z A;  4HPA A;  1A57 A;  1QY1 A;  3P6F A;  1GKA A;  1GXA A;  4A1H A;  1HMR A;  1BRP A;  1X89 A;  2RCQ A;  3SAO A;  1KT7 A;  3IA8 A;  3MVF A;  3B2J A;  1KT5 A;  3BRN A;  4YGG A;  3TGB A;  4KII A;  1EW3 A;  5EZ2 A;  3MBT A;  4I3D A;  5F7G A;  2WQA E;  3TF6 A;  3DSZ A;  1GT1 A;  4EXZ A;  1BBP A;  3WJE A;  3APW A;  1MUP A;  2NP1 A;  2OVE A;  5LJE A;  5B27 A;  1KQX A;  4TLJ A;  1TVQ A;  4WFU A;  3CMP A;  5LJK A;  2DM5 A;  4AZM A;  4K19 A;  4QYN A;  1KXO A;  1EPB A;  4GNY A;  2QM9 A;  3CR6 A;  2A2U A;  1HMS A;  1MX8 A;  1QAB E;  4HFO A;  3KQ0 A;  1GT5 A;  3P6H A;  4I9S A;  2HYS A;  1PM1 X;  1YWA A;  4OS3 A;  4M7M A;  3BU1 A;  3FEP A;  1HN2 A;  3U9P C;  1FEN A;  2JOZ A;  2OVD A;  1O1V A;  2LBA A;  3F8A A;  4ORR A;  1HBP A;  1U0X A;  2FRS A;  1SXY A;  3FEN A;  5L8N A;  5HCC C;  2WUT A;  3L4R A;  1B4M A;  2L5P A;  1VPR A;  5B29 A;  2GJ5 A;  4DQ4 A;  3UEU A;  4GRJ A;  2MM3 A;  1KT4 A;  4BQU A;  4AZR A;  3CQR A;  1IKE A;  3BLG A;  1ZNG A;  3O22 A;  4NLJ A;  1GGL A;  1YP6 A;  1QY2 A;  1ZNK A;  3P6C A;  4QYP A;  4MVL A;  5LKF A;  2OZQ A;  1H91 A;  1PBO A;  1A18 A;  1ZRY A;  4GH7 A;  4IAX A;  5FEN A;  1S44 A;  4AYH A;  4GET A;  1IFC A;  4IAW A;  1LNM A;  1LF7 A;  4NNS A;  5HWZ A;  3BY0 A;  1LFO A;  4YCE A;  5L8I A;  1O8V A;  2HZR A;  5LJG A;  1GKA B;  1DZK A;  1SY2 A;  1FTP A;  1X8P A;  2LKK A;  2L67 A;  2AT3 X;  2W2B A;  2QO4 A;  3D95 A;  2Q4N A;  4IMN A;  4ZHC A;  1LIF A;  1BEB A;  1BM5 A;  4OMX A;  1X8N A;  1EUO A;  3FLL A;  5FFH A;  1EPA A;  2XKL A;  1RBP A;  2K62 A;  3K3L A;  3VG2 A;  1TOW A;  2RD7 C;  3WJB A;  4TJZ A;  3CWK A;  3BSZ E;  1E02 A;  1E00 A;  1CBQ A;  3ZQ3 A;  4AZP A;  5FAZ A;  3FR4 A;  2E4J A;  3BDR A;  1JV4 A;  2HNX A;  5EDB A;  1JYJ A;  4HPB A;  2NND A;  1VYF A;  4WBK A;  3UEW A;  4ZCB A;  1EII A;  3BS2 A;  3AKN A;  1O1U A;  2W2A A;  4M6S A;  4YBP A;  1E06 A;  3TZS A;  3FR5 A;  4A60 A;  3I17 A;  1YP7 A;  4LZU A;  2RA6 A;  1DC9 A;  2MJI A;  2WEX A;  3I0A A;  5F6B A;  1U18 A;  4TKH A;  5HA0 A;  3APX A;  1VYG A;  2JU7 A;  1T8V A;  4ORS A;  1FDQ A;  2A13 A;  3VG4 A;  4A1Y A;  5EEE A;  2K23 A;  3BU9 A;  2GC9 A;  1QY0 A;  4YH0 A;  5BVT A;  1OBU A;  1I06 A;  1HMT A;  2R56 A;  1HBQ A;  2AKQ A;  5HZ8 A;  2AT0 X;  5HA1 A;  4ZH9 A;  2FT9 A;  4TKJ A;  3STN A;  2QO6 A;  1CBI A;  1BRQ A;  1G85 A;  4ALO A;  5KIC A;  3FA9 A;  4ZHF A;  4DQ3 A;  2AT8 X;  3VG7 A;  4UU3 A;  2Q2M A;  4ORY A;  5KID A;  5DPQ A;  4YBU A;  1MVG A;  3C76 X;  1BSQ A;  5HZ5 A;  4YKM A;  3O2Y A;  2X45 A;  1URE A;  1QG5 A;  3UEV A;  2NNQ A;  4ORU A;  3ZUO A;  1KT6 A;  5HTE A;  2FS7 A;  3EBK A;  3FIQ A;  5F1E A;  2P8G A;  2ACP X;  4YMY A;  1YIV A;  3G7X A;  2KTD A;  3P6G A;  1D2U A;  3HWE A;  2OFM X;  1AVG I;  4RUU A;  1R0U A;  4ZGU A;  3OJY C;  2AT5 X;  2F73 A;  3WXQ A;  1OEE A;  1LIE A;  1QFV A;  3P6D A;  1AQB A;  1CBR A;  1GX9 A;  4TKB A;  1L6M A;  3KFF A;  1YWC A;  4WFV A;  4OMW A;  3JSQ A;  4D6A A;  4BVM A;  4ZHG A;  5HAE A;  2OVA A;  4CK4 A;  1YUP A;  1BLR A;  1ACD A;  2CM4 A;  1DZJ A;  2WWP A;  3C77 X;  1YWD A;  1JBH A;  1SXU A;  2WR6 A;  3B2I A;  2FR3 A;  3F9D A;  3QKG A;  4ES7 A;  4Y0R A;  1KT3 A;  2CZT A;  4NNT A;  4IBA A;  4AZQ A;  5EPQ A;  5AQ6 A;  1G5W A;  5D45 A;  1EQD A;  1S7D A;  1JYD A;  4ZR2 A;  4YGH A;  3S26 A;  2JU8 A;  3PPT A;  1DZP A;  2HLV A;  1GT4 A;  1QFT A;  3WJF A;  1G7N A;  4PSQ A;  2QOS C;  2PY1 A;  1MDC A;  4IMO A;  3CQN A;  3VG5 A;  3CBS A;  4OS8 A;  1IKJ A;  4A8Z A;  1OEK A;  3STK A;  3FW5 A;  3STM X;  2XST A;  2G78 A;  5D4A A;  4YFQ A;  1ZND A;  1KZX A;  3TGC A;  2AL0 X;  2CM9 A;  3B2K A;  1BWY A;  3AKM A;  4I9R A;  1IW2 A;  1JJJ A;  2ANS A;  2ALL X;  4OS0 A;  1GX8 A;  5HZQ A;  2Q2P A;  1T0V A;  1ERB A;  3WJC A;  4ZFX A;  2GTF X;  2BLG A;  3FA6 A;  1JZU A;  2FWV A;  4QZT A;  4IB6 A;  2A2G A;  4I3C A;  4EFG A;  1NP1 A;  3JS1 A;  3PEC A;  1N0S A;  1I05 A;  1SA8 A;  2AT6 X;  1TOU A;  3HWD A;  2R74 A;  1DFV A;  5L8O A;  5BVQ A;  1B8E A;  1ALB A;  4XMG A;  2AMM X;  1KZW A;  1XKI A;  1AEL A;  4NLI A;  4YGZ A;  5DG4 A;  1XCA A;  1TW4 A;  1EXS A;  4XMF A;  4UU2 A;  1MX7 A;  2WEW A;  4GKC A;  4N7D A;  1EIO A;  3B2L A;  1ML7 A;  2G79 A;  3WJD A;  5KHP A;  3EMM A;  5IO7 A;  4EDE A;  1E5P A;  1P6P A;  4XME A;  4NYR A;  1AB0 A;  2WQ9 A;  1CJ5 A;  1IFB A;  1LID A;  4IB9 A;  4LKP A;  4YFR A;  1ICN A;  2N93 A;  1S2P A;  4ORX A;  3ZUI A;  2LB6 A;  3WVM A;  4TNN A;  2EU7 X;  3DTQ A;  5HTD A;  3KFH A;  3NQ9 A;  3EBW A;  2O62 A;  4AZO A;  1LPJ A;  1SXX A;  2G7B A;  5EDC A;  4XMD A;  1DZM A;  1X8U A;  3PP6 A;  4ZHD A;  3EM0 A;  4LZV A;  1TXL A;  2CZU A;  5H9L A;  4TQ2 A;  1SY3 A;  3VG6 A;  3CBC A;  3NX1 A;  1NGL A;  4RUN A;  2X46 A;  1CRB A;  4HPD A;  1DV9 A;  1OPA A;  3U0D A;  2FLJ A;  1A3Y A;  2WSJ A;  1ADL A;  4GE1 A;  3FR2 A;  3PH5 A;  3APV A;  4ZHH A;  4YDB A;  2AH7 X;  3D96 A;  4YKO A;  4D6B A;  4EEJ A;  5JR8 A;  2R73 A;  2LBV A;  5C0N A;  2JU3 A;  1HQP A;  3NR3 A;  1FEM A;  4LKT A;  2QO5 A;  1EAL A;  1DF3 A;  3APU A;  1KOI A;  5BVS A;  1LKE A;  2CBR A;  5HBS A;  5HCE C;  3TGA A;  4ZJ0 A;  1ZNE A;  3PED A;  3KFI A;  4QGW A;  4YDA A;  3EYC A;  2MO5 A;  2Q39 A;  5H8T A;  3KFG A;  1GM6 A;  2JN3 A;  3B2H A;  3NX2 A;  5HCD C;  1KQW A;  5EED A;  2RQ0 A;  4R0B A;  4QGV A;  5LKE A;  2A3F X;  3U03 A;  4ZH6 A;  3BX7 A;  3FW4 A;  1SY0 A;  1NP4 A;  1RLB E;  4IB8 A;  2HMB A;  4QZU A;  1CBS A;  3T1D A;  4IB7 A;  2L9C A;  1Z24 A;  1D3S A;  3C78 X;  1BSY A;  1IIU A;  1X71 A;  1QQS A;  1GT3 A;  1ZNH A;  2L68 A;  4I3B A;  1G74 A;  3IFB A;  3RSW A;  2FR2 A;  2KT4 B;  4O9S A;  3BX8 A;  1B0O A;  3NP1 A;  2CBS A;  4MVK A;  1OBP A;  5H9N A;  3ELX A;  4YCH A;  5CE4 A;  1I04 A;  4ALB A;  4Y0S A;  1U17 A;  3NQ3 A;  5HZ6 A;  4NYQ A;  2OFR X;  2Q9S A;  4XMH A;  3VG3 A;  3Q6L A;  1QWD A;  3HK1 A;  5H9K A;  3NAD A;  5IO5 A;  5LJC A;  5D48 A;  1LIB A;  1B56 A;  3D97 A;  4ODD A;  4HPC A;  4AW8 A;  1UZ2 X;  1ZNL A;  2ACO A;  1BJ7 A;  4YFP A;  3PH6 A;  1OEJ A;  5LJD A;  1JJX A;  1ERX A;  3KZA A;  2W2F A;  3NPO A;  4QAE A;  3WBG A;  1T68 X;  4QGX A;  4ARH A;  1OPB A;  5K06 A;  1LIC A;  1OBQ A;  2HZQ A;  4GNW A;  4AZN A;  1YWB A;  4XMC A;  3HWF A;  3O19 A;  3FMZ A;  5F58 A;  4Y0P A;  2YG2 A;  5D8J A;  3FA7 A;  2A0A A;  3FA8 A;  1SY1 A;  2ASN X;  1FEL A;  4Y0Q A;  3UEX A;  4NP1 A;  1X8O A;  1I4U A;  5LJB A;  5IO6 A;  1A2D A;  1BSO A;  1FE3 A;  3HWG A;  3P6E A;  4ORW A;  1KGL A;  2NNE A;  4MVI A;  4BOE A;  3RZY A;  4N7C A;  1PMP A;  2FS6 A;  2FTB A;  3FEL A;  2IFB A;  3FEK A;  3ELZ A;  1X8Q A;  1SXW A;  2LFO A;  3GAQ A;  5HZ9 A;  5LJH A;  1ICM A;  2POA A;  2RCT A;  1PEE A;  3WJG A; 
#chains in the Genus database with same CATH topology
 5H9A A;  3HOE A;  5D47 A;  5F6Z A;  4HPA A;  1A57 A;  1QY1 A;  3P6F A;  3WYP A;  1GKA A;  1GXA A;  4A1H A;  1HMR A;  3N91 A;  3GE2 A;  1SWQ A;  1BRP A;  1X89 A;  2RCQ A;  3SAO A;  3SZI A;  2MHD A;  1KT7 A;  3IA8 A;  3MVF A;  3B2J A;  4KC7 A;  1KT5 A;  3BRN A;  4YGG A;  2PI3 O;  3TGB A;  1LCW A;  4KII A;  4KC8 A;  1KL5 A;  1EW3 A;  2Z4H A;  5EZ2 A;  3MBT A;  2OVS A;  2BSZ A;  4I3D A;  5F7G A;  2WQA E;  3TF6 A;  2RCT A;  3DSZ A;  1GT1 A;  4EXZ A;  1BBP A;  3WJE A;  3APW A;  1MUP A;  2IZF B;  1Y9L A;  2ZAG A;  4BX6 A;  2NP1 A;  2OVE A;  5LJE A;  5B27 A;  1SRH A;  1KQX A;  4TLJ A;  1TVQ A;  4WFU A;  3CMP A;  5LJK A;  4JNJ A;  4GJV A;  4O49 A;  2DM5 A;  4AZM A;  3HOL A;  4K19 A;  3OD9 A;  4QYN A;  1KXO A;  1EPB A;  4L3R A;  4GNY A;  2QM9 A;  3CR6 A;  2A2U A;  3VHH A;  3X00 A;  1HMS A;  2Y3F A;  1MX8 A;  1HQQ A;  1QAB E;  4HFO A;  3KQ0 A;  1GT5 A;  3P6H A;  4I9S A;  2HYS A;  4MIS A;  1PM1 X;  1SWA A;  4ZGF A;  4U8U M;  2RTK A;  1YWA A;  4I60 A;  4OS3 A;  4M7M A;  3ZW0 A;  1JIW I;  3BU1 A;  3FEP A;  1HN2 A;  3T2X A;  2CAM A;  3U9P C;  2A5B A;  4GU8 A;  1FEN A;  2JOZ A;  2OVD A;  1SLE B;  1UYO X;  1O1V A;  2LBA A;  3F8A A;  3AEH A;  4ORR A;  1HBP A;  1U0X A;  2FRS A;  1SXY A;  3FEN A;  4BX7 B;  2OY8 A;  5HCC C;  5L8N A;  2JGS A;  1VWH B;  2WUT A;  1VWC B;  3L4R A;  1B4M A;  2L5P A;  1VPR A;  4GGT A;  5B29 A;  4IRW A;  3FDC A;  2GJ5 A;  4DQ4 A;  3UEU A;  1KL4 A;  2KTS A;  4GRJ A;  2MM3 A;  1KT4 A;  4NV8 A;  4BQU A;  3UAQ A;  3QQ2 A;  4AZR A;  3CQR A;  3ZW1 A;  2RTC B;  2IZG B;  1IKE A;  3BLG A;  1ZNG A;  3O22 A;  4IAB A;  4NLJ A;  4CDD A;  1GGL A;  1YP6 A;  1QY2 A;  1ZNK A;  1VWP B;  2F09 A;  1LDQ A;  2KD2 A;  3P6C A;  4MVL A;  1VWA B;  4QYP A;  5LKF A;  4BBO A;  4FBR A;  5L3Y A;  1VYO A;  1JQP A;  2OZQ A;  1H91 A;  1PBO A;  3E3C A;  3WYQ A;  1A18 A;  1ZRY A;  4GH7 A;  4IAX A;  5FEN A;  3FYF A;  1S44 A;  1SWP A;  4AYH A;  4GET A;  1IFC A;  4IAW A;  4Z6J A;  1LNM A;  1LF7 A;  4NNS A;  1SWO A;  1VWD B;  4DCB A;  3T6L A;  5HWZ A;  3SOT A;  3BY0 A;  3F6Z B;  1LFO A;  4YCE A;  5L8I A;  1O8V A;  2HZR A;  3JQO A;  5LJG A;  1GKA B;  1DZK A;  1SWR A;  1SY2 A;  1SWC A;  3WOV A;  1FTP A;  1DF8 A;  1X8P A;  1SLF B;  2LKK A;  2L67 A;  2AT3 X;  2W2B A;  2QO4 A;  4QZU A;  2G8C O;  4GUZ A;  3D95 A;  2Q4N A;  4Z28 A;  2RTO B;  4IMN A;  4MVE A;  4ZHC A;  1LIF A;  1BEB A;  3CKF A;  1BM5 A;  4ID2 A;  4GK9 A;  4OMX A;  1X8N A;  1EUO A;  4LQZ A;  3FLL A;  5FFH A;  1EPA A;  2XKL A;  1RBP A;  2K62 A;  3K3L A;  3VG2 A;  2BC3 A;  1TOW A;  1Y0G A;  2RD7 C;  3WJB A;  4TJZ A;  3CWK A;  3BSZ E;  3HPE A;  1LDO A;  1E02 A;  2MWH A;  1E00 A;  1CBQ A;  5FQ8 E;  4BX6 B;  3ZQ3 A;  1LCZ A;  5FAZ A;  3FR4 A;  4AZP A;  2E4J A;  1VWE B;  3BDR A;  4Y5D A;  2FKJ A;  1JV4 A;  4BJ8 A;  2HNX A;  5EDB A;  1JYJ A;  4HPB A;  2NND A;  1VYF A;  4WBK A;  3UEW A;  4ZCB A;  2IZI A;  1EII A;  3BS2 A;  4BX7 A;  3AKN A;  1O1U A;  4Z27 A;  1SLG B;  2W2A A;  2VFB A;  4M6S A;  5IRW A;  2IZA A;  4YBP A;  4JO6 A;  2IZC B;  1E06 A;  3TZS A;  2LA7 A;  3FR5 A;  1W6F A;  3ZW2 A;  1VWI B;  2C1S A;  4OEM A;  4A60 A;  4O3W A;  3I17 A;  5F2B A;  3NBX X;  1YP7 A;  3P24 A;  3PK2 A;  4LZU A;  2RA6 A;  5IXG A;  1DC9 A;  1SWL A;  2MJI A;  2WEX A;  3I0A A;  4QRL A;  1RAV A;  5F6B A;  1U18 A;  4TKH A;  3RWX A;  3T6F A;  5HA0 A;  2OFA A;  1STS B;  3APX A;  1VYG A;  2OY7 A;  2JU7 A;  1T8V A;  4ORS A;  1FDQ A;  1OSP O;  2A13 A;  3EW1 A;  4O3Z A;  3VG4 A;  3VE1 A;  1N4J A;  3PQU A;  5EEE A;  2X8F A;  2Y3E A;  5FQ6 E;  4GD9 A;  5B2A O;  2K23 A;  3BU9 A;  3RDS A;  2GC9 A;  3ZW1 B;  1QY0 A;  4YH0 A;  1LUQ A;  5BVT A;  1OBU A;  2UYW A;  1I06 A;  2OY5 O;  1HMT A;  2R56 A;  1HBQ A;  2AKQ A;  2MF6 A;  4O3Y A;  3RBY A;  4Z2V A;  2RTR B;  2AT0 X;  5HA1 A;  4ZH9 A;  5HZ8 A;  2A5C A;  2FT9 A;  4O4X A;  4TKJ A;  3STN A;  2QO6 A;  1CBI A;  1BRQ A;  1SWS A;  5JD2 A;  1G85 A;  4ALO A;  3Q34 A;  5KIC A;  2OL8 O;  2KW1 A;  3FA9 A;  2AT8 X;  4O4U A;  2Y32 A;  3T2W A;  4UU3 A;  2Q2M A;  4ORY A;  3VG7 A;  4BX5 B;  4FBV A;  5B5F A;  5KID A;  1NBX A;  4YBU A;  5DPQ A;  1MEP A;  1MVG A;  3C76 X;  4B55 A;  1BSQ A;  3MG5 A;  1SWU A;  5HZ5 A;  5B10 O;  4YKM A;  2RTP B;  3O2Y A;  2X45 A;  1URE A;  1QG5 A;  3UEV A;  3VPJ E;  2NNQ A;  2FGS A;  2YMS A;  4ORU A;  1HY2 A;  3ZUO A;  1KT6 A;  5HTE A;  2FS7 A;  3EBK A;  3AUM O;  3FIQ A;  5F1E A;  2P8G A;  2ACP X;  3SZH A;  4YMY A;  1LEL A;  1YIV A;  3G7X A;  5CYB A;  4A1Y A;  2KTD A;  2RTI B;  1Y52 X;  2C1Q A;  3P6G A;  1N9M A;  3ZZV A;  1D2U A;  3HWE A;  4DNE A;  1VWF B;  2OFM X;  1AVG I;  4RUU A;  1R0U A;  4ZGU A;  4KCA A;  2GTL N;  3OJY C;  2AT5 X;  2F73 A;  2ZSC A;  3WXQ A;  5B5G A;  1JMX A;  1LIE A;  1OEE A;  1QFV A;  3P6D A;  1AQB A;  4DQ3 A;  1CBR A;  1I9H A;  1GX9 A;  4KT5 A;  4U3Q A;  4TKB A;  1L6M A;  3KFF A;  1YWC A;  4WFV A;  4OMW A;  4OEL A;  1UYN X;  3JSQ A;  4D6A A;  2X4M A;  4BVM A;  1JJU A;  2OL6 O;  4ZHG A;  4CV7 A;  5HAE A;  2OVA A;  3S60 A;  4CK4 A;  2OYB O;  1YUP A;  1BLR A;  3KVN A;  4WHI A;  1ACD A;  2CM4 A;  2X8T A;  1DZJ A;  2WWP A;  3C77 X;  1YWD A;  1JBH A;  1SXU A;  2Z4I A;  1NDJ A;  2WR6 A;  3B2I A;  2FR3 A;  3F9D A;  3QKG A;  4ES7 A;  4Y0R A;  2OL7 A;  1KT3 A;  2CZT A;  2G5L A;  4GJS A;  1Y9T A;  4IBA A;  4NNT A;  4AZQ A;  5EPQ A;  2GTL O;  1SWG A;  1SWK A;  2OY1 O;  4CDE A;  5AQ6 A;  3RDQ A;  5D45 A;  1EQD A;  1G5W A;  1S7D A;  1STP A;  1JYD A;  3NQK A;  4ZR2 A;  4PJ2 A;  4O4S A;  3EC5 A;  4YGH A;  2JU8 A;  3PPT A;  1DZP A;  1SMP I;  2HLV A;  3S26 A;  1GT4 A;  1VWJ B;  4BX5 A;  1QFT A;  4L1N A;  1G7N A;  1SWF A;  4PSQ A;  3WJF A;  2QOS C;  2PY1 A;  3H3I A;  1MDC A;  1SWJ A;  3V8U A;  3RDU A;  4IMO A;  3CQN A;  4GDZ A;  3VG5 A;  3CBS A;  1STR B;  2WPU A;  1IKJ A;  4OS8 A;  4A8Z A;  1OEK A;  3STK A;  3FW5 A;  3RE5 A;  3STM X;  3D9W A;  2IZE B;  2G78 A;  2XST A;  5D4A A;  3S5V A;  4YFQ A;  1ZND A;  5B11 O;  3SLJ A;  1SWB A;  3WZP A;  2JMB A;  1KZX A;  3TGC A;  2AL0 X;  2CM9 A;  3B2K A;  2RTF B;  2JW1 A;  1BWY A;  3AKM A;  1SWN A;  4I9R A;  4MIR A;  4MEE A;  2X32 A;  3RDM A;  1IW2 A;  2IZL B;  2ANS A;  4GDA A;  2ALL X;  4FBO A;  1GX8 A;  4OS0 A;  1JJJ A;  3RE6 A;  5HZQ A;  2Q2P A;  4U9C A;  2I5Z O;  4CPH B;  1T0V A;  4Z2O A;  1SWT A;  1ERB A;  4COT A;  3CKG A;  3WJC A;  1RST B;  4ZFX A;  2GTF X;  2BLG A;  3D4R A;  4CPI A;  3FA6 A;  1JZU A;  2FWV A;  3SLO A;  1N9Y A;  2OF9 A;  2A2G A;  4IB6 A;  4QZT A;  2BHV A;  4I3C A;  4EFG A;  1NP1 A;  2RTN B;  3JS1 A;  3PEC A;  1N0S A;  1I05 A;  1SA8 A;  2AT6 X;  1TOU A;  3HWD A;  4YVB A;  4INN A;  2R74 A;  1DFV A;  5L8O A;  3OE3 A;  1VWK B;  5BVQ A;  1B8E A;  1ALB A;  4XMG A;  2AMM X;  1KZW A;  4ML7 B;  1XKI A;  1AEL A;  4NLI A;  2OF8 A;  2AF5 A;  4HWM A;  4YGZ A;  5DG4 A;  1XCA A;  1TW4 A;  1EXS A;  3LV4 A;  4XMF A;  4UU2 A;  1MX7 A;  2WEW A;  4GKC A;  4N7D A;  1EIO A;  1KL3 A;  1ML7 A;  1VWL B;  3B2L A;  2G79 A;  4U46 A;  3WJD A;  5KHP A;  3EMM A;  1KFF A;  5IO7 A;  4EDE A;  1E5P A;  1EI5 A;  5CSE A;  1P6P A;  5K68 A;  4XME A;  1W5R A;  2DJG A;  1AB0 A;  2GTL M;  2WQ9 A;  4NYR A;  1IFB A;  3SZJ A;  1CJ5 A;  2X55 A;  1LID A;  4IB9 A;  4LKP A;  4ON1 A;  4YFR A;  1ICN A;  2N93 A;  1S2P A;  4ORX A;  3ZUI A;  2LB6 A;  3WVM A;  1PTS A;  2VDF A;  4TNN A;  2RTD B;  3VHM A;  1GX3 A;  2EU7 X;  3DTQ A;  1PBY A;  2DJF A;  5IRU A;  2QMI A;  5HTD A;  3HTY A;  3KFH A;  3NQ9 A;  3EBW A;  2O62 A;  4AZO A;  1LPJ A;  1SXX A;  2G7B A;  1HXL A;  5EDC A;  4XMD A;  1DZM A;  1X8U A;  3PP6 A;  1SRF A;  4ZHD A;  1SRI A;  1N7Y A;  1AVE A;  3RY1 A;  2IZH B;  3EM0 A;  1TXL A;  4LZV A;  2CZU A;  1VWB B;  5H9L A;  3SLT A;  4CPH A;  1RXJ A;  4TQ2 A;  1SY3 A;  3VG6 A;  2RTE B;  3CBC A;  3NX1 A;  1NGL A;  1VWN B;  4RUN A;  2X46 A;  1CRB A;  1N43 A;  4HPD A;  1DV9 A;  1SWD A;  1OPA A;  3U0D A;  2FLJ A;  1A3Y A;  2WSJ A;  1ADL A;  4CPF A;  2BS5 A;  4GE1 A;  3FR2 A;  3PH5 A;  3APV A;  4ZHH A;  4YDB A;  2AH7 X;  3D96 A;  5AJC A;  4NW4 A;  4YKO A;  5K67 A;  4D6B A;  4EEJ A;  5JR8 A;  2R73 A;  2LBV A;  5C0N A;  1VWO B;  2JU3 A;  1HQP A;  3NR3 A;  1FEM A;  2RTL A;  4GZV A;  4CDC A;  4LKT A;  4GGZ A;  2QO5 A;  4O4O A;  1EAL A;  1DF3 A;  3APU A;  1KOI A;  5BVS A;  1SRE A;  1LKE A;  2CBR A;  4FQB B;  5HBS A;  1FJ1 E;  1MOY A;  5HCE C;  3TGA A;  4ZJ0 A;  1ZNE A;  3PED A;  2C4I A;  4JGL A;  1Y55 X;  3KFI A;  2IZJ A;  4QGW A;  4YDA A;  3EYC A;  2MO5 A;  3LTW A;  4QNI A;  3RKG A;  1JMZ A;  2Q39 A;  3KFG A;  3PDF A;  1GM6 A;  5H8T A;  2QCB A;  2JN3 A;  3B2H A;  3EW2 A;  3NX2 A;  3OBL A;  3VU1 A;  5HCD C;  1KQW A;  5EED A;  2RQ0 A;  4R0B A;  4QGV A;  5LKE A;  5IRA A;  2A3F X;  3U03 A;  1IJ8 A;  3FID A;  4ZH6 A;  3BX7 A;  3FW4 A;  1SY0 A;  1NP4 A;  1RLB E;  1LCV A;  2FKG A;  2HMB A;  1CBS A;  4IB8 A;  4OKA A;  3T1D A;  4IB7 A;  2L9C A;  4FGI B;  1Z24 A;  1D3S A;  3C78 X;  1BSY A;  2RN4 A;  1IIU A;  1X71 A;  1QQS A;  1GT3 A;  1ZNH A;  2L68 A;  4I3B A;  1G74 A;  3IFB A;  3RSW A;  2FR2 A;  2KT4 B;  4O9S A;  4Y59 A;  3BX8 A;  1B0O A;  2GH7 A;  3NP1 A;  3WZN A;  4CSB A;  1AVD A;  2CBS A;  2IZD B;  4MVK A;  4QQ1 A;  4BCS A;  4C5P A;  1OBP A;  5H9N A;  5AJB A;  3ELX A;  4YCH A;  4EQA C;  3WZO A;  1I04 A;  4ALB A;  1NQM A;  2RTH B;  4Y0S A;  2M4L A;  4BGF A;  5CE4 A;  1VWQ B;  1U17 A;  3NQ3 A;  4I95 A;  5HZ6 A;  4NYQ A;  1K24 A;  2OFR X;  2Q9S A;  4XMH A;  3VG3 A;  3Q6L A;  1QWD A;  3HK1 A;  5H9K A;  3NAD A;  5IO5 A;  5LJC A;  5D48 A;  1LIB A;  2X56 A;  2QOM A;  4JHQ A;  1B56 A;  1RSU B;  3D97 A;  1MK5 A;  4ODD A;  4HPC A;  4AW8 A;  2HKD A;  5FQ7 E;  4I6S A;  1UZ2 X;  4U8U N;  1ZNL A;  2ACO A;  1BJ7 A;  2FHL A;  2RTA A;  3PH6 A;  1NC9 A;  4YFP A;  1OEJ A;  5LJD A;  1JJX A;  1ERX A;  3KZA A;  2W2F A;  2RTG B;  3NPO A;  3LHN A;  4QAE A;  3VGW A;  3WBG A;  2IZK A;  1T68 X;  4QGX A;  5B3M O;  4ARH A;  2I5V O;  5CHK A;  4NV7 A;  1OPB A;  4CPE A;  3RY2 A;  2VFC A;  2RTB B;  5K06 A;  1VWR B;  5AEO A;  1WBI A;  3RDO A;  1LIC A;  1OBQ A;  2HZQ A;  4GNW A;  4AZN A;  1YWB A;  3WZQ A;  4XMC A;  3HWF A;  3O19 A;  2F01 A;  2A8G A;  1VWM B;  3FMZ A;  1SWH A;  5F58 A;  3VE2 A;  1I78 A;  1SRJ A;  3ZI8 A;  4Y0P A;  2YG2 A;  1SWE A;  1HXZ A;  5D8J A;  4GGR A;  3FA7 A;  2A0A A;  2X34 A;  2X8S A;  3FA8 A;  1SY1 A;  4CDF A;  2ASN X;  4U8U O;  2ZAI A;  2RTM A;  1FEL A;  4Y0Q A;  3RDX A;  3UEX A;  2OFB A;  4NP1 A;  1X8O A;  2AVI A;  1RXH A;  1I4U A;  2RTQ B;  4EKV A;  5LJB A;  5IO6 A;  1A2D A;  2BT9 A;  2IZB A;  1BSO A;  1FE3 A;  4O3X B;  3ZW0 B;  3HWG A;  3P6E A;  4ORW A;  1KGL A;  2NNE A;  4MVI A;  4BOE A;  1SLD B;  3RZY A;  4Z2P A;  3PQS A;  3P02 A;  1PMP A;  2FS6 A;  2FTB A;  4N7C A;  3FEL A;  1SRG A;  2IFB A;  1MM9 A;  3FEK A;  3ELZ A;  1X8Q A;  1SXW A;  2FHN X;  2LFO A;  3MX7 A;  3GAQ A;  1NQN A;  2UZ2 A;  3S5X A;  3ZWE A;  4KH8 A;  4ZHF A;  5HZ9 A;  1RXK A;  2BS6 A;  1W4T A;  2RTJ A;  1K3B A;  1VWG B;  1ICM A;  5LJH A;  3MM0 A;  3VHI A;  2POA A;  1E2T A;  1Y53 X;  1WUB A;  1PEE A;  5BYP A;  3WJG A; 
#chains in the Genus database with same CATH homology
 5H9A A;  3HOE A;  5D47 A;  5F6Z A;  4HPA A;  1A57 A;  1QY1 A;  3P6F A;  1GKA A;  1GXA A;  4A1H A;  1HMR A;  3N91 A;  3GE2 A;  1BRP A;  1X89 A;  2RCQ A;  3SAO A;  2MHD A;  1KT7 A;  3IA8 A;  3MVF A;  3B2J A;  4KC7 A;  1KT5 A;  3BRN A;  4YGG A;  3TGB A;  4KII A;  4KC8 A;  1EW3 A;  2Z4H A;  5EZ2 A;  3MBT A;  2OVS A;  4I3D A;  5F7G A;  2WQA E;  3TF6 A;  3DSZ A;  1GT1 A;  4EXZ A;  1BBP A;  3WJE A;  3APW A;  1MUP A;  1Y9L A;  2ZAG A;  2NP1 A;  2OVE A;  5LJE A;  5B27 A;  1KQX A;  4TLJ A;  1TVQ A;  4WFU A;  3CMP A;  5LJK A;  4O49 A;  2DM5 A;  4AZM A;  3HOL A;  4K19 A;  3OD9 A;  4QYN A;  1KXO A;  1EPB A;  4L3R A;  4GNY A;  2QM9 A;  3CR6 A;  2A2U A;  1HMS A;  1MX8 A;  1QAB E;  4HFO A;  3KQ0 A;  1GT5 A;  3P6H A;  4I9S A;  2HYS A;  4MIS A;  1PM1 X;  4ZGF A;  4U8U M;  1YWA A;  4OS3 A;  4M7M A;  3ZW0 A;  1JIW I;  3BU1 A;  3FEP A;  1HN2 A;  3U9P C;  4GU8 A;  1FEN A;  2JOZ A;  2OVD A;  1O1V A;  2LBA A;  3F8A A;  4ORR A;  1HBP A;  1U0X A;  2FRS A;  1SXY A;  3FEN A;  5L8N A;  5HCC C;  2WUT A;  3L4R A;  1B4M A;  2L5P A;  1VPR A;  5B29 A;  2GJ5 A;  4DQ4 A;  3UEU A;  2KTS A;  4GRJ A;  2MM3 A;  1KT4 A;  4BQU A;  3UAQ A;  4AZR A;  3CQR A;  3ZW1 A;  4IAB A;  1IKE A;  3BLG A;  1ZNG A;  3O22 A;  4NLJ A;  1GGL A;  1YP6 A;  1QY2 A;  1ZNK A;  2F09 A;  2KD2 A;  3P6C A;  4QYP A;  4MVL A;  5LKF A;  4FBR A;  3E3C A;  2OZQ A;  1H91 A;  1PBO A;  1A18 A;  1ZRY A;  4GH7 A;  4IAX A;  5FEN A;  3FYF A;  1S44 A;  4AYH A;  4GET A;  1IFC A;  4IAW A;  1LNM A;  1LF7 A;  4NNS A;  5HWZ A;  3SOT A;  3BY0 A;  3F6Z B;  1LFO A;  4YCE A;  5L8I A;  1O8V A;  2HZR A;  3JQO A;  5LJG A;  1GKA B;  1DZK A;  1SY2 A;  3WOV A;  1FTP A;  1X8P A;  2LKK A;  2L67 A;  2AT3 X;  2W2B A;  2QO4 A;  3D95 A;  2Q4N A;  4IMN A;  4MVE A;  4ZHC A;  1LIF A;  1BEB A;  1BM5 A;  4ID2 A;  4GK9 A;  4OMX A;  1X8N A;  1EUO A;  4LQZ A;  3FLL A;  5FFH A;  1EPA A;  2XKL A;  1RBP A;  2K62 A;  3K3L A;  3VG2 A;  1TOW A;  2RD7 C;  3WJB A;  4TJZ A;  3CWK A;  3BSZ E;  1E02 A;  2MWH A;  1E00 A;  1CBQ A;  5FQ8 E;  3ZQ3 A;  4AZP A;  5FAZ A;  3FR4 A;  2E4J A;  3BDR A;  1JV4 A;  2HNX A;  5EDB A;  1JYJ A;  4HPB A;  2NND A;  1VYF A;  4WBK A;  3UEW A;  4ZCB A;  1EII A;  3BS2 A;  3AKN A;  1O1U A;  2W2A A;  4M6S A;  4YBP A;  1E06 A;  3TZS A;  2LA7 A;  3FR5 A;  3ZW2 A;  4A60 A;  4O3W A;  3I17 A;  3NBX X;  1YP7 A;  3P24 A;  4LZU A;  2RA6 A;  1DC9 A;  2MJI A;  2WEX A;  3I0A A;  4QRL A;  5F6B A;  1U18 A;  4TKH A;  3RWX A;  5HA0 A;  3APX A;  1VYG A;  2JU7 A;  1T8V A;  4ORS A;  1FDQ A;  2A13 A;  3VG4 A;  4A1Y A;  4O3Z A;  3VE1 A;  5EEE A;  3PQU A;  2X8F A;  5FQ6 E;  2K23 A;  3BU9 A;  2GC9 A;  3ZW1 B;  1QY0 A;  4YH0 A;  5BVT A;  1OBU A;  1I06 A;  1HMT A;  2R56 A;  1HBQ A;  2AKQ A;  4O3Y A;  5HZ8 A;  3RBY A;  2AT0 X;  5HA1 A;  4ZH9 A;  2FT9 A;  4O4X A;  4TKJ A;  3STN A;  2QO6 A;  1CBI A;  1BRQ A;  1G85 A;  4ALO A;  5KIC A;  3FA9 A;  2KW1 A;  4O4U A;  2AT8 X;  4DQ3 A;  4ZHF A;  3VG7 A;  4UU3 A;  2Q2M A;  4ORY A;  4FBV A;  5KID A;  5DPQ A;  4YBU A;  1MVG A;  3C76 X;  1BSQ A;  5HZ5 A;  4YKM A;  3O2Y A;  2X45 A;  1URE A;  1QG5 A;  3UEV A;  3VPJ E;  2NNQ A;  2YMS A;  4ORU A;  3ZUO A;  1KT6 A;  5HTE A;  2FS7 A;  3EBK A;  3FIQ A;  5F1E A;  2P8G A;  2ACP X;  4YMY A;  1YIV A;  3G7X A;  5CYB A;  2KTD A;  3P6G A;  3ZZV A;  1D2U A;  3HWE A;  2OFM X;  1AVG I;  4RUU A;  1R0U A;  4ZGU A;  4KCA A;  2GTL N;  3OJY C;  2AT5 X;  2F73 A;  3WXQ A;  1OEE A;  1LIE A;  1QFV A;  3P6D A;  1AQB A;  1CBR A;  4U3Q A;  1GX9 A;  4KT5 A;  4TKB A;  1L6M A;  3KFF A;  1YWC A;  4WFV A;  4OMW A;  3JSQ A;  4D6A A;  4BVM A;  4ZHG A;  4CV7 A;  5HAE A;  2OVA A;  3S60 A;  4CK4 A;  1YUP A;  1BLR A;  4WHI A;  1ACD A;  2CM4 A;  2X8T A;  1DZJ A;  2WWP A;  3C77 X;  1YWD A;  1JBH A;  1SXU A;  2Z4I A;  2WR6 A;  3B2I A;  2FR3 A;  3F9D A;  3QKG A;  4ES7 A;  4Y0R A;  1KT3 A;  2CZT A;  4NNT A;  1Y9T A;  4IBA A;  4AZQ A;  5EPQ A;  2GTL O;  5AQ6 A;  1G5W A;  5D45 A;  1EQD A;  1S7D A;  1JYD A;  3NQK A;  4ZR2 A;  4PJ2 A;  4O4S A;  4YGH A;  3S26 A;  2JU8 A;  3PPT A;  1DZP A;  1SMP I;  2HLV A;  1GT4 A;  1QFT A;  4L1N A;  1G7N A;  4PSQ A;  3WJF A;  2QOS C;  2PY1 A;  3H3I A;  1MDC A;  3V8U A;  4IMO A;  3CQN A;  4GDZ A;  3VG5 A;  3CBS A;  4OS8 A;  1IKJ A;  4A8Z A;  1OEK A;  3STK A;  3FW5 A;  3STM X;  2XST A;  2G78 A;  5D4A A;  3S5V A;  4YFQ A;  1ZND A;  1KZX A;  2JMB A;  3TGC A;  2AL0 X;  2CM9 A;  3B2K A;  2JW1 A;  1BWY A;  3AKM A;  4I9R A;  4MIR A;  1IW2 A;  1JJJ A;  2ANS A;  2ALL X;  4FBO A;  1GX8 A;  4OS0 A;  5HZQ A;  2Q2P A;  4U9C A;  1T0V A;  1ERB A;  4COT A;  3WJC A;  4ZFX A;  2GTF X;  2BLG A;  3D4R A;  3FA6 A;  1JZU A;  2FWV A;  4QZT A;  4IB6 A;  2A2G A;  2BHV A;  4I3C A;  4EFG A;  1NP1 A;  3JS1 A;  3PEC A;  1N0S A;  1I05 A;  1SA8 A;  2AT6 X;  1TOU A;  3HWD A;  4INN A;  2R74 A;  1DFV A;  5L8O A;  3OE3 A;  5BVQ A;  1B8E A;  1ALB A;  4XMG A;  2AMM X;  1KZW A;  4ML7 B;  1XKI A;  1AEL A;  4NLI A;  4HWM A;  4YGZ A;  5DG4 A;  1XCA A;  1TW4 A;  1EXS A;  3LV4 A;  4XMF A;  4UU2 A;  1MX7 A;  2WEW A;  4GKC A;  4N7D A;  1EIO A;  3B2L A;  1ML7 A;  2G79 A;  3WJD A;  5KHP A;  3EMM A;  5IO7 A;  4EDE A;  1E5P A;  1EI5 A;  1P6P A;  4XME A;  2GTL M;  1AB0 A;  2WQ9 A;  4NYR A;  1CJ5 A;  1IFB A;  1LID A;  4IB9 A;  4LKP A;  4ON1 A;  4YFR A;  1ICN A;  2N93 A;  1S2P A;  4ORX A;  3ZUI A;  2LB6 A;  3WVM A;  4TNN A;  2EU7 X;  3DTQ A;  2QMI A;  5HTD A;  3HTY A;  3KFH A;  3NQ9 A;  3EBW A;  2O62 A;  4AZO A;  1LPJ A;  1SXX A;  2G7B A;  5EDC A;  4XMD A;  1DZM A;  1X8U A;  3PP6 A;  4ZHD A;  3EM0 A;  4LZV A;  1TXL A;  2CZU A;  5H9L A;  4TQ2 A;  1SY3 A;  3VG6 A;  3CBC A;  3NX1 A;  1NGL A;  4RUN A;  2X46 A;  1CRB A;  4HPD A;  1DV9 A;  1OPA A;  3U0D A;  2FLJ A;  1A3Y A;  2WSJ A;  1ADL A;  2BS5 A;  4GE1 A;  3FR2 A;  3PH5 A;  3APV A;  4ZHH A;  4YDB A;  2AH7 X;  3D96 A;  5AJC A;  4NW4 A;  4YKO A;  4D6B A;  4EEJ A;  5JR8 A;  2R73 A;  2LBV A;  5C0N A;  2JU3 A;  1HQP A;  3NR3 A;  1FEM A;  4GZV A;  4LKT A;  2QO5 A;  4O4O A;  1EAL A;  1DF3 A;  3APU A;  1KOI A;  5BVS A;  1LKE A;  2CBR A;  4FQB B;  5HBS A;  5HCE C;  3TGA A;  4ZJ0 A;  1ZNE A;  3PED A;  4JGL A;  3KFI A;  4QGW A;  4YDA A;  3EYC A;  2MO5 A;  3RKG A;  4QNI A;  2Q39 A;  5H8T A;  3KFG A;  1GM6 A;  2JN3 A;  3B2H A;  3NX2 A;  3OBL A;  3VU1 A;  5HCD C;  1KQW A;  5EED A;  2RQ0 A;  4R0B A;  4QGV A;  5LKE A;  2A3F X;  3U03 A;  4ZH6 A;  3BX7 A;  3FW4 A;  1SY0 A;  1NP4 A;  1RLB E;  4IB8 A;  2HMB A;  4QZU A;  1CBS A;  3T1D A;  4IB7 A;  2L9C A;  4FGI B;  1Z24 A;  1D3S A;  3C78 X;  1BSY A;  2RN4 A;  1IIU A;  1X71 A;  1QQS A;  1GT3 A;  1ZNH A;  2L68 A;  4I3B A;  1G74 A;  3IFB A;  3RSW A;  2FR2 A;  2KT4 B;  4O9S A;  3BX8 A;  1B0O A;  3NP1 A;  4CSB A;  2CBS A;  4MVK A;  4QQ1 A;  1OBP A;  5H9N A;  5AJB A;  3ELX A;  4YCH A;  4EQA C;  5CE4 A;  1I04 A;  4ALB A;  4Y0S A;  2M4L A;  4I95 A;  1U17 A;  3NQ3 A;  5HZ6 A;  4NYQ A;  2OFR X;  2Q9S A;  4XMH A;  3VG3 A;  3Q6L A;  1QWD A;  3HK1 A;  5H9K A;  3NAD A;  5IO5 A;  5LJC A;  5D48 A;  1LIB A;  1B56 A;  3D97 A;  4ODD A;  4HPC A;  4AW8 A;  5FQ7 E;  4I6S A;  1UZ2 X;  4U8U N;  1ZNL A;  2ACO A;  1BJ7 A;  4YFP A;  3PH6 A;  1OEJ A;  5LJD A;  1JJX A;  1ERX A;  3KZA A;  2W2F A;  3NPO A;  3LHN A;  4QAE A;  3WBG A;  1T68 X;  4QGX A;  4ARH A;  1OPB A;  5K06 A;  5AEO A;  1LIC A;  1OBQ A;  2HZQ A;  4GNW A;  4AZN A;  1YWB A;  4XMC A;  3HWF A;  3O19 A;  3VE2 A;  3FMZ A;  5F58 A;  3ZI8 A;  4Y0P A;  2YG2 A;  5D8J A;  3FA7 A;  2A0A A;  2X8S A;  3FA8 A;  1SY1 A;  2ASN X;  4U8U O;  2ZAI A;  1FEL A;  4Y0Q A;  3UEX A;  4NP1 A;  1X8O A;  1I4U A;  5LJB A;  5IO6 A;  1A2D A;  2BT9 A;  1BSO A;  1FE3 A;  4O3X B;  3ZW0 B;  3HWG A;  3P6E A;  4ORW A;  1KGL A;  2NNE A;  4MVI A;  4BOE A;  3RZY A;  3PQS A;  3P02 A;  1PMP A;  2FS6 A;  2FTB A;  4N7C A;  3FEL A;  2IFB A;  3FEK A;  3ELZ A;  1X8Q A;  1SXW A;  2LFO A;  3MX7 A;  3S5X A;  3GAQ A;  3ZWE A;  4KH8 A;  5HZ9 A;  2BS6 A;  5LJH A;  1ICM A;  2POA A;  2RCT A;  1PEE A;  5BYP A;  3WJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...