3I0AA

Crystal structure of siderocalin (ngal, lipocalin 2) k134a mutant complexed with ferric enterobactin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
174
structure length
174
Chain Sequence
SDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFAITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Parsing the functional specificity of Siderocalin / Lipocalin 2 / NGAL for siderophores and related small-molecule ligands
rcsb
source organism Homo sapiens
total genus 42
structure length 174
sequence length 174
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3i0aA00
4ZFXA 4XMFA 4IB6A 4NYQA 1N0SA 1LPJA 3BRNA 1KT5A 3WXQA 3JS1A 4EXZA 2OVEA 3CMPA 4D6BA 1AQBA 5H8TA 4I3DA 2KTDA 1ZNLA 3KZAA 4ZH6A 4ORXA 3ZUIA 1SXUA 5CE4A 1BSYA 3NQ3A 1A57A 3P6HA 2A0AA 1FE3A 2AH7X 1T68X 2Q4NA 3P6GA 4ZCBA 1B4MA 4TKHA 3B2IA 5L8NA 1SXWA 4ZGUA 2BLGA 1G5WA 4ODDA 4WBKA 1B8EA 4EEJA 2CBSA 3WJEA 4NNSA 4IMOA 2AT5X 3STMX 1ZNHA 1X8QA 4UU2A 1L6MA 1OPBA 2L67A 2FWVA 1KT4A 4NYRA 4EDEA 1DC9A 5EPQA 1GM6A 1YWAA 1JJXA 1S7DA 3TGAA 3FEPA 1DFVA 4ZHDA 1ICMA 3CBCA 3HWDA 4IAXA 4O9SA 4MVKA 1EXSA 3U0DA 2LBVA 1CBQA 1QQSA 1KQWA 3FLLA 3EMMA 5AQ6A 1FENA 4DQ3A 5BVQA 3APVA 4OMWA 4ZH9A 1YIVA 2WUTA 2RD7C 2WQAE 1ERBA 3VG5A 1KOIA 4A8ZA 4A60A 2QO4A 1QABE 1GKAA 1GX9A 1TOUA 4YCEA 4EFGA 5K06A 3ELZA 1JZUA 1ICNA 4LKPA 5LKFA 3FW5A 1YWBA 3WJCA 1JBHA 5LJKA 1QY2A 3B2LA 1I4UA 3D97A 5LJGA 1PEEA 2WQ9A 4QZTA 4HFOA 3FR4A 1PMPA 4YH0A 1OBPA 1QY0A 1ZNDA 5D45A 1GGLA 4Y0RA 4AZNA 4XMEA 2HMBA 1R0UA 2QO6A 5H9AA 5C0NA 2LBAA 1FDQA 4N7CA 3VG6A 3KFIA 1U0XA 2WR6A 3NX2A 5D8JA 1JYJA 1KXOA 1E06A 5F6BA 1LNMA 3BLGA 1YUPA 2L68A 4MVLA 4RUUA 3WJFA 2L9CA 3DTQA 1E02A 1IIUA 2N93A 3FA7A 5DPQA 3NR3A 2RQ0A 1O1VA 1CJ5A 1X89A 5HZ9A 4MVIA 3CWKA 5HA1A 4CK4A 5KHPA 4NNTA 3NPOA 2FS6A 3I17A 5L8IA 5F58A 2CM4A 4ZR2A 1LIBA 3RSWA 2LKKA 4QYPA 1CBSA 2AMMX 3FR2A 1LFOA 2RCTA 5HCDC 1BSQA 1ML7A 2A13A 1TW4A 3P6EA 1KT3A 3I0AA 1BEBA 2IFBA 1E5PA 4GETA 5B29A 2Q9SA 3UEVA 1MX8A 3NX1A 1DZKA 2G7BA 2NNEA 3NQ9A 4GH7A 1DZMA 4QAEA 2FLJA 4BVMA 1AVGI 1Z24A 2OFRX 2QM9A 3BSZE 4ALOA 2R56A 1O1UA 1RBPA 4M6SA 5LJHA 1BLRA 4AZQA 1NP4A 5H9KA 1DZJA 4PSQA 3HWFA 5HWZA 2X46A 4QYNA 3O2YA 4HPBA 1H91A 1RLBE 4ZJ0A 1ZNGA 1YP6A 1BWYA 2CBRA 4IB9A 3TF6A 5LJDA 4YFQA 4ZHFA 1IKEA 5FAZA 4Y0QA 5HZ5A 5HZ6A 1S44A 1G74A 4R0BA 1MVGA 1GT3A 5LKEA 3AKNA 4AZMA 1O8VA 4A1HA 2ACPX 5KICA 4OS3A 3IFBA 4ZHHA 3B2HA 1GT1A 4GNWA 3VG7A 1B56A 2OVDA 2Q39A 1IFBA 1DV9A 4IAWA 5D47A 1QY1A 5HZQA 4NLIA 2AKQA 4YDBA 1KQXA 3IA8A 3C77X 2LFOA 2FT9A 2K62A 3B2JA 3U9PC 1GT4A 2X45A 3O22A 3WJDA 1BM5A 1DZPA 1UREA 4WFVA 2AT6X 1ERXA 2CZTA 2WEWA 3PEDA 3BDRA 2DM5A 1YWDA 1FEMA 5H9NA 1HN2A 4IBAA 1PBOA 2A2GA 1MUPA 3KQ0A 1EALA 2ANSA 2P8GA 2OZQA 1OEKA 2R73A 3BX7A 5D4AA 5LJBA 3TGBA 3FENA 1VYFA 1FTPA 2FTBA 4K19A 5H9LA 3BY0A 4YGGA 3PP6A 1GXAA 1EUOA 4XMDA 1UZ2X 5F6ZA 2MO5A 1BJ7A 5LJEA 1A18A 1QFVA 1X8PA 3PPTA 1HMTA 1BBPA 1CBIA 3WJBA 5HCCC 2AT8X 5LJCA 3C78X 2ACOA 3VG3A 1KZWA 5EEEA 2F73A 3K3LA 1PM1X 2JU7A 1GKAB 1KT6A 4YGHA 3PH5A 1G7NA 1TVQA 2PY1A 2JU3A 2W2BA 1ALBA 3D95A 2R74A 1YP7A 1A2DA 3C76X 3EBWA 2RCQA 4ORSA 1JJJA 2FS7A 1AELA 2CZUA 3FA8A 4AYHA 5DG4A 5HZ8A 1QG5A 3FIQA 3ZUOA 1CBRA 4GKCA 1SY3A 3T1DA 5L8OA 4UU3A 3BU1A 1EPAA 4AW8A 1IW2A 1A3YA 1KT7A 2QOSC 3CQNA 3NP1A 4HPDA 3MVFA 1DF3A 1AB0A 3BU9A 3PECA 1GX8A 4LKTA 5HBSA 2OFMX 2HNXA 4QZUA 4ORRA 4IB7A 4YKMA 4OMXA 3CBSA 4AZOA 4YBPA 1GT5A 2G79A 1EIIA 1HMRA 4LZUA 4ZHCA 3FA6A 4I3CA 3FMZA 1X71A 1LIEA 2JU8A 2AT3X 4ALBA 2MM3A 1I04A 4ZHGA 4I9SA 2HZRA 3TZSA 4NLJA 2A3FX 3TGCA 1JV4A 1EIOA 4KIIA 1U17A 3P6DA 1HMSA 2WWPA 2POAA 1HQPA 4YBUA 1SY1A 3NADA 3CQRA 2XKLA 1X8OA 4GE1A 3P6CA 3SAOA 1X8NA 3EM0A 2ALLX 4GNYA 4YFRA 3PH6A 2QO5A 2JOZA 3STNA 5IO5A 2NNDA 2NP1A 2WEXA 1T8VA 3WBGA 1TXLA 2YG2A 1OBUA 4HPCA 2K23A 3FA9A 1EPBA 4TLJA 1SY0A 3B2KA 2W2FA 5F1EA 3STKA 1LIFA 2KT4B 3P6FA 4YCHA 1VPRA 4I3BA 4YMYA 3APUA 4RUNA 4TJZA 3APXA 4Y0SA 1I05A 1S2PA 4DQ4A 5FENA 1FELA 4XMCA 2HLVA 3FR5A 1ZNEA 5HTDA 5KIDA 4YKOA 3BS2A 4YFPA 4AZPA 2HZQA 1T0VA 2RA6A 1HBQA 2AT0X 4IB8A 1QFTA 1MDCA 4ARHA 1LIDA 2GC9A 4TKBA 2CM9A 3BX8A 1CRBA 1XCAA 1ZRYA 4HPAA 3JSQA 3FW4A 3RZYA 5F7GA 2AL0X 3Q6LA 2FRSA 4ORUA 5HA0A 1D2UA 3FELA 3AKMA 3D96A 5B27A 2Q2MA 4D6AA 4QGXA 4TKJA 4NP1A 4OS0A 3F8AA 4GRJA 4YGZA 1LKEA 2Q2PA 1TOWA 2WSJA 4N7DA 3WVMA 1OEJA 3O19A 4TQ2A 3UEXA 1LF7A 1EQDA 1SY2A 3CR6A 1OEEA 3OJYC 3UEUA 3VG2A 3FEKA 1LICA 1VYGA 3APWA 3HWEA 3DSZA 1HBPA 1MX7A 2EU7X 4ORYA 5FFHA 4Y0PA 1D3SA 3QKGA 4XMHA 2LB6A 1YWCA 1EW3A 2MJIA 1IKJA 4QGWA 3ZQ3A 1BRPA 4OS8A 5EDCA 4XMGA 1ACDA 2XSTA 3F9DA 5EZ2A 3EBKA 2HYSA 2G78A 3KFHA 4YDAA 1ADLA 2A2UA 4BOEA 2OVAA 4IMNA 3KFGA 5HAEA 2FR2A 3VG4A 4AZRA 5HCEC 1JYDA 5BVSA 1BRQA 4ORWA 3HK1A 1IFCA 1ZNKA 3MBTA 3UEWA 1BSOA 1QWDA 1E00A 1B0OA 3HWGA 1OBQA 5EDBA 3WJGA 1XKIA 5D48A 1X8UA 3S26A 2ASNX 1SXYA 5BVTA 1KGLA 1KZXA 4WFUA 1P6PA 4BQUA 2FR3A 5JR8A 2O62A 3EYCA 1G85A 3KFFA 5HTEA 2E4JA 4M7MA 2L5PA 2JN3A 4LZVA 3GAQA 5EEDA 5IO7A 1SXXA 1U18A 1I06A 2NNQA 4QGVA 3L4RA 4TNNA 2GTFX 4A1YA 2W2AA 2GJ5A 1SA8A 3G7XA 5IO6A 3U03A 3ELXA 1NGLA 4I9RA 1NP1A 1OPAA 4ES7A
chains in the Genus database with same CATH superfamily
2CAMA 4L1NA 4ZFXA 4XMFA 4IB6A 4NYQA 1N0SA 1LPJA 3BRNA 3LTWA 1KT5A 3WXQA 3JS1A 4EXZA 2DJGA 2OVEA 1SWTA 3CMPA 4D6BA 3VU1A 1AQBA 5H8TA 4I3DA 2KTDA 1ZNLA 3KZAA 5CSEA 4ZH6A 5FQ7E 2RTLA 2BC3A 4ORXA 1I78A 3ZUIA 1SXUA 5CE4A 1BSYA 1HY2A 1SWPA 3NQ3A 3P6HA 3X00A 1A57A 2A0AA 1FE3A 4GK9A 4JNJA 2AH7X 1T68X 2Q4NA 3P6GA 4ZCBA 4O49A 1B4MA 1AVDA 4MVEA 4TKHA 3ZW2A 3B2IA 1SWNA 5L8NA 3VHIA 1SXWA 4ZGUA 1GX3A 2BLGA 4ML7B 1G5WA 3AEHA 4ODDA 2YMSA 4WBKA 1B8EA 4EEJA 5L3YA 4O4SA 1SWLA 2CBSA 1VWEB 3WJEA 4NNSA 3AUMO 4IMOA 2AT5X 3STMX 2FKGA 1ZNHA 2RTGB 1X8QA 4UU2A 1L6MA 2MHDA 1OPBA 2FWVA 2L67A 3E3CA 4GUZA 1KT4A 4NYRA 4EDEA 1DC9A 5EPQA 4CDEA 1GM6A 1YWAA 1JJXA 1VWRB 1S7DA 3TGAA 3S60A 4KH8A 3FEPA 1DFVA 4U8UN 1ICMA 3CBCA 4ZHDA 5LJCA 3HWDA 4IAXA 4O9SA 4EKVA 4MVKA 5IRAA 1EXSA 4I95A 4QNIA 3U0DA 2LBVA 1SWOA 2QOMA 1CBQA 1QQSA 1SWHA 2RTNB 1KQWA 3FLLA 3EMMA 5AQ6A 1FENA 4DQ3A 5BVQA 3APVA 4OMWA 4ZH9A 1IJ8A 1YIVA 2WUTA 3FDCA 2RD7C 2IZKA 4CPHB 2WQAE 2OY5O 4BGFA 2JGSA 1ERBA 2IZLB 3S5XA 3VG5A 1KOIA 2AVIA 4A8ZA 4A60A 4EQAC 2QMIA 2QO4A 1WUBA 1QABE 1GKAA 1GX9A 1RSUB 1TOUA 4YCEA 3ELZA 3LV4A 4EFGA 1ICNA 4LKPA 5LKFA 4CSBA 3FW5A 5FQ8E 4Z2PA 1SWSA 3H3IA 1N4JA 1YWBA 3CKFA 3WJCA 4CV7A 1JBHA 5LJKA 1QY2A 2OY1O 3B2LA 2A5BA 1I4UA 3D97A 1Y0GA 4U3QA 5LJGA 1PEEA 2WQ9A 4QZTA 4HFOA 1PTSA 1PMPA 3FR4A 1OBPA 4YH0A 1QY0A 1ZNDA 5D45A 1GGLA 1SLEB 1LELA 3RDSA 4Y0RA 4AZNA 5HCDC 4XMEA 2HMBA 1R0UA 2QO6A 5H9AA 5C0NA 2DJFA 2LBAA 1FDQA 4N7CA 3VG6A 3KFIA 1K3BA 1U0XA 4KC8A 2WR6A 3NX2A 4PJ2A 5D8JA 2BHVA 1JYJA 1KXOA 1E06A 2F09A 5F6BA 1LNMA 3BLGA 1YUPA 2L68A 4MVLA 4RUUA 3WJFA 1NBXA 4BX7B 1JMZA 2L9CA 3DTQA 1E02A 1IIUA 1N7YA 1OSPO 2N93A 3FA7A 1MEPA 5DPQA 3RDMA 3SLTA 1UYOX 3NR3A 2RQ0A 1O1VA 1SWCA 1CJ5A 4IABA 1X89A 5HZ9A 2OL7A 4MVIA 1Y53X 1FJ1E 3CWKA 5HA1A 1VWPB 4CK4A 5KHPA 3SZJA 4NNTA 3NPOA 1VWJB 2FS6A 3I17A 5L8IA 3SLOA 5F58A 2CM4A 4ZR2A 1LIBA 3RSWA 2LKKA 2VFCA 3VE2A 4QYPA 1CBSA 2AMMX 3FR2A 1LFOA 2RCTA 2RTRB 1BSQA 4CPEA 4ZGFA 1JIWI 1KL4A 1ML7A 2A13A 3HTYA 3MX7A 1TW4A 3P6EA 4Z2OA 1SWBA 1KT3A 3OD9A 2UZ2A 2OFBA 3I0AA 1BEBA 3ZWEA 2FGSA 2IFBA 1E5PA 4GETA 2OFAA 5AEOA 4O3YA 5B29A 2C1QA 2Q9SA 3UEVA 1MX8A 3NX1A 2G5LA 1DZKA 2G7BA 2NNEA 3NQ9A 4GH7A 1DZMA 1SWGA 3LHNA 4QAEA 1VWAB 2GTLO 3WZNA 2FLJA 2KW1A 4BVMA 1AVGI 2X4MA 1JZUA 1Z24A 2OFRX 2QM9A 3BSZE 4ALOA 4BX6B 2WPUA 2R56A 1SWAA 1O1UA 1RBPA 4M6SA 1VWDB 5LJHA 1BLRA 4AZQA 1NP4A 5H9KA 1DZJA 4PSQA 3WZQA 1SWJA 3HWFA 5B5GA 5HWZA 2I5VO 2X46A 4QYNA 3O2YA 2IZBA 1NQMA 1Y9LA 4HPBA 1H91A 1RLBE 2GH7A 4ZJ0A 1ZNGA 1HXLA 1YP6A 2CBRA 1BWYA 1SWFA 3KVNA 4GGZA 4IB9A 3TF6A 5AJBA 5LJDA 3T6FA 2FHNX 4YFQA 1SWEA 4Z6JA 1MM9A 3SLJA 4ZHFA 2I5ZO 1IKEA 1KL3A 3OBLA 5FAZA 4Y0QA 3EC5A 5HZ5A 5HZ6A 1S44A 1G74A 2OL6O 4R0BA 1Y9TA 1MVGA 1GT3A 3EW2A 3AKNA 5LKEA 4AZMA 1O8VA 4A1HA 2ACPX 2HKDA 2RTFB 2RTCB 2X34A 3FYFA 3RY1A 5KICA 4FGIB 3IFBA 4OS3A 4ZHHA 3B2HA 1GT1A 4GNWA 4OKAA 3VG7A 1B56A 2OVDA 2Q39A 1IFBA 1DV9A 4FBRA 4IAWA 2VDFA 4GZVA 1QY1A 4GJVA 5D47A 3HOLA 5HZQA 1RSTB 1W6FA 4NLIA 3WOVA 2AKQA 4YDBA 1KQXA 3ZW1B 3IA8A 2RTBB 3RE5A 3C77X 2LFOA 2M4LA 2FT9A 2K62A 1HQQA 3B2JA 3U9PC 1GT4A 1KL5A 2X45A 3O22A 3WJDA 1VWCB 1BM5A 1DZPA 1UREA 1VYOA 2PI3O 2AT6X 1ERXA 4O4OA 4WFVA 3PQSA 4GGTA 3ZZVA 2FKJA 4Z2VA 1EI5A 4BBOA 2CZTA 2WEWA 3PEDA 1NC9A 3BDRA 2DM5A 1YWDA 1FEMA 1E2TA 5H9NA 1HN2A 4IBAA 4CPHA 5B5FA 1PBOA 3VHHA 2A2GA 1MUPA 3KQ0A 1EALA 2ANSA 2P8GA 1SRGA 4BX5B 3NQKA 3SZIA 1LDQA 2OZQA 3RWXA 1OEKA 1SLDB 2R73A 3BX7A 2JW1A 5D4AA 3RDXA 5LJBA 3FENA 3TGBA 2Z4HA 1VYFA 4FQBB 1FTPA 2FTBA 3D9WA 4K19A 5H9LA 3BY0A 4MISA 4YGGA 4DNEA 3PP6A 1GXAA 3D4RA 1EUOA 4XMDA 1UZ2X 1LUQA 5F6ZA 4QQ1A 2MO5A 1BJ7A 4GGRA 4WHIA 4GDAA 5LJEA 1A18A 1MOYA 5B11O 1QFVA 3RY2A 2RN4A 1PBYA 1X8PA 1SRFA 1HMTA 1BBPA 1CBIA 3PPTA 3WJBA 2AT8X 3QQ2A 5HCCC 3C78X 2ACOA 3T6LA 1NQNA 3VG3A 1I9HA 2IZHB 1WBIA 5JD2A 2RTPB 1KZWA 5EEEA 2F73A 3K3LA 1W4TA 3ZI8A 1PM1X 3ZW0A 2JU7A 1GKAB 1KT6A 4YGHA 4NV8A 4BX7A 3PH5A 1G7NA 1TVQA 2PY1A 1RXKA 2ZSCA 2JU3A 2W2BA 1ALBA 4INNA 2QCBA 1VWFB 2UYWA 3D95A 2C1SA 1YP7A 1A2DA 2R74A 3C76X 3EBWA 5IRUA 1Y55X 2RCQA 4ORSA 1SWUA 5IXGA 1JJJA 2FS7A 1LCZA 1AELA 2CZUA 2X55A 3FA8A 2Y3EA 3SOTA 4AYHA 5DG4A 3V8UA 5HZ8A 1QG5A 2GTLM 2A5CA 1CBRA 3FIQA 3ZUOA 4GKCA 1SY3A 3T1DA 1VWMB 5L8OA 2RTKA 4O3WA 4UU3A 3BU1A 4ON1A 1AVEA 1VWKB 1EPAA 3P02A 4AW8A 1VWGB 2BT9A 1IW2A 4I60A 1A3YA 1KT7A 2QOSC 3CQNA 3NP1A 4MEEA 4Z28A 4HPDA 1VWLB 1SREA 3MVFA 1AB0A 3BU9A 3RDQA 1SRIA 1DF3A 3PECA 1GX8A 4LKTA 5HBSA 2OFMX 3S5VA 1STRB 2HNXA 4ORRA 4QZUA 4IB7A 4YKMA 4OMXA 4BX6A 3CBSA 4AZOA 4YBPA 1GT5A 3HPEA 2G79A 5K68A 2RTHB 1EIIA 1HMRA 5IRWA 2OY8A 4LZUA 4ZHCA 3N91A 2IZDB 3FA6A 4I3CA 3FMZA 2OF8A 2OF9A 1X71A 4U46A 1LIEA 5AJCA 2JU8A 3FIDA 2AT3X 4ALBA 2MM3A 2X32A 1I04A 2OY7A 3RDUA 4ZHGA 2IZAA 4I9SA 2HZRA 4IRWA 3TZSA 4NLJA 2A3FX 4JO6A 1JV4A 3TGCA 4KIIA 1EIOA 4OEMA 1U17A 4OELA 2JMBA 5B10O 4B55A 4O4UA 3P6DA 4CDFA 1VWOB 1HMSA 1VWBB 4HWMA 1STPA 2BSZA 2POAA 2WWPA 4JHQA 4KC7A 1HQPA 4GJSA 4YBUA 1SY1A 3NADA 2KD2A 1JQPA 3CQRA 2RTJA 2XKLA 1X8OA 4GE1A 4YVBA 4BCSA 5B2AO 3P6CA 4GD9A 3SAOA 1X8NA 3EM0A 4O3ZA 2IZFB 2ALLX 2GTLN 4GNYA 2OYBO 3WYQA 3VHMA 4YFRA 3PH6A 2QO5A 4U8UO 2JOZA 3RKGA 4GU8A 3STNA 2NNDA 2NP1A 5IO5A 2WEXA 3MM0A 1T8VA 3NBXX 1N43A 3WBGA 2BS6A 4FBOA 3PDFA 3ZW1A 1TXLA 2YG2A 1OBUA 4HPCA 1W5RA 3PK2A 2K23A 1LDOA 1EPBA 3FA9A 4TLJA 4COTA 1SY0A 3B2KA 2W2FA 5F1EA 3STKA 1LIFA 2MWHA 2KT4B 5B3MO 3P6FA 4YCHA 1VPRA 1Y52X 2IZIA 4I3BA 4YMYA 2RTIB 3JQOA 3APUA 1SLGB 5CHKA 4RUNA 4TJZA 3APXA 4Y0SA 1I05A 1S2PA 4GDZA 3WZPA 1FELA 1UYNX 4XMCA 2HLVA 3FR5A 3RBYA 1ZNEA 5FENA 5HTDA 5KIDA 4YKOA 3BS2A 2RTQB 4YFPA 2FHLA 2HZQA 4AZPA 4BX5A 3VGWA 1T0VA 2RA6A 1HBQA 1SRJA 2AT0X 1LCVA 4IB8A 1QFTA 1MDCA 4ARHA 1LIDA 4FBVA 2GC9A 4U9CA 4CDCA 2F01A 4TKBA 2CM9A 3BX8A 3WZOA 4Z27A 1CRBA 1XCAA 1ZRYA 4HPAA 3JSQA 5FQ6E 1SWKA 3FW4A 3RZYA 5F7GA 5BYPA 5CYBA 1DF8A 2AL0X 3Q34A 2FRSA 2VFBA 3Q6LA 5K67A 4ORUA 5HA0A 1D2UA 3FELA 4LQZA 3AKMA 1RAVA 1MK5A 2Q2MA 3D96A 5B27A 4D6AA 4QGXA 4TKJA 4NP1A 4OS0A 3F8AA 4GRJA 4YGZA 1LKEA 1SWRA 2Q2PA 1JMXA 1TOWA 2RTAA 2IZCB 2WSJA 4N7DA 3WVMA 2G8CO 4NW4A 1OEJA 3O19A 4TQ2A 3UEXA 1LF7A 1EQDA 1SY2A 3CR6A 1OEEA 3OJYC 3SZHA 3UEUA 3FEKA 3VG2A 1LICA 1VYGA 3APWA 3HWEA 3DSZA 1HBPA 1MX7A 2EU7X 4ORYA 5FFHA 4Y0PA 1D3SA 3QKGA 4XMHA 2LB6A 4QRLA 1YWCA 2OVSA 1EW3A 2MJIA 3RDOA 1IKJA 1N9MA 2X8SA 4JGLA 4NV7A 4QGWA 3ZQ3A 1BRPA 4OS8A 5EDCA 4XMGA 3UAQA 1ACDA 2XSTA 1K24A 3F9DA 5EZ2A 3EBKA 2HYSA 2G78A 4O4XA 1VWIB 2Y3FA 2Y32A 3KFHA 4L3RA 4MIRA 4YDAA 2RTOB 2A8GA 1ADLA 2A2UA 2RTEB 4KCAA 2OVAA 1RXHA 4IMNA 4BOEA 2RTMA 1VWQB 4DCBA 3KFGA 5HAEA 1N9YA 2FR2A 1SRHA 3VG4A 4O3XB 4AZRA 5HCEC 2OL8O 1JYDA 5BVSA 3CKGA 2X56A 1BRQA 1SWDA 4ORWA 3HK1A 1RXJA 1VWNB 3F6ZB 2IZJA 1IFCA 1ZNKA 2Z4IA 3MBTA 4I6SA 3UEWA 1BSOA 1QWDA 3ZW0B 1E00A 4ID2A 2ZAGA 3P24A 4DQ4A 2MF6A 2KTSA 1B0OA 3HWGA 3T2XA 1OBQA 3OE3A 5EDBA 4C5PA 3GE2A 3MG5A 2LA7A 1KFFA 2C4IA 3EW1A 3WJGA 4KT5A 1SLFB 1XKIA 1SWQA 1X8UA 3HOEA 5D48A 3S26A 1STSB 2ASNX 1SXYA 4Y5DA 5BVTA 1KGLA 1KZXA 1LCWA 4WFUA 1P6PA 2X8FA 2AF5A 4BQUA 2FR3A 3RE6A 3VE1A 5K06A 4BJ8A 5JR8A 2O62A 2BS5A 1NDJA 1G85A 2ZAIA 3EYCA 3KFFA 5HTEA 1HXZA 2E4JA 2IZGB 4M7MA 2L5PA 2JN3A 2X8TA 4LZVA 3GAQA 5EEDA 5F2BA 3PQUA 4CDDA 5IO7A 4Y59A 1JJUA 1SXXA 3T2WA 3VPJE 3WYPA 1U18A 1I06A 2NNQA 2RTDB 4QGVA 3L4RA 4TNNA 2GTFX 1VWHB 4A1YA 2W2AA 4U8UM 2GJ5A 4CPIA 1SA8A 2IZEB 3G7XA 5IO6A 3U03A 1SMPI 3ELXA 1NGLA 4I9RA 1NP1A 1OPAA 4ES7A 4CPFA
chains in the Genus database with same CATH topology
4L1NA 4ZFXA 4XMFA 4IB6A 4NYQA 1N0SA 1LPJA 3BRNA 1KT5A 3WXQA 3JS1A 4EXZA 2OVEA 3CMPA 4D6BA 3VU1A 1AQBA 5H8TA 4I3DA 2KTDA 1ZNLA 3KZAA 4ZH6A 5FQ7E 4ORXA 3ZUIA 1SXUA 5CE4A 1BSYA 3NQ3A 1A57A 3P6HA 2A0AA 1FE3A 4GK9A 2AH7X 1T68X 2Q4NA 3P6GA 4ZCBA 4O49A 1B4MA 4MVEA 4TKHA 3ZW2A 3B2IA 5L8NA 1SXWA 4ZGUA 2BLGA 1G5WA 4ML7B 4ODDA 2YMSA 4WBKA 1B8EA 4EEJA 4O4SA 2CBSA 3WJEA 4NNSA 4IMOA 2AT5X 3STMX 1ZNHA 1X8QA 4UU2A 1L6MA 2MHDA 1OPBA 2L67A 2FWVA 3E3CA 1KT4A 4NYRA 4EDEA 1DC9A 5EPQA 1GM6A 1YWAA 1JJXA 1S7DA 3TGAA 3S60A 4KH8A 3FEPA 1DFVA 4U8UN 1ICMA 3CBCA 4ZHDA 3HWDA 4IAXA 4O9SA 4MVKA 1EXSA 4I95A 4QNIA 3U0DA 2LBVA 1CBQA 1QQSA 1KQWA 3FLLA 3EMMA 5AQ6A 1FENA 4DQ3A 5BVQA 3APVA 4OMWA 4ZH9A 1YIVA 2WUTA 2RD7C 2WQAE 3S5XA 1ERBA 3VG5A 1KOIA 4A8ZA 4A60A 4EQAC 2QMIA 2QO4A 1QABE 1GKAA 1GX9A 1TOUA 4YCEA 4EFGA 5K06A 3ELZA 3LV4A 1JZUA 1ICNA 4LKPA 5LKFA 4CSBA 3FW5A 5FQ8E 3H3IA 1YWBA 3WJCA 4CV7A 1JBHA 5LJKA 1QY2A 3B2LA 1I4UA 3D97A 4U3QA 5LJGA 1PEEA 2WQ9A 4QZTA 4HFOA 3FR4A 1PMPA 4YH0A 1OBPA 1QY0A 1ZNDA 5D45A 1GGLA 4Y0RA 4AZNA 4XMEA 2HMBA 1R0UA 2QO6A 5H9AA 5C0NA 2LBAA 1FDQA 4N7CA 3VG6A 3KFIA 4KC8A 1U0XA 2WR6A 3NX2A 4PJ2A 5D8JA 2BHVA 1JYJA 1KXOA 1E06A 2F09A 5F6BA 1LNMA 3BLGA 1YUPA 2L68A 4MVLA 4RUUA 3WJFA 2L9CA 3DTQA 1E02A 1IIUA 2N93A 3FA7A 5DPQA 3NR3A 2RQ0A 1O1VA 1CJ5A 4IABA 1X89A 5HZ9A 4MVIA 3CWKA 5HA1A 4CK4A 5KHPA 4NNTA 3NPOA 2FS6A 3I17A 5L8IA 5F58A 2CM4A 4ZR2A 1LIBA 3RSWA 2LKKA 3VE2A 4QYPA 1CBSA 2AMMX 3FR2A 1LFOA 2RCTA 5HCDC 1BSQA 4ZGFA 1JIWI 1ML7A 2A13A 3HTYA 3MX7A 1TW4A 3P6EA 1KT3A 3OD9A 3I0AA 1BEBA 3ZWEA 2IFBA 1E5PA 4GETA 5AEOA 4O3YA 5B29A 2Q9SA 3UEVA 1MX8A 3NX1A 1DZKA 2G7BA 2NNEA 3NQ9A 4GH7A 1DZMA 3LHNA 4QAEA 2GTLO 2FLJA 2KW1A 4BVMA 1AVGI 1Z24A 2OFRX 2QM9A 3BSZE 4ALOA 2R56A 1O1UA 1RBPA 4M6SA 5LJHA 1BLRA 4AZQA 1NP4A 5H9KA 1DZJA 4PSQA 3HWFA 5HWZA 2X46A 4QYNA 3O2YA 1Y9LA 4HPBA 1H91A 1RLBE 4ZJ0A 1ZNGA 1YP6A 1BWYA 2CBRA 4IB9A 3TF6A 5AJBA 5LJDA 4YFQA 4ZHFA 1IKEA 3OBLA 5FAZA 4Y0QA 5HZ5A 5HZ6A 1S44A 1G74A 4R0BA 1Y9TA 1MVGA 1GT3A 5LKEA 3AKNA 4AZMA 1O8VA 4A1HA 2ACPX 3FYFA 5KICA 4FGIB 3IFBA 4OS3A 4ZHHA 3B2HA 1GT1A 4GNWA 3VG7A 1B56A 2OVDA 2Q39A 1IFBA 1DV9A 4FBRA 4IAWA 4GZVA 1QY1A 5D47A 3HOLA 5HZQA 3WOVA 4NLIA 2AKQA 4YDBA 1KQXA 3ZW1B 3IA8A 3C77X 2LFOA 2M4LA 2FT9A 2K62A 3B2JA 3U9PC 1GT4A 2X45A 3O22A 3WJDA 1BM5A 1DZPA 1UREA 4WFVA 2AT6X 1ERXA 4O4OA 3PQSA 3ZZVA 1EI5A 2CZTA 2WEWA 3PEDA 3BDRA 2DM5A 1YWDA 1FEMA 5H9NA 1HN2A 4IBAA 1PBOA 2A2GA 1MUPA 3KQ0A 1EALA 2ANSA 2P8GA 3NQKA 2OZQA 3RWXA 1OEKA 2R73A 3BX7A 2JW1A 5D4AA 5LJBA 3TGBA 3FENA 2Z4HA 1VYFA 4FQBB 1FTPA 2FTBA 4K19A 5H9LA 3BY0A 4MISA 4YGGA 3PP6A 1GXAA 3D4RA 1EUOA 4XMDA 1UZ2X 5F6ZA 4QQ1A 2MO5A 1BJ7A 4WHIA 5LJEA 1A18A 1QFVA 2RN4A 1X8PA 3PPTA 1HMTA 1BBPA 1CBIA 3WJBA 5HCCC 2AT8X 5LJCA 3C78X 2ACOA 3VG3A 1KZWA 5EEEA 2F73A 3K3LA 3ZI8A 1PM1X 3ZW0A 2JU7A 1GKAB 1KT6A 4YGHA 3PH5A 1G7NA 1TVQA 2PY1A 2JU3A 2W2BA 1ALBA 4INNA 3D95A 2R74A 1YP7A 1A2DA 3C76X 3EBWA 2RCQA 4ORSA 1JJJA 2FS7A 1AELA 2CZUA 3FA8A 3SOTA 4AYHA 5DG4A 3V8UA 5HZ8A 2GTLM 1QG5A 3FIQA 1CBRA 3ZUOA 4GKCA 1SY3A 3T1DA 5L8OA 4O3WA 4UU3A 3BU1A 4ON1A 1EPAA 3P02A 4AW8A 2BT9A 1IW2A 1A3YA 1KT7A 2QOSC 3CQNA 3NP1A 4HPDA 3MVFA 1DF3A 1AB0A 3BU9A 3PECA 1GX8A 4LKTA 5HBSA 2OFMX 3S5VA 2HNXA 4QZUA 4ORRA 4IB7A 4YKMA 4OMXA 3CBSA 4AZOA 4YBPA 1GT5A 2G79A 1EIIA 1HMRA 4LZUA 4ZHCA 3N91A 3FA6A 4I3CA 3FMZA 1X71A 1LIEA 5AJCA 2JU8A 2AT3X 4ALBA 2MM3A 1I04A 4ZHGA 4I9SA 2HZRA 3TZSA 4NLJA 2A3FX 3TGCA 1JV4A 1EIOA 4KIIA 1U17A 2JMBA 4O4UA 3P6DA 1HMSA 4HWMA 2WWPA 2POAA 4KC7A 1HQPA 4YBUA 1SY1A 3NADA 2KD2A 3CQRA 2XKLA 1X8OA 4GE1A 3P6CA 3SAOA 1X8NA 3EM0A 4O3ZA 2ALLX 2GTLN 4GNYA 4YFRA 3PH6A 2QO5A 4U8UO 2JOZA 3RKGA 4GU8A 3STNA 2NNDA 2NP1A 5IO5A 2WEXA 1T8VA 3NBXX 3WBGA 2BS6A 4FBOA 3ZW1A 1TXLA 2YG2A 1OBUA 4HPCA 4COTA 2K23A 3FA9A 1EPBA 4TLJA 1SY0A 3B2KA 2W2FA 5F1EA 3STKA 1LIFA 2MWHA 2KT4B 3P6FA 4YCHA 1VPRA 4I3BA 4YMYA 3JQOA 3APUA 4RUNA 4TJZA 3APXA 4Y0SA 1I05A 1S2PA 4GDZA 4DQ4A 1FELA 4XMCA 5FENA 2HLVA 3FR5A 3RBYA 1ZNEA 5HTDA 5KIDA 4YKOA 3BS2A 4YFPA 4AZPA 2HZQA 1T0VA 2RA6A 1HBQA 2AT0X 4IB8A 1QFTA 1MDCA 4ARHA 1LIDA 4FBVA 2GC9A 4U9CA 4TKBA 2CM9A 3BX8A 1CRBA 1XCAA 1ZRYA 4HPAA 3JSQA 5FQ6E 3FW4A 3RZYA 5F7GA 5BYPA 5CYBA 2AL0X 3Q6LA 2FRSA 4ORUA 5HA0A 1D2UA 3FELA 4LQZA 3AKMA 3D96A 5B27A 2Q2MA 4D6AA 4QGXA 4TKJA 4NP1A 4OS0A 3F8AA 4GRJA 4YGZA 1LKEA 2Q2PA 1TOWA 2WSJA 4N7DA 3WVMA 4NW4A 1OEJA 3O19A 4TQ2A 3UEXA 1LF7A 1EQDA 1SY2A 3CR6A 1OEEA 3OJYC 3UEUA 3VG2A 3FEKA 1LICA 1VYGA 3APWA 3HWEA 3DSZA 1HBPA 1MX7A 2EU7X 4ORYA 5FFHA 4Y0PA 1D3SA 3QKGA 4XMHA 2LB6A 4QRLA 1YWCA 2OVSA 1EW3A 2MJIA 1IKJA 2X8SA 4JGLA 4QGWA 3ZQ3A 1BRPA 4OS8A 5EDCA 4XMGA 3UAQA 1ACDA 2XSTA 3F9DA 5EZ2A 3EBKA 2HYSA 2G78A 4O4XA 3KFHA 4L3RA 4MIRA 4YDAA 1ADLA 2A2UA 4KCAA 2OVAA 4IMNA 4BOEA 3KFGA 5HAEA 2FR2A 3VG4A 4AZRA 4O3XB 5HCEC 1JYDA 5BVSA 1BRQA 4ORWA 3HK1A 3F6ZB 1IFCA 1ZNKA 2Z4IA 3MBTA 4I6SA 3UEWA 1BSOA 1QWDA 3ZW0B 1E00A 4ID2A 2ZAGA 3P24A 2KTSA 1B0OA 3HWGA 1OBQA 3OE3A 5EDBA 3GE2A 2LA7A 3WJGA 4KT5A 1XKIA 5D48A 1X8UA 3HOEA 3S26A 2ASNX 1SXYA 5BVTA 1KGLA 1KZXA 4WFUA 1P6PA 2X8FA 4BQUA 2FR3A 3VE1A 5JR8A 2O62A 2BS5A 3EYCA 1G85A 2ZAIA 3KFFA 5HTEA 2E4JA 4M7MA 2L5PA 2JN3A 2X8TA 4LZVA 3GAQA 5EEDA 3PQUA 5IO7A 1SXXA 3VPJE 1U18A 1I06A 2NNQA 4QGVA 3L4RA 4TNNA 2GTFX 4A1YA 2W2AA 4U8UM 2GJ5A 1SA8A 3G7XA 5IO6A 3U03A 1SMPI 3ELXA 1NGLA 4I9RA 1NP1A 1OPAA 4ES7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZFX A;  4XMF A;  4IB6 A;  4NYQ A;  1N0S A;  1LPJ A;  3BRN A;  1KT5 A;  3WXQ A;  3JS1 A;  4EXZ A;  2OVE A;  3CMP A;  4D6B A;  1AQB A;  5H8T A;  4I3D A;  2KTD A;  1ZNL A;  3KZA A;  4ZH6 A;  4ORX A;  3ZUI A;  1SXU A;  5CE4 A;  1BSY A;  3NQ3 A;  1A57 A;  3P6H A;  2A0A A;  1FE3 A;  2AH7 X;  1T68 X;  2Q4N A;  3P6G A;  4ZCB A;  1B4M A;  4TKH A;  3B2I A;  5L8N A;  1SXW A;  4ZGU A;  2BLG A;  1G5W A;  4ODD A;  4WBK A;  1B8E A;  4EEJ A;  2CBS A;  3WJE A;  4NNS A;  4IMO A;  2AT5 X;  3STM X;  1ZNH A;  1X8Q A;  4UU2 A;  1L6M A;  1OPB A;  2L67 A;  2FWV A;  1KT4 A;  4NYR A;  4EDE A;  1DC9 A;  5EPQ A;  1GM6 A;  1YWA A;  1JJX A;  1S7D A;  3TGA A;  3FEP A;  1DFV A;  4ZHD A;  1ICM A;  3CBC A;  3HWD A;  4IAX A;  4O9S A;  4MVK A;  1EXS A;  3U0D A;  2LBV A;  1CBQ A;  1QQS A;  1KQW A;  3FLL A;  3EMM A;  5AQ6 A;  1FEN A;  4DQ3 A;  5BVQ A;  3APV A;  4OMW A;  4ZH9 A;  1YIV A;  2WUT A;  2RD7 C;  2WQA E;  1ERB A;  3VG5 A;  1KOI A;  4A8Z A;  4A60 A;  2QO4 A;  1QAB E;  1GKA A;  1GX9 A;  1TOU A;  4YCE A;  4EFG A;  5K06 A;  3ELZ A;  1JZU A;  1ICN A;  4LKP A;  5LKF A;  3FW5 A;  1YWB A;  3WJC A;  1JBH A;  5LJK A;  1QY2 A;  3B2L A;  1I4U A;  3D97 A;  5LJG A;  1PEE A;  2WQ9 A;  4QZT A;  4HFO A;  3FR4 A;  1PMP A;  4YH0 A;  1OBP A;  1QY0 A;  1ZND A;  5D45 A;  1GGL A;  4Y0R A;  4AZN A;  4XME A;  2HMB A;  1R0U A;  2QO6 A;  5H9A A;  5C0N A;  2LBA A;  1FDQ A;  4N7C A;  3VG6 A;  3KFI A;  1U0X A;  2WR6 A;  3NX2 A;  5D8J A;  1JYJ A;  1KXO A;  1E06 A;  5F6B A;  1LNM A;  3BLG A;  1YUP A;  2L68 A;  4MVL A;  4RUU A;  3WJF A;  2L9C A;  3DTQ A;  1E02 A;  1IIU A;  2N93 A;  3FA7 A;  5DPQ A;  3NR3 A;  2RQ0 A;  1O1V A;  1CJ5 A;  1X89 A;  5HZ9 A;  4MVI A;  3CWK A;  5HA1 A;  4CK4 A;  5KHP A;  4NNT A;  3NPO A;  2FS6 A;  3I17 A;  5L8I A;  5F58 A;  2CM4 A;  4ZR2 A;  1LIB A;  3RSW A;  2LKK A;  4QYP A;  1CBS A;  2AMM X;  3FR2 A;  1LFO A;  2RCT A;  5HCD C;  1BSQ A;  1ML7 A;  2A13 A;  1TW4 A;  3P6E A;  1KT3 A;  3I0A A;  1BEB A;  2IFB A;  1E5P A;  4GET A;  5B29 A;  2Q9S A;  3UEV A;  1MX8 A;  3NX1 A;  1DZK A;  2G7B A;  2NNE A;  3NQ9 A;  4GH7 A;  1DZM A;  4QAE A;  2FLJ A;  4BVM A;  1AVG I;  1Z24 A;  2OFR X;  2QM9 A;  3BSZ E;  4ALO A;  2R56 A;  1O1U A;  1RBP A;  4M6S A;  5LJH A;  1BLR A;  4AZQ A;  1NP4 A;  5H9K A;  1DZJ A;  4PSQ A;  3HWF A;  5HWZ A;  2X46 A;  4QYN A;  3O2Y A;  4HPB A;  1H91 A;  1RLB E;  4ZJ0 A;  1ZNG A;  1YP6 A;  1BWY A;  2CBR A;  4IB9 A;  3TF6 A;  5LJD A;  4YFQ A;  4ZHF A;  1IKE A;  5FAZ A;  4Y0Q A;  5HZ5 A;  5HZ6 A;  1S44 A;  1G74 A;  4R0B A;  1MVG A;  1GT3 A;  5LKE A;  3AKN A;  4AZM A;  1O8V A;  4A1H A;  2ACP X;  5KIC A;  4OS3 A;  3IFB A;  4ZHH A;  3B2H A;  1GT1 A;  4GNW A;  3VG7 A;  1B56 A;  2OVD A;  2Q39 A;  1IFB A;  1DV9 A;  4IAW A;  5D47 A;  1QY1 A;  5HZQ A;  4NLI A;  2AKQ A;  4YDB A;  1KQX A;  3IA8 A;  3C77 X;  2LFO A;  2FT9 A;  2K62 A;  3B2J A;  3U9P C;  1GT4 A;  2X45 A;  3O22 A;  3WJD A;  1BM5 A;  1DZP A;  1URE A;  4WFV A;  2AT6 X;  1ERX A;  2CZT A;  2WEW A;  3PED A;  3BDR A;  2DM5 A;  1YWD A;  1FEM A;  5H9N A;  1HN2 A;  4IBA A;  1PBO A;  2A2G A;  1MUP A;  3KQ0 A;  1EAL A;  2ANS A;  2P8G A;  2OZQ A;  1OEK A;  2R73 A;  3BX7 A;  5D4A A;  5LJB A;  3TGB A;  3FEN A;  1VYF A;  1FTP A;  2FTB A;  4K19 A;  5H9L A;  3BY0 A;  4YGG A;  3PP6 A;  1GXA A;  1EUO A;  4XMD A;  1UZ2 X;  5F6Z A;  2MO5 A;  1BJ7 A;  5LJE A;  1A18 A;  1QFV A;  1X8P A;  3PPT A;  1HMT A;  1BBP A;  1CBI A;  3WJB A;  5HCC C;  2AT8 X;  5LJC A;  3C78 X;  2ACO A;  3VG3 A;  1KZW A;  5EEE A;  2F73 A;  3K3L A;  1PM1 X;  2JU7 A;  1GKA B;  1KT6 A;  4YGH A;  3PH5 A;  1G7N A;  1TVQ A;  2PY1 A;  2JU3 A;  2W2B A;  1ALB A;  3D95 A;  2R74 A;  1YP7 A;  1A2D A;  3C76 X;  3EBW A;  2RCQ A;  4ORS A;  1JJJ A;  2FS7 A;  1AEL A;  2CZU A;  3FA8 A;  4AYH A;  5DG4 A;  5HZ8 A;  1QG5 A;  3FIQ A;  3ZUO A;  1CBR A;  4GKC A;  1SY3 A;  3T1D A;  5L8O A;  4UU3 A;  3BU1 A;  1EPA A;  4AW8 A;  1IW2 A;  1A3Y A;  1KT7 A;  2QOS C;  3CQN A;  3NP1 A;  4HPD A;  3MVF A;  1DF3 A;  1AB0 A;  3BU9 A;  3PEC A;  1GX8 A;  4LKT A;  5HBS A;  2OFM X;  2HNX A;  4QZU A;  4ORR A;  4IB7 A;  4YKM A;  4OMX A;  3CBS A;  4AZO A;  4YBP A;  1GT5 A;  2G79 A;  1EII A;  1HMR A;  4LZU A;  4ZHC A;  3FA6 A;  4I3C A;  3FMZ A;  1X71 A;  1LIE A;  2JU8 A;  2AT3 X;  4ALB A;  2MM3 A;  1I04 A;  4ZHG A;  4I9S A;  2HZR A;  3TZS A;  4NLJ A;  2A3F X;  3TGC A;  1JV4 A;  1EIO A;  4KII A;  1U17 A;  3P6D A;  1HMS A;  2WWP A;  2POA A;  1HQP A;  4YBU A;  1SY1 A;  3NAD A;  3CQR A;  2XKL A;  1X8O A;  4GE1 A;  3P6C A;  3SAO A;  1X8N A;  3EM0 A;  2ALL X;  4GNY A;  4YFR A;  3PH6 A;  2QO5 A;  2JOZ A;  3STN A;  5IO5 A;  2NND A;  2NP1 A;  2WEX A;  1T8V A;  3WBG A;  1TXL A;  2YG2 A;  1OBU A;  4HPC A;  2K23 A;  3FA9 A;  1EPB A;  4TLJ A;  1SY0 A;  3B2K A;  2W2F A;  5F1E A;  3STK A;  1LIF A;  2KT4 B;  3P6F A;  4YCH A;  1VPR A;  4I3B A;  4YMY A;  3APU A;  4RUN A;  4TJZ A;  3APX A;  4Y0S A;  1I05 A;  1S2P A;  4DQ4 A;  5FEN A;  1FEL A;  4XMC A;  2HLV A;  3FR5 A;  1ZNE A;  5HTD A;  5KID A;  4YKO A;  3BS2 A;  4YFP A;  4AZP A;  2HZQ A;  1T0V A;  2RA6 A;  1HBQ A;  2AT0 X;  4IB8 A;  1QFT A;  1MDC A;  4ARH A;  1LID A;  2GC9 A;  4TKB A;  2CM9 A;  3BX8 A;  1CRB A;  1XCA A;  1ZRY A;  4HPA A;  3JSQ A;  3FW4 A;  3RZY A;  5F7G A;  2AL0 X;  3Q6L A;  2FRS A;  4ORU A;  5HA0 A;  1D2U A;  3FEL A;  3AKM A;  3D96 A;  5B27 A;  2Q2M A;  4D6A A;  4QGX A;  4TKJ A;  4NP1 A;  4OS0 A;  3F8A A;  4GRJ A;  4YGZ A;  1LKE A;  2Q2P A;  1TOW A;  2WSJ A;  4N7D A;  3WVM A;  1OEJ A;  3O19 A;  4TQ2 A;  3UEX A;  1LF7 A;  1EQD A;  1SY2 A;  3CR6 A;  1OEE A;  3OJY C;  3UEU A;  3VG2 A;  3FEK A;  1LIC A;  1VYG A;  3APW A;  3HWE A;  3DSZ A;  1HBP A;  1MX7 A;  2EU7 X;  4ORY A;  5FFH A;  4Y0P A;  1D3S A;  3QKG A;  4XMH A;  2LB6 A;  1YWC A;  1EW3 A;  2MJI A;  1IKJ A;  4QGW A;  3ZQ3 A;  1BRP A;  4OS8 A;  5EDC A;  4XMG A;  1ACD A;  2XST A;  3F9D A;  5EZ2 A;  3EBK A;  2HYS A;  2G78 A;  3KFH A;  4YDA A;  1ADL A;  2A2U A;  4BOE A;  2OVA A;  4IMN A;  3KFG A;  5HAE A;  2FR2 A;  3VG4 A;  4AZR A;  5HCE C;  1JYD A;  5BVS A;  1BRQ A;  4ORW A;  3HK1 A;  1IFC A;  1ZNK A;  3MBT A;  3UEW A;  1BSO A;  1QWD A;  1E00 A;  1B0O A;  3HWG A;  1OBQ A;  5EDB A;  3WJG A;  1XKI A;  5D48 A;  1X8U A;  3S26 A;  2ASN X;  1SXY A;  5BVT A;  1KGL A;  1KZX A;  4WFU A;  1P6P A;  4BQU A;  2FR3 A;  5JR8 A;  2O62 A;  3EYC A;  1G85 A;  3KFF A;  5HTE A;  2E4J A;  4M7M A;  2L5P A;  2JN3 A;  4LZV A;  3GAQ A;  5EED A;  5IO7 A;  1SXX A;  1U18 A;  1I06 A;  2NNQ A;  4QGV A;  3L4R A;  4TNN A;  2GTF X;  4A1Y A;  2W2A A;  2GJ5 A;  1SA8 A;  3G7X A;  5IO6 A;  3U03 A;  3ELX A;  1NGL A;  4I9R A;  1NP1 A;  1OPA A;  4ES7 A; 
#chains in the Genus database with same CATH topology
 2CAM A;  4L1N A;  4ZFX A;  4XMF A;  4IB6 A;  4NYQ A;  1N0S A;  1LPJ A;  3BRN A;  3LTW A;  1KT5 A;  3WXQ A;  3JS1 A;  4EXZ A;  2DJG A;  2OVE A;  1SWT A;  3CMP A;  4D6B A;  3VU1 A;  1AQB A;  5H8T A;  4I3D A;  2KTD A;  1ZNL A;  3KZA A;  5CSE A;  4ZH6 A;  5FQ7 E;  2RTL A;  2BC3 A;  4ORX A;  1I78 A;  3ZUI A;  1SXU A;  5CE4 A;  1BSY A;  1HY2 A;  1SWP A;  3NQ3 A;  3P6H A;  3X00 A;  1A57 A;  2A0A A;  1FE3 A;  4GK9 A;  4JNJ A;  2AH7 X;  1T68 X;  2Q4N A;  3P6G A;  4ZCB A;  4O49 A;  1B4M A;  1AVD A;  4MVE A;  4TKH A;  3ZW2 A;  3B2I A;  1SWN A;  5L8N A;  3VHI A;  1SXW A;  4ZGU A;  1GX3 A;  2BLG A;  4ML7 B;  1G5W A;  3AEH A;  4ODD A;  2YMS A;  4WBK A;  1B8E A;  4EEJ A;  5L3Y A;  4O4S A;  1SWL A;  2CBS A;  1VWE B;  3WJE A;  4NNS A;  3AUM O;  4IMO A;  2AT5 X;  3STM X;  2FKG A;  1ZNH A;  2RTG B;  1X8Q A;  4UU2 A;  1L6M A;  2MHD A;  1OPB A;  2FWV A;  2L67 A;  3E3C A;  4GUZ A;  1KT4 A;  4NYR A;  4EDE A;  1DC9 A;  5EPQ A;  4CDE A;  1GM6 A;  1YWA A;  1JJX A;  1VWR B;  1S7D A;  3TGA A;  3S60 A;  4KH8 A;  3FEP A;  1DFV A;  4U8U N;  1ICM A;  3CBC A;  4ZHD A;  5LJC A;  3HWD A;  4IAX A;  4O9S A;  4EKV A;  4MVK A;  5IRA A;  1EXS A;  4I95 A;  4QNI A;  3U0D A;  2LBV A;  1SWO A;  2QOM A;  1CBQ A;  1QQS A;  1SWH A;  2RTN B;  1KQW A;  3FLL A;  3EMM A;  5AQ6 A;  1FEN A;  4DQ3 A;  5BVQ A;  3APV A;  4OMW A;  4ZH9 A;  1IJ8 A;  1YIV A;  2WUT A;  3FDC A;  2RD7 C;  2IZK A;  4CPH B;  2WQA E;  2OY5 O;  4BGF A;  2JGS A;  1ERB A;  2IZL B;  3S5X A;  3VG5 A;  1KOI A;  2AVI A;  4A8Z A;  4A60 A;  4EQA C;  2QMI A;  2QO4 A;  1WUB A;  1QAB E;  1GKA A;  1GX9 A;  1RSU B;  1TOU A;  4YCE A;  3ELZ A;  3LV4 A;  4EFG A;  1ICN A;  4LKP A;  5LKF A;  4CSB A;  3FW5 A;  5FQ8 E;  4Z2P A;  1SWS A;  3H3I A;  1N4J A;  1YWB A;  3CKF A;  3WJC A;  4CV7 A;  1JBH A;  5LJK A;  1QY2 A;  2OY1 O;  3B2L A;  2A5B A;  1I4U A;  3D97 A;  1Y0G A;  4U3Q A;  5LJG A;  1PEE A;  2WQ9 A;  4QZT A;  4HFO A;  1PTS A;  1PMP A;  3FR4 A;  1OBP A;  4YH0 A;  1QY0 A;  1ZND A;  5D45 A;  1GGL A;  1SLE B;  1LEL A;  3RDS A;  4Y0R A;  4AZN A;  5HCD C;  4XME A;  2HMB A;  1R0U A;  2QO6 A;  5H9A A;  5C0N A;  2DJF A;  2LBA A;  1FDQ A;  4N7C A;  3VG6 A;  3KFI A;  1K3B A;  1U0X A;  4KC8 A;  2WR6 A;  3NX2 A;  4PJ2 A;  5D8J A;  2BHV A;  1JYJ A;  1KXO A;  1E06 A;  2F09 A;  5F6B A;  1LNM A;  3BLG A;  1YUP A;  2L68 A;  4MVL A;  4RUU A;  3WJF A;  1NBX A;  4BX7 B;  1JMZ A;  2L9C A;  3DTQ A;  1E02 A;  1IIU A;  1N7Y A;  1OSP O;  2N93 A;  3FA7 A;  1MEP A;  5DPQ A;  3RDM A;  3SLT A;  1UYO X;  3NR3 A;  2RQ0 A;  1O1V A;  1SWC A;  1CJ5 A;  4IAB A;  1X89 A;  5HZ9 A;  2OL7 A;  4MVI A;  1Y53 X;  1FJ1 E;  3CWK A;  5HA1 A;  1VWP B;  4CK4 A;  5KHP A;  3SZJ A;  4NNT A;  3NPO A;  1VWJ B;  2FS6 A;  3I17 A;  5L8I A;  3SLO A;  5F58 A;  2CM4 A;  4ZR2 A;  1LIB A;  3RSW A;  2LKK A;  2VFC A;  3VE2 A;  4QYP A;  1CBS A;  2AMM X;  3FR2 A;  1LFO A;  2RCT A;  2RTR B;  1BSQ A;  4CPE A;  4ZGF A;  1JIW I;  1KL4 A;  1ML7 A;  2A13 A;  3HTY A;  3MX7 A;  1TW4 A;  3P6E A;  4Z2O A;  1SWB A;  1KT3 A;  3OD9 A;  2UZ2 A;  2OFB A;  3I0A A;  1BEB A;  3ZWE A;  2FGS A;  2IFB A;  1E5P A;  4GET A;  2OFA A;  5AEO A;  4O3Y A;  5B29 A;  2C1Q A;  2Q9S A;  3UEV A;  1MX8 A;  3NX1 A;  2G5L A;  1DZK A;  2G7B A;  2NNE A;  3NQ9 A;  4GH7 A;  1DZM A;  1SWG A;  3LHN A;  4QAE A;  1VWA B;  2GTL O;  3WZN A;  2FLJ A;  2KW1 A;  4BVM A;  1AVG I;  2X4M A;  1JZU A;  1Z24 A;  2OFR X;  2QM9 A;  3BSZ E;  4ALO A;  4BX6 B;  2WPU A;  2R56 A;  1SWA A;  1O1U A;  1RBP A;  4M6S A;  1VWD B;  5LJH A;  1BLR A;  4AZQ A;  1NP4 A;  5H9K A;  1DZJ A;  4PSQ A;  3WZQ A;  1SWJ A;  3HWF A;  5B5G A;  5HWZ A;  2I5V O;  2X46 A;  4QYN A;  3O2Y A;  2IZB A;  1NQM A;  1Y9L A;  4HPB A;  1H91 A;  1RLB E;  2GH7 A;  4ZJ0 A;  1ZNG A;  1HXL A;  1YP6 A;  2CBR A;  1BWY A;  1SWF A;  3KVN A;  4GGZ A;  4IB9 A;  3TF6 A;  5AJB A;  5LJD A;  3T6F A;  2FHN X;  4YFQ A;  1SWE A;  4Z6J A;  1MM9 A;  3SLJ A;  4ZHF A;  2I5Z O;  1IKE A;  1KL3 A;  3OBL A;  5FAZ A;  4Y0Q A;  3EC5 A;  5HZ5 A;  5HZ6 A;  1S44 A;  1G74 A;  2OL6 O;  4R0B A;  1Y9T A;  1MVG A;  1GT3 A;  3EW2 A;  3AKN A;  5LKE A;  4AZM A;  1O8V A;  4A1H A;  2ACP X;  2HKD A;  2RTF B;  2RTC B;  2X34 A;  3FYF A;  3RY1 A;  5KIC A;  4FGI B;  3IFB A;  4OS3 A;  4ZHH A;  3B2H A;  1GT1 A;  4GNW A;  4OKA A;  3VG7 A;  1B56 A;  2OVD A;  2Q39 A;  1IFB A;  1DV9 A;  4FBR A;  4IAW A;  2VDF A;  4GZV A;  1QY1 A;  4GJV A;  5D47 A;  3HOL A;  5HZQ A;  1RST B;  1W6F A;  4NLI A;  3WOV A;  2AKQ A;  4YDB A;  1KQX A;  3ZW1 B;  3IA8 A;  2RTB B;  3RE5 A;  3C77 X;  2LFO A;  2M4L A;  2FT9 A;  2K62 A;  1HQQ A;  3B2J A;  3U9P C;  1GT4 A;  1KL5 A;  2X45 A;  3O22 A;  3WJD A;  1VWC B;  1BM5 A;  1DZP A;  1URE A;  1VYO A;  2PI3 O;  2AT6 X;  1ERX A;  4O4O A;  4WFV A;  3PQS A;  4GGT A;  3ZZV A;  2FKJ A;  4Z2V A;  1EI5 A;  4BBO A;  2CZT A;  2WEW A;  3PED A;  1NC9 A;  3BDR A;  2DM5 A;  1YWD A;  1FEM A;  1E2T A;  5H9N A;  1HN2 A;  4IBA A;  4CPH A;  5B5F A;  1PBO A;  3VHH A;  2A2G A;  1MUP A;  3KQ0 A;  1EAL A;  2ANS A;  2P8G A;  1SRG A;  4BX5 B;  3NQK A;  3SZI A;  1LDQ A;  2OZQ A;  3RWX A;  1OEK A;  1SLD B;  2R73 A;  3BX7 A;  2JW1 A;  5D4A A;  3RDX A;  5LJB A;  3FEN A;  3TGB A;  2Z4H A;  1VYF A;  4FQB B;  1FTP A;  2FTB A;  3D9W A;  4K19 A;  5H9L A;  3BY0 A;  4MIS A;  4YGG A;  4DNE A;  3PP6 A;  1GXA A;  3D4R A;  1EUO A;  4XMD A;  1UZ2 X;  1LUQ A;  5F6Z A;  4QQ1 A;  2MO5 A;  1BJ7 A;  4GGR A;  4WHI A;  4GDA A;  5LJE A;  1A18 A;  1MOY A;  5B11 O;  1QFV A;  3RY2 A;  2RN4 A;  1PBY A;  1X8P A;  1SRF A;  1HMT A;  1BBP A;  1CBI A;  3PPT A;  3WJB A;  2AT8 X;  3QQ2 A;  5HCC C;  3C78 X;  2ACO A;  3T6L A;  1NQN A;  3VG3 A;  1I9H A;  2IZH B;  1WBI A;  5JD2 A;  2RTP B;  1KZW A;  5EEE A;  2F73 A;  3K3L A;  1W4T A;  3ZI8 A;  1PM1 X;  3ZW0 A;  2JU7 A;  1GKA B;  1KT6 A;  4YGH A;  4NV8 A;  4BX7 A;  3PH5 A;  1G7N A;  1TVQ A;  2PY1 A;  1RXK A;  2ZSC A;  2JU3 A;  2W2B A;  1ALB A;  4INN A;  2QCB A;  1VWF B;  2UYW A;  3D95 A;  2C1S A;  1YP7 A;  1A2D A;  2R74 A;  3C76 X;  3EBW A;  5IRU A;  1Y55 X;  2RCQ A;  4ORS A;  1SWU A;  5IXG A;  1JJJ A;  2FS7 A;  1LCZ A;  1AEL A;  2CZU A;  2X55 A;  3FA8 A;  2Y3E A;  3SOT A;  4AYH A;  5DG4 A;  3V8U A;  5HZ8 A;  1QG5 A;  2GTL M;  2A5C A;  1CBR A;  3FIQ A;  3ZUO A;  4GKC A;  1SY3 A;  3T1D A;  1VWM B;  5L8O A;  2RTK A;  4O3W A;  4UU3 A;  3BU1 A;  4ON1 A;  1AVE A;  1VWK B;  1EPA A;  3P02 A;  4AW8 A;  1VWG B;  2BT9 A;  1IW2 A;  4I60 A;  1A3Y A;  1KT7 A;  2QOS C;  3CQN A;  3NP1 A;  4MEE A;  4Z28 A;  4HPD A;  1VWL B;  1SRE A;  3MVF A;  1AB0 A;  3BU9 A;  3RDQ A;  1SRI A;  1DF3 A;  3PEC A;  1GX8 A;  4LKT A;  5HBS A;  2OFM X;  3S5V A;  1STR B;  2HNX A;  4ORR A;  4QZU A;  4IB7 A;  4YKM A;  4OMX A;  4BX6 A;  3CBS A;  4AZO A;  4YBP A;  1GT5 A;  3HPE A;  2G79 A;  5K68 A;  2RTH B;  1EII A;  1HMR A;  5IRW A;  2OY8 A;  4LZU A;  4ZHC A;  3N91 A;  2IZD B;  3FA6 A;  4I3C A;  3FMZ A;  2OF8 A;  2OF9 A;  1X71 A;  4U46 A;  1LIE A;  5AJC A;  2JU8 A;  3FID A;  2AT3 X;  4ALB A;  2MM3 A;  2X32 A;  1I04 A;  2OY7 A;  3RDU A;  4ZHG A;  2IZA A;  4I9S A;  2HZR A;  4IRW A;  3TZS A;  4NLJ A;  2A3F X;  4JO6 A;  1JV4 A;  3TGC A;  4KII A;  1EIO A;  4OEM A;  1U17 A;  4OEL A;  2JMB A;  5B10 O;  4B55 A;  4O4U A;  3P6D A;  4CDF A;  1VWO B;  1HMS A;  1VWB B;  4HWM A;  1STP A;  2BSZ A;  2POA A;  2WWP A;  4JHQ A;  4KC7 A;  1HQP A;  4GJS A;  4YBU A;  1SY1 A;  3NAD A;  2KD2 A;  1JQP A;  3CQR A;  2RTJ A;  2XKL A;  1X8O A;  4GE1 A;  4YVB A;  4BCS A;  5B2A O;  3P6C A;  4GD9 A;  3SAO A;  1X8N A;  3EM0 A;  4O3Z A;  2IZF B;  2ALL X;  2GTL N;  4GNY A;  2OYB O;  3WYQ A;  3VHM A;  4YFR A;  3PH6 A;  2QO5 A;  4U8U O;  2JOZ A;  3RKG A;  4GU8 A;  3STN A;  2NND A;  2NP1 A;  5IO5 A;  2WEX A;  3MM0 A;  1T8V A;  3NBX X;  1N43 A;  3WBG A;  2BS6 A;  4FBO A;  3PDF A;  3ZW1 A;  1TXL A;  2YG2 A;  1OBU A;  4HPC A;  1W5R A;  3PK2 A;  2K23 A;  1LDO A;  1EPB A;  3FA9 A;  4TLJ A;  4COT A;  1SY0 A;  3B2K A;  2W2F A;  5F1E A;  3STK A;  1LIF A;  2MWH A;  2KT4 B;  5B3M O;  3P6F A;  4YCH A;  1VPR A;  1Y52 X;  2IZI A;  4I3B A;  4YMY A;  2RTI B;  3JQO A;  3APU A;  1SLG B;  5CHK A;  4RUN A;  4TJZ A;  3APX A;  4Y0S A;  1I05 A;  1S2P A;  4GDZ A;  3WZP A;  1FEL A;  1UYN X;  4XMC A;  2HLV A;  3FR5 A;  3RBY A;  1ZNE A;  5FEN A;  5HTD A;  5KID A;  4YKO A;  3BS2 A;  2RTQ B;  4YFP A;  2FHL A;  2HZQ A;  4AZP A;  4BX5 A;  3VGW A;  1T0V A;  2RA6 A;  1HBQ A;  1SRJ A;  2AT0 X;  1LCV A;  4IB8 A;  1QFT A;  1MDC A;  4ARH A;  1LID A;  4FBV A;  2GC9 A;  4U9C A;  4CDC A;  2F01 A;  4TKB A;  2CM9 A;  3BX8 A;  3WZO A;  4Z27 A;  1CRB A;  1XCA A;  1ZRY A;  4HPA A;  3JSQ A;  5FQ6 E;  1SWK A;  3FW4 A;  3RZY A;  5F7G A;  5BYP A;  5CYB A;  1DF8 A;  2AL0 X;  3Q34 A;  2FRS A;  2VFB A;  3Q6L A;  5K67 A;  4ORU A;  5HA0 A;  1D2U A;  3FEL A;  4LQZ A;  3AKM A;  1RAV A;  1MK5 A;  2Q2M A;  3D96 A;  5B27 A;  4D6A A;  4QGX A;  4TKJ A;  4NP1 A;  4OS0 A;  3F8A A;  4GRJ A;  4YGZ A;  1LKE A;  1SWR A;  2Q2P A;  1JMX A;  1TOW A;  2RTA A;  2IZC B;  2WSJ A;  4N7D A;  3WVM A;  2G8C O;  4NW4 A;  1OEJ A;  3O19 A;  4TQ2 A;  3UEX A;  1LF7 A;  1EQD A;  1SY2 A;  3CR6 A;  1OEE A;  3OJY C;  3SZH A;  3UEU A;  3FEK A;  3VG2 A;  1LIC A;  1VYG A;  3APW A;  3HWE A;  3DSZ A;  1HBP A;  1MX7 A;  2EU7 X;  4ORY A;  5FFH A;  4Y0P A;  1D3S A;  3QKG A;  4XMH A;  2LB6 A;  4QRL A;  1YWC A;  2OVS A;  1EW3 A;  2MJI A;  3RDO A;  1IKJ A;  1N9M A;  2X8S A;  4JGL A;  4NV7 A;  4QGW A;  3ZQ3 A;  1BRP A;  4OS8 A;  5EDC A;  4XMG A;  3UAQ A;  1ACD A;  2XST A;  1K24 A;  3F9D A;  5EZ2 A;  3EBK A;  2HYS A;  2G78 A;  4O4X A;  1VWI B;  2Y3F A;  2Y32 A;  3KFH A;  4L3R A;  4MIR A;  4YDA A;  2RTO B;  2A8G A;  1ADL A;  2A2U A;  2RTE B;  4KCA A;  2OVA A;  1RXH A;  4IMN A;  4BOE A;  2RTM A;  1VWQ B;  4DCB A;  3KFG A;  5HAE A;  1N9Y A;  2FR2 A;  1SRH A;  3VG4 A;  4O3X B;  4AZR A;  5HCE C;  2OL8 O;  1JYD A;  5BVS A;  3CKG A;  2X56 A;  1BRQ A;  1SWD A;  4ORW A;  3HK1 A;  1RXJ A;  1VWN B;  3F6Z B;  2IZJ A;  1IFC A;  1ZNK A;  2Z4I A;  3MBT A;  4I6S A;  3UEW A;  1BSO A;  1QWD A;  3ZW0 B;  1E00 A;  4ID2 A;  2ZAG A;  3P24 A;  4DQ4 A;  2MF6 A;  2KTS A;  1B0O A;  3HWG A;  3T2X A;  1OBQ A;  3OE3 A;  5EDB A;  4C5P A;  3GE2 A;  3MG5 A;  2LA7 A;  1KFF A;  2C4I A;  3EW1 A;  3WJG A;  4KT5 A;  1SLF B;  1XKI A;  1SWQ A;  1X8U A;  3HOE A;  5D48 A;  3S26 A;  1STS B;  2ASN X;  1SXY A;  4Y5D A;  5BVT A;  1KGL A;  1KZX A;  1LCW A;  4WFU A;  1P6P A;  2X8F A;  2AF5 A;  4BQU A;  2FR3 A;  3RE6 A;  3VE1 A;  5K06 A;  4BJ8 A;  5JR8 A;  2O62 A;  2BS5 A;  1NDJ A;  1G85 A;  2ZAI A;  3EYC A;  3KFF A;  5HTE A;  1HXZ A;  2E4J A;  2IZG B;  4M7M A;  2L5P A;  2JN3 A;  2X8T A;  4LZV A;  3GAQ A;  5EED A;  5F2B A;  3PQU A;  4CDD A;  5IO7 A;  4Y59 A;  1JJU A;  1SXX A;  3T2W A;  3VPJ E;  3WYP A;  1U18 A;  1I06 A;  2NNQ A;  2RTD B;  4QGV A;  3L4R A;  4TNN A;  2GTF X;  1VWH B;  4A1Y A;  2W2A A;  4U8U M;  2GJ5 A;  4CPI A;  1SA8 A;  2IZE B;  3G7X A;  5IO6 A;  3U03 A;  1SMP I;  3ELX A;  1NGL A;  4I9R A;  1NP1 A;  1OPA A;  4ES7 A;  4CPF A; 
#chains in the Genus database with same CATH homology
 4L1N A;  4ZFX A;  4XMF A;  4IB6 A;  4NYQ A;  1N0S A;  1LPJ A;  3BRN A;  1KT5 A;  3WXQ A;  3JS1 A;  4EXZ A;  2OVE A;  3CMP A;  4D6B A;  3VU1 A;  1AQB A;  5H8T A;  4I3D A;  2KTD A;  1ZNL A;  3KZA A;  4ZH6 A;  5FQ7 E;  4ORX A;  3ZUI A;  1SXU A;  5CE4 A;  1BSY A;  3NQ3 A;  1A57 A;  3P6H A;  2A0A A;  1FE3 A;  4GK9 A;  2AH7 X;  1T68 X;  2Q4N A;  3P6G A;  4ZCB A;  4O49 A;  1B4M A;  4MVE A;  4TKH A;  3ZW2 A;  3B2I A;  5L8N A;  1SXW A;  4ZGU A;  2BLG A;  1G5W A;  4ML7 B;  4ODD A;  2YMS A;  4WBK A;  1B8E A;  4EEJ A;  4O4S A;  2CBS A;  3WJE A;  4NNS A;  4IMO A;  2AT5 X;  3STM X;  1ZNH A;  1X8Q A;  4UU2 A;  1L6M A;  2MHD A;  1OPB A;  2L67 A;  2FWV A;  3E3C A;  1KT4 A;  4NYR A;  4EDE A;  1DC9 A;  5EPQ A;  1GM6 A;  1YWA A;  1JJX A;  1S7D A;  3TGA A;  3S60 A;  4KH8 A;  3FEP A;  1DFV A;  4U8U N;  1ICM A;  3CBC A;  4ZHD A;  3HWD A;  4IAX A;  4O9S A;  4MVK A;  1EXS A;  4I95 A;  4QNI A;  3U0D A;  2LBV A;  1CBQ A;  1QQS A;  1KQW A;  3FLL A;  3EMM A;  5AQ6 A;  1FEN A;  4DQ3 A;  5BVQ A;  3APV A;  4OMW A;  4ZH9 A;  1YIV A;  2WUT A;  2RD7 C;  2WQA E;  3S5X A;  1ERB A;  3VG5 A;  1KOI A;  4A8Z A;  4A60 A;  4EQA C;  2QMI A;  2QO4 A;  1QAB E;  1GKA A;  1GX9 A;  1TOU A;  4YCE A;  4EFG A;  5K06 A;  3ELZ A;  3LV4 A;  1JZU A;  1ICN A;  4LKP A;  5LKF A;  4CSB A;  3FW5 A;  5FQ8 E;  3H3I A;  1YWB A;  3WJC A;  4CV7 A;  1JBH A;  5LJK A;  1QY2 A;  3B2L A;  1I4U A;  3D97 A;  4U3Q A;  5LJG A;  1PEE A;  2WQ9 A;  4QZT A;  4HFO A;  3FR4 A;  1PMP A;  4YH0 A;  1OBP A;  1QY0 A;  1ZND A;  5D45 A;  1GGL A;  4Y0R A;  4AZN A;  4XME A;  2HMB A;  1R0U A;  2QO6 A;  5H9A A;  5C0N A;  2LBA A;  1FDQ A;  4N7C A;  3VG6 A;  3KFI A;  4KC8 A;  1U0X A;  2WR6 A;  3NX2 A;  4PJ2 A;  5D8J A;  2BHV A;  1JYJ A;  1KXO A;  1E06 A;  2F09 A;  5F6B A;  1LNM A;  3BLG A;  1YUP A;  2L68 A;  4MVL A;  4RUU A;  3WJF A;  2L9C A;  3DTQ A;  1E02 A;  1IIU A;  2N93 A;  3FA7 A;  5DPQ A;  3NR3 A;  2RQ0 A;  1O1V A;  1CJ5 A;  4IAB A;  1X89 A;  5HZ9 A;  4MVI A;  3CWK A;  5HA1 A;  4CK4 A;  5KHP A;  4NNT A;  3NPO A;  2FS6 A;  3I17 A;  5L8I A;  5F58 A;  2CM4 A;  4ZR2 A;  1LIB A;  3RSW A;  2LKK A;  3VE2 A;  4QYP A;  1CBS A;  2AMM X;  3FR2 A;  1LFO A;  2RCT A;  5HCD C;  1BSQ A;  4ZGF A;  1JIW I;  1ML7 A;  2A13 A;  3HTY A;  3MX7 A;  1TW4 A;  3P6E A;  1KT3 A;  3OD9 A;  3I0A A;  1BEB A;  3ZWE A;  2IFB A;  1E5P A;  4GET A;  5AEO A;  4O3Y A;  5B29 A;  2Q9S A;  3UEV A;  1MX8 A;  3NX1 A;  1DZK A;  2G7B A;  2NNE A;  3NQ9 A;  4GH7 A;  1DZM A;  3LHN A;  4QAE A;  2GTL O;  2FLJ A;  2KW1 A;  4BVM A;  1AVG I;  1Z24 A;  2OFR X;  2QM9 A;  3BSZ E;  4ALO A;  2R56 A;  1O1U A;  1RBP A;  4M6S A;  5LJH A;  1BLR A;  4AZQ A;  1NP4 A;  5H9K A;  1DZJ A;  4PSQ A;  3HWF A;  5HWZ A;  2X46 A;  4QYN A;  3O2Y A;  1Y9L A;  4HPB A;  1H91 A;  1RLB E;  4ZJ0 A;  1ZNG A;  1YP6 A;  1BWY A;  2CBR A;  4IB9 A;  3TF6 A;  5AJB A;  5LJD A;  4YFQ A;  4ZHF A;  1IKE A;  3OBL A;  5FAZ A;  4Y0Q A;  5HZ5 A;  5HZ6 A;  1S44 A;  1G74 A;  4R0B A;  1Y9T A;  1MVG A;  1GT3 A;  5LKE A;  3AKN A;  4AZM A;  1O8V A;  4A1H A;  2ACP X;  3FYF A;  5KIC A;  4FGI B;  3IFB A;  4OS3 A;  4ZHH A;  3B2H A;  1GT1 A;  4GNW A;  3VG7 A;  1B56 A;  2OVD A;  2Q39 A;  1IFB A;  1DV9 A;  4FBR A;  4IAW A;  4GZV A;  1QY1 A;  5D47 A;  3HOL A;  5HZQ A;  3WOV A;  4NLI A;  2AKQ A;  4YDB A;  1KQX A;  3ZW1 B;  3IA8 A;  3C77 X;  2LFO A;  2M4L A;  2FT9 A;  2K62 A;  3B2J A;  3U9P C;  1GT4 A;  2X45 A;  3O22 A;  3WJD A;  1BM5 A;  1DZP A;  1URE A;  4WFV A;  2AT6 X;  1ERX A;  4O4O A;  3PQS A;  3ZZV A;  1EI5 A;  2CZT A;  2WEW A;  3PED A;  3BDR A;  2DM5 A;  1YWD A;  1FEM A;  5H9N A;  1HN2 A;  4IBA A;  1PBO A;  2A2G A;  1MUP A;  3KQ0 A;  1EAL A;  2ANS A;  2P8G A;  3NQK A;  2OZQ A;  3RWX A;  1OEK A;  2R73 A;  3BX7 A;  2JW1 A;  5D4A A;  5LJB A;  3TGB A;  3FEN A;  2Z4H A;  1VYF A;  4FQB B;  1FTP A;  2FTB A;  4K19 A;  5H9L A;  3BY0 A;  4MIS A;  4YGG A;  3PP6 A;  1GXA A;  3D4R A;  1EUO A;  4XMD A;  1UZ2 X;  5F6Z A;  4QQ1 A;  2MO5 A;  1BJ7 A;  4WHI A;  5LJE A;  1A18 A;  1QFV A;  2RN4 A;  1X8P A;  3PPT A;  1HMT A;  1BBP A;  1CBI A;  3WJB A;  5HCC C;  2AT8 X;  5LJC A;  3C78 X;  2ACO A;  3VG3 A;  1KZW A;  5EEE A;  2F73 A;  3K3L A;  3ZI8 A;  1PM1 X;  3ZW0 A;  2JU7 A;  1GKA B;  1KT6 A;  4YGH A;  3PH5 A;  1G7N A;  1TVQ A;  2PY1 A;  2JU3 A;  2W2B A;  1ALB A;  4INN A;  3D95 A;  2R74 A;  1YP7 A;  1A2D A;  3C76 X;  3EBW A;  2RCQ A;  4ORS A;  1JJJ A;  2FS7 A;  1AEL A;  2CZU A;  3FA8 A;  3SOT A;  4AYH A;  5DG4 A;  3V8U A;  5HZ8 A;  2GTL M;  1QG5 A;  3FIQ A;  1CBR A;  3ZUO A;  4GKC A;  1SY3 A;  3T1D A;  5L8O A;  4O3W A;  4UU3 A;  3BU1 A;  4ON1 A;  1EPA A;  3P02 A;  4AW8 A;  2BT9 A;  1IW2 A;  1A3Y A;  1KT7 A;  2QOS C;  3CQN A;  3NP1 A;  4HPD A;  3MVF A;  1DF3 A;  1AB0 A;  3BU9 A;  3PEC A;  1GX8 A;  4LKT A;  5HBS A;  2OFM X;  3S5V A;  2HNX A;  4QZU A;  4ORR A;  4IB7 A;  4YKM A;  4OMX A;  3CBS A;  4AZO A;  4YBP A;  1GT5 A;  2G79 A;  1EII A;  1HMR A;  4LZU A;  4ZHC A;  3N91 A;  3FA6 A;  4I3C A;  3FMZ A;  1X71 A;  1LIE A;  5AJC A;  2JU8 A;  2AT3 X;  4ALB A;  2MM3 A;  1I04 A;  4ZHG A;  4I9S A;  2HZR A;  3TZS A;  4NLJ A;  2A3F X;  3TGC A;  1JV4 A;  1EIO A;  4KII A;  1U17 A;  2JMB A;  4O4U A;  3P6D A;  1HMS A;  4HWM A;  2WWP A;  2POA A;  4KC7 A;  1HQP A;  4YBU A;  1SY1 A;  3NAD A;  2KD2 A;  3CQR A;  2XKL A;  1X8O A;  4GE1 A;  3P6C A;  3SAO A;  1X8N A;  3EM0 A;  4O3Z A;  2ALL X;  2GTL N;  4GNY A;  4YFR A;  3PH6 A;  2QO5 A;  4U8U O;  2JOZ A;  3RKG A;  4GU8 A;  3STN A;  2NND A;  2NP1 A;  5IO5 A;  2WEX A;  1T8V A;  3NBX X;  3WBG A;  2BS6 A;  4FBO A;  3ZW1 A;  1TXL A;  2YG2 A;  1OBU A;  4HPC A;  4COT A;  2K23 A;  3FA9 A;  1EPB A;  4TLJ A;  1SY0 A;  3B2K A;  2W2F A;  5F1E A;  3STK A;  1LIF A;  2MWH A;  2KT4 B;  3P6F A;  4YCH A;  1VPR A;  4I3B A;  4YMY A;  3JQO A;  3APU A;  4RUN A;  4TJZ A;  3APX A;  4Y0S A;  1I05 A;  1S2P A;  4GDZ A;  4DQ4 A;  1FEL A;  4XMC A;  5FEN A;  2HLV A;  3FR5 A;  3RBY A;  1ZNE A;  5HTD A;  5KID A;  4YKO A;  3BS2 A;  4YFP A;  4AZP A;  2HZQ A;  1T0V A;  2RA6 A;  1HBQ A;  2AT0 X;  4IB8 A;  1QFT A;  1MDC A;  4ARH A;  1LID A;  4FBV A;  2GC9 A;  4U9C A;  4TKB A;  2CM9 A;  3BX8 A;  1CRB A;  1XCA A;  1ZRY A;  4HPA A;  3JSQ A;  5FQ6 E;  3FW4 A;  3RZY A;  5F7G A;  5BYP A;  5CYB A;  2AL0 X;  3Q6L A;  2FRS A;  4ORU A;  5HA0 A;  1D2U A;  3FEL A;  4LQZ A;  3AKM A;  3D96 A;  5B27 A;  2Q2M A;  4D6A A;  4QGX A;  4TKJ A;  4NP1 A;  4OS0 A;  3F8A A;  4GRJ A;  4YGZ A;  1LKE A;  2Q2P A;  1TOW A;  2WSJ A;  4N7D A;  3WVM A;  4NW4 A;  1OEJ A;  3O19 A;  4TQ2 A;  3UEX A;  1LF7 A;  1EQD A;  1SY2 A;  3CR6 A;  1OEE A;  3OJY C;  3UEU A;  3VG2 A;  3FEK A;  1LIC A;  1VYG A;  3APW A;  3HWE A;  3DSZ A;  1HBP A;  1MX7 A;  2EU7 X;  4ORY A;  5FFH A;  4Y0P A;  1D3S A;  3QKG A;  4XMH A;  2LB6 A;  4QRL A;  1YWC A;  2OVS A;  1EW3 A;  2MJI A;  1IKJ A;  2X8S A;  4JGL A;  4QGW A;  3ZQ3 A;  1BRP A;  4OS8 A;  5EDC A;  4XMG A;  3UAQ A;  1ACD A;  2XST A;  3F9D A;  5EZ2 A;  3EBK A;  2HYS A;  2G78 A;  4O4X A;  3KFH A;  4L3R A;  4MIR A;  4YDA A;  1ADL A;  2A2U A;  4KCA A;  2OVA A;  4IMN A;  4BOE A;  3KFG A;  5HAE A;  2FR2 A;  3VG4 A;  4AZR A;  4O3X B;  5HCE C;  1JYD A;  5BVS A;  1BRQ A;  4ORW A;  3HK1 A;  3F6Z B;  1IFC A;  1ZNK A;  2Z4I A;  3MBT A;  4I6S A;  3UEW A;  1BSO A;  1QWD A;  3ZW0 B;  1E00 A;  4ID2 A;  2ZAG A;  3P24 A;  2KTS A;  1B0O A;  3HWG A;  1OBQ A;  3OE3 A;  5EDB A;  3GE2 A;  2LA7 A;  3WJG A;  4KT5 A;  1XKI A;  5D48 A;  1X8U A;  3HOE A;  3S26 A;  2ASN X;  1SXY A;  5BVT A;  1KGL A;  1KZX A;  4WFU A;  1P6P A;  2X8F A;  4BQU A;  2FR3 A;  3VE1 A;  5JR8 A;  2O62 A;  2BS5 A;  3EYC A;  1G85 A;  2ZAI A;  3KFF A;  5HTE A;  2E4J A;  4M7M A;  2L5P A;  2JN3 A;  2X8T A;  4LZV A;  3GAQ A;  5EED A;  3PQU A;  5IO7 A;  1SXX A;  3VPJ E;  1U18 A;  1I06 A;  2NNQ A;  4QGV A;  3L4R A;  4TNN A;  2GTF X;  4A1Y A;  2W2A A;  4U8U M;  2GJ5 A;  1SA8 A;  3G7X A;  5IO6 A;  3U03 A;  1SMP I;  3ELX A;  1NGL A;  4I9R A;  1NP1 A;  1OPA A;  4ES7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...