4YFQA

Crystal structure of the r111k:y134f:t54v:r132q:p39y:r59y mutant of human cellular retinoic acid binding proteinii with retinal after 24 hours incubation at 1.62 angstrom resolution - thermodynamic product - 1st cycle
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
137
structure length
137
Chain Sequence
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular retinoic acid-binding protein 2
publication title A Photoisomerizing Rhodopsin Mimic Observed at Atomic Resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 37
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4yfqA00
2R74A 4LZUA 2OFMX 2KTDA 4A60A 4D6AA 3F9DA 1U0XA 1FELA 3U03A 3OJYC 3T1DA 1TOUA 5H8TA 3VG6A 1IKJA 4YGHA 3ELXA 4YFRA 4TKBA 3JSQA 1AVGI 4XMEA 1EIOA 3FENA 1QWDA 4ZCBA 1LIDA 1X71A 3C78X 4QZUA 4XMCA 3VG4A 4QYNA 2HZRA 3ELZA 5EPQA 4M6SA 2AT6X 4TNNA 4WFVA 2PY1A 4BOEA 1HBQA 2OFRX 1FEMA 3PH6A 4UU3A 4YBUA 1KT4A 3MVFA 1I4UA 1ACDA 1ZNDA 4OS3A 1G85A 1L6MA 5KICA 3TGAA 1PMPA 1B8EA 2G78A 2N93A 3BX8A 5EEEA 2JU7A 4LKPA 3FELA 4R0BA 1EPBA 3KQ0A 2WEXA 1AQBA 3U0DA 1T8VA 2K62A 2HMBA 1KXOA 1OBUA 2Q39A 1X8QA 2RD7C 5IO7A 4ZH9A 1KZXA 5EEDA 3HWDA 1YP6A 1FDQA 2Q2PA 1IFBA 3CBCA 1LIBA 1ICNA 4RUNA 4AW8A 1KT7A 2X45A 3F8AA 1N0SA 2NP1A 3FEKA 2FT9A 4AZRA 3L4RA 3NR3A 1ZNGA 2L9CA 5DPQA 1GKAB 4Y0SA 3ZUOA 2QO6A 1JBHA 3O19A 3TZSA 4ALBA 4YFPA 4ORXA 1A2DA 4I9SA 3WXQA 4A8ZA 4YH0A 2FR3A 1ADLA 4TKJA 3VG7A 3APXA 1YP7A 2A0AA 2Q4NA 3QKGA 1IW2A 3PECA 4O9SA 1YWDA 3FEPA 3HWEA 5D4AA 4IB9A 2W2AA 1PBOA 1ZNEA 1RBPA 1B56A 1OPAA 1SY3A 4XMGA 3CMPA 5B29A 4ZHCA 1GT3A 5F6ZA 1NP4A 1CRBA 4NP1A 2GC9A 1Z24A 3D95A 1GGLA 1LKEA 1TXLA 4AZMA 1DFVA 5C0NA 4IB6A 2CM4A 2CZUA 1HBPA 4TJZA 3WVMA 3UEXA 4EFGA 3P6GA 5D8JA 1OBQA 1MDCA 5F58A 1MUPA 3KFIA 3NPOA 3UEVA 4A1YA 1GX8A 5L8OA 4AZPA 4AZQA 2OZQA 4ZHFA 5FENA 5HZ5A 4LKTA 4ALOA 4KIIA 2A3FX 2CBRA 3O22A 1D3SA 1ERXA 3Q6LA 2WEWA 4YCEA 2BLGA 1CBSA 4PSQA 4YKMA 4K19A 4AZNA 1G5WA 1LFOA 1OEEA 5KIDA 4EDEA 1R0UA 2A2GA 1EUOA 4GRJA 1YWCA 1EALA 3BS2A 1GT4A 2ACPX 1ZNKA 1SXWA 1GM6A 3EBKA 5BVQA 1QY0A 1BBPA 4MVKA 4TLJA 2E4JA 1ZRYA 4ORWA 3GAQA 2G79A 2MM3A 3BU9A 3STNA 4QAEA 3P6FA 4OMWA 2JU3A 4ES7A 1I06A 4AZOA 5JR8A 3D96A 3CQNA 4ZHHA 1OPBA 1SXUA 1FTPA 2FLJA 5H9NA 1SXXA 1YIVA 1LF7A 1OEJA 3WJDA 2L68A 4EEJA 4I9RA 1A57A 4ZHGA 1DZJA 1EW3A 1MX7A 4YBPA 1KT6A 5H9LA 4ODDA 4YCHA 3PP6A 5D48A 3B2IA 1KT5A 2O62A 2WQAE 1GT1A 4RUUA 1FE3A 2X46A 5FAZA 3BSZE 1S2PA 5D45A 1IIUA 2HNXA 4M7MA 3DTQA 1E02A 2AT5X 3C76X 2F73A 2NNQA 1GT5A 1S7DA 4ORSA 4MVLA 1JZUA 2FRSA 4HPAA 4I3DA 4EXZA 2XSTA 5B27A 1QFVA 3FIQA 4OS8A 2QO5A 4ZGUA 1JJXA 5AQ6A 4GE1A 1NGLA 3FR4A 2QOSC 4TQ2A 1ZNLA 3VG5A 1ML7A 2A13A 5F6BA 1ERBA 1YWBA 1HQPA 1JYJA 3WJFA 2QM9A 5F7GA 2RCTA 3BX7A 1AELA 3WJGA 2DM5A 5H9AA 2MO5A 3VG3A 5KHPA 2GJ5A 2AT0X 1KOIA 1KQWA 2LB6A 5LJCA 1BRPA 1QG5A 5H9KA 3P6EA 4LZVA 4ZFXA 3WJEA 2WUTA 4HPDA 2R56A 4GETA 1I04A 3UEUA 3JS1A 4IBAA 1HMSA 3STKA 3P6DA 2FS7A 2IFBA 1U17A 5HZQA 1G7NA 3EYCA 4YFQA 4XMDA 1O8VA 1IFCA 3IFBA 1KGLA 4ZH6A 1E06A 3UEWA 3EM0A 3IA8A 4ORUA 1LPJA 1PM1X 4I3BA 3APWA 3MBTA 3BLGA 4IMOA 1ALBA 1TOWA 2FTBA 3VG2A 5IO5A 2WSJA 3FW4A 2LKKA 3BU1A 3P6CA 1CJ5A 4YKOA 1HMTA 1CBRA 2JOZA 2MJIA 2LFOA 3K3LA 3EMMA 5LKFA 1DZPA 2EU7X 5EZ2A 2CM9A 5BVSA 1AB0A 1GXAA 3ZQ3A 1DZKA 1BSQA 1QQSA 4Y0PA 4GNYA 1DV9A 3B2LA 1HN2A 4IAWA 1MX8A 3FA6A 4GKCA 1X8PA 1I05A 1X8UA 2AH7X 2LBVA 1O1UA 3FA9A 1QY2A 4NNSA 5EDBA 4CK4A 1UREA 2OVDA 5CE4A 5HZ9A 5EDCA 1SY1A 4IMNA 1SA8A 2ANSA 4QYPA 1CBQA 1SY2A 4QGXA 3ZUIA 3NX2A 4DQ4A 1UZ2X 2JU8A 2CZTA 4NLIA 2XKLA 4ORYA 4ARHA 2Q2MA 5LJGA 2RA6A 3HK1A 3FLLA 2ACOA 3TGCA 1BSYA 3FW5A 1SY0A 1T0VA 4UU2A 4D6BA 1YWAA 5K06A 4YGGA 1QFTA 5HCEC 1TW4A 2POAA 5LJEA 3AKNA 3B2KA 4GH7A 3EBWA 3FA8A 2JN3A 2L67A 3PH5A 1BLRA 5FFHA 1X89A 2LBAA 2WR6A 3HWFA 2YG2A 1IKEA 3WBGA 4WBKA 4IB7A 3S26A 4QGWA 1JYDA 4HPCA 3FMZA 3WJBA 4NYQA 3TF6A 3I17A 4XMHA 4N7DA 5HAEA 1D2UA 4Y0QA 5HCDC 2NNEA 1EIIA 1EXSA 3CQRA 1KT3A 3STMX 2CBSA 3RZYA 3DSZA 4HPBA 4IAXA 4QZTA 2WQ9A 1LIEA 4YGZA 2RCQA 1VPRA 2KT4B 3FR5A 1X8NA 4AYHA 3AKMA 5HTDA 1E5PA 2W2FA 1X8OA 3PPTA 4OMXA 1XKIA 2A2UA 2Q9SA 4MVIA 2ALLX 1T68X 3D97A 2AT3X 4WFUA 5LJHA 3BY0A 1YUPA 4NYRA 5HZ6A 1BWYA 1B0OA 3NQ9A 4DQ3A 5HA1A 4YMYA 3CR6A 1OEKA 2HZQA 1DZMA 3FA7A 4YDAA 2QO4A 3PEDA 3NX1A 3BDRA 5HTEA 3RSWA 5L8NA 1H91A 1EPAA 4N7CA 4A1HA 1QABE 2P8GA 3NP1A 3SAOA 5BVTA 1BEBA 5L8IA 4BVMA 1KQXA 4HFOA 1S44A 1BM5A 2WWPA 4QGVA 1KZWA 5LKEA 3C77X 4NNTA 5LJBA 3APVA 2NNDA 1DF3A 1U18A 3G7XA 3APUA 1BRQA 3O2YA 3P6HA 1XCAA 3U9PC 3NADA 2AT8X 2G7BA 4TKHA 2L5PA 4YDBA 2AMMX 3WJCA 3KFGA 1BJ7A 1ICMA 2AKQA 1VYGA 1CBIA 3I0AA 4I3CA 1MVGA 2OVEA 1VYFA 2OVAA 1E00A 1JJJA 4ZJ0A 2R73A 3FR2A 5IO6A 4Y0RA 1NP1A 1O1VA 3B2HA 3KFHA 1OBPA 4OS0A 1HMRA 4XMFA 5HA0A 4BQUA 1GX9A 3TGBA 1A18A 3BRNA 5HZ8A 2GTFX 3KZAA 5HWZA 4ZR2A 2W2BA 1FENA 1A3YA 1QY1A 1BSOA 1SXYA 2K23A 1PEEA 4ORRA 4NLJA 1P6PA 5F1EA 3CWKA 1LIFA 2FR2A 2AL0X 5LJDA 5D47A 2RQ0A 1ZNHA 2ASNX 1G74A 2HYSA 5DG4A 3B2JA 1EQDA 1TVQA 4GNWA 1LNMA 2FWVA 2HLVA 3NQ3A 1GKAA 2FS6A 1LICA 1DC9A 4IB8A 1JV4A 5HCCC 1B4MA 3HWGA 1RLBE 3CBSA 3KFFA 4ZHDA 5LJKA 5HBSA
chains in the Genus database with same CATH superfamily
2R74A 3OD9A 1NDJA 2OFMX 2KTDA 4LZUA 4A60A 4D6AA 3F9DA 1U0XA 1FELA 3U03A 3OJYC 3T1DA 1TOUA 5H8TA 1FJ1E 1IKJA 4YGHA 3ELXA 3VG6A 4YFRA 4TKBA 3JSQA 1AVGI 4XMEA 1EIOA 3FENA 1QWDA 2X55A 1VWIB 1LIDA 3JQOA 1X71A 4ZCBA 3C78X 4QZUA 2OL7A 3PDFA 1VWMB 2GTLN 4XMCA 3VG4A 4QYNA 2HZRA 3ELZA 4U46A 4OEMA 4U8UO 5EPQA 4M6SA 2AT6X 4TNNA 4WFVA 2RTIB 2FHLA 2PY1A 4BOEA 1SWHA 2FKJA 1HBQA 2OFRX 1FEMA 3PH6A 1VWLB 4UU3A 1SWLA 2Y3EA 4YBUA 1KT4A 3MM0A 4FBVA 3MVFA 1I4UA 3LTWA 4GJVA 1ACDA 4OMXA 1ZNDA 4OS3A 5B5GA 1G85A 3P02A 3CKFA 1L6MA 5KICA 3TGAA 1PMPA 1B8EA 4BGFA 2G78A 2N93A 3BX8A 5EEEA 2JU7A 4LKPA 3FELA 5AEOA 4R0BA 2RTDB 1EPBA 3KQ0A 4JNJA 5B10O 2VDFA 2WEXA 1AQBA 1DF8A 2AVIA 1SLDB 4COTA 1T8VA 2K62A 2HMBA 1KXOA 1OBUA 1NQNA 1X8QA 2Q39A 2RD7C 3SOTA 4ZH9A 4O4UA 4GZVA 4C5PA 5IO7A 1KZXA 5EEDA 3HWDA 4O3WA 1YP6A 1FDQA 2Q2PA 3RBYA 5CYBA 1IFBA 3CBCA 4NV8A 3VHMA 1LIBA 1ICNA 4NV7A 4RUNA 4AW8A 1KT7A 2X45A 3F8AA 5K67A 1N0SA 2NP1A 3FEKA 3T6FA 2FT9A 4AZRA 2IZHB 3L4RA 3NR3A 1ZNGA 4GDZA 1E2TA 2L9CA 4I60A 1GKAB 4Y0SA 1SWNA 5DPQA 2QO6A 4Z28A 3VGWA 3ZUOA 1JBHA 2I5ZO 3O19A 3ZW1A 3TZSA 4ALBA 4YFPA 4ORXA 1A2DA 4BX7A 2A8GA 4I9SA 3WXQA 4YH0A 4A8ZA 2FR3A 1JIWI 1JQPA 1ADLA 4TKJA 3VG7A 3APXA 1YP7A 1VWAB 4QRLA 2A0AA 2RTLA 4KH8A 2IZBA 2Q4NA 2OYBO 3QKGA 1IW2A 3PECA 4O9SA 1YWDA 3FEPA 1IJ8A 3HWEA 1SWPA 5D4AA 3NQKA 4IB9A 4CDCA 2W2AA 4CPFA 4CV7A 1PBOA 3V8UA 5B2AO 1ZNEA 1JMZA 2FKGA 3SZJA 1LCVA 1RBPA 1B56A 3WYQA 1SRHA 5K68A 1OPAA 1SY3A 4XMGA 2JMBA 3CMPA 4ZHCA 5B29A 2C1QA 4GUZA 1GT3A 2AF5A 5F6ZA 3T6LA 1NP4A 5BYPA 1CRBA 4NP1A 1Z24A 2GC9A 2OF8A 3D95A 1GGLA 1LKEA 1TXLA 5CSEA 1DFVA 4AZMA 4BX5A 5C0NA 4EQAC 3AEHA 4IB6A 2CM4A 2CZUA 1HBPA 4TJZA 3RE5A 1SWDA 3UEXA 2OL6O 3WVMA 4EFGA 1NC9A 3P6GA 1VWRB 4KC8A 5D8JA 3ZI8A 1MOYA 1PTSA 3PQUA 1OBQA 1MDCA 1SREA 3D9WA 3GE2A 5F58A 3ZWEA 1MUPA 3KFIA 3NPOA 1VWJB 3UEVA 4A1YA 2C1SA 4DNEA 1GX8A 5L8OA 1OSPO 4AZPA 1VWHB 4AZQA 2OZQA 4ZHFA 5B5FA 5FENA 1VWFB 5HZ5A 4FBRA 1HY2A 1RSTB 1RXKA 4FBOA 4LKTA 5IXGA 4O4OA 2RTHB 4KIIA 5FQ7E 4ALOA 1SWFA 2A3FX 2CBRA 2IZKA 3O22A 1D3SA 1ERXA 2X8SA 3Q6LA 2WEWA 4YCEA 2BLGA 1CBSA 3OE3A 4OELA 4PSQA 4YKMA 4K19A 2UYWA 3RDXA 4AZNA 1G5WA 1LFOA 1OEEA 3AUMO 5KIDA 4EDEA 1N4JA 4EKVA 1SRJA 1R0UA 3ZW1B 2A2GA 1EUOA 4GRJA 2X34A 1YWCA 1EALA 3T2XA 1HXZA 3BS2A 1W6FA 1GT4A 1KL4A 4BX7B 2ACPX 1ZNKA 1Y0GA 1SXWA 1GM6A 3EBKA 5BVQA 1QY0A 1N9MA 3VU1A 1BBPA 4MVKA 4TLJA 2E4JA 2Y32A 1ZRYA 3KVNA 2JGSA 3GAQA 1NBXA 2G79A 2MM3A 2PI3O 3PK2A 4ORWA 3BU9A 1LUQA 4QAEA 3RDMA 3STNA 4CSBA 2X56A 1HQQA 3P6FA 4OMWA 2GTLO 2JU3A 4ES7A 2GH7A 1I06A 2CAMA 1STRB 4AZOA 5JR8A 3D96A 3CQNA 2X4MA 4ZHHA 1OPBA 4JO6A 5L3YA 4IABA 1SXUA 1FTPA 1RAVA 2FLJA 5H9NA 1AVEA 4O3XB 3WZQA 1SXXA 1YIVA 1LF7A 1OEJA 3WJDA 2L68A 3VHHA 3LV4A 2ZAGA 3RDSA 4I9RA 4EEJA 1SWQA 4O3YA 3S5XA 3SLJA 1DZJA 1EW3A 1MX7A 4ZHGA 1VWEB 3EC5A 4YBPA 1KT6A 2HKDA 5H9LA 3S5VA 4BX5B 4ODDA 4O4SA 2QMIA 3PP6A 4YCHA 1SLEB 5D48A 4GGZA 4GU8A 4OKAA 2RTJA 3B2IA 1KT5A 1SWAA 2O62A 3RY1A 2WQAE 4KT5A 1GT1A 4RUUA 4U8UN 4U9CA 1FE3A 2X46A 5FAZA 3ZW0A 3BSZE 1S2PA 3Q34A 5D45A 2OL8O 1IIUA 2HNXA 4M7MA 1PBYA 3DTQA 1E02A 1N9YA 2AT5X 2RTBB 3C76X 2F73A 2NNQA 1GT5A 1LCWA 1S7DA 4ORSA 3SZHA 2RTNB 4MVEA 4MVLA 5B3MO 1RXHA 4MEEA 2FRSA 4HPAA 1JZUA 4I3DA 2JW1A 4EXZA 2XSTA 1MEPA 1N43A 5B27A 1QFVA 3FIQA 1SWBA 4L1NA 4OS8A 4KC7A 3ZW2A 4Z2VA 2QO5A 4ZGUA 1JJXA 5AQ6A 4GE1A 1NGLA 3FR4A 4INNA 2QOSC 4TQ2A 4O49A 1VWBB 1ZNLA 3VG5A 1ML7A 2A13A 4CPHA 4CPIA 5F6BA 1ERBA 2RTFB 1YWBA 1HQPA 1JYJA 1RSUB 4GD9A 2QM9A 4IRWA 5F7GA 2RCTA 3WJFA 3BX7A 1AELA 4I95A 2OFAA 2OFBA 3WJGA 1RXJA 1NQMA 2DM5A 2MO5A 5H9AA 3VG3A 3WOVA 2FGSA 5KHPA 2G5LA 2GJ5A 4MIRA 3MX7A 2AT0X 1KOIA 1WBIA 1KQWA 2LB6A 5LJCA 2I5VO 1BRPA 1QG5A 5H9KA 1SWCA 3HTYA 2IZJA 3LHNA 2X8TA 3P6EA 1VWDB 5AJBA 4LZVA 4ZFXA 3WJEA 2WUTA 4ID2A 2MHDA 4HPDA 2R56A 4GETA 1I04A 3UEUA 3JS1A 4IBAA 1HMSA 3STKA 3RDUA 3P6DA 2A5CA 2FS7A 2IFBA 1U17A 5HZQA 1G7NA 3EYCA 4YFQA 4XMDA 1O8VA 1K24A 1IFCA 3IFBA 1KGLA 2QCBA 2KTSA 1E06A 1SWOA 4ZH6A 2G8CO 3EM0A 3IA8A 4L3RA 4ORUA 5F2BA 3UEWA 1LPJA 1PM1X 2IZLB 3APWA 3MBTA 4I3BA 4Y59A 2BS6A 3BLGA 2IZAA 2RTQB 3MG5A 4IMOA 1ALBA 1AVDA 4I6SA 1TOWA 1STPA 2QOMA 2FTBA 2F09A 3VG2A 2WSJA 5IO5A 1K3BA 1JMXA 2BT9A 3FW4A 3ZW0B 4DCBA 3OBLA 2LKKA 3BU1A 3P6CA 1CJ5A 4MISA 1HMTA 1CBRA 2GTLM 2JOZA 2MJIA 4YKOA 2LFOA 3X00A 3K3LA 3E3CA 3VE1A 3WZNA 4Z2PA 4ZGFA 3EMMA 5LKFA 2BSZA 1SRIA 4BX6A 2RTGB 1Y9TA 3N91A 1DZPA 2EU7X 5EZ2A 2CM9A 5BVSA 2IZEB 1AB0A 1GXAA 3ZQ3A 3VE2A 1SWRA 1DZKA 1BSQA 2IZGB 1QQSA 4Y0PA 4GNYA 1DV9A 4BBOA 4CPHB 3B2LA 1HN2A 4FQBB 4IAWA 2A5BA 4QQ1A 1MX8A 3FA6A 4GKCA 1X8PA 1I05A 1X8UA 2RTMA 3EW1A 2AH7X 2LBVA 1VWCB 1O1UA 2RTOB 3FA9A 1QY2A 4NNSA 5EDBA 2OY7A 4CK4A 4HWMA 2X32A 1UREA 2OVDA 4Z6JA 5CE4A 5HZ9A 5EDCA 1SY1A 3HOLA 3QQ2A 4IMNA 1SA8A 2ANSA 4GJSA 4QYPA 1CBQA 1SY2A 2X8FA 4QGXA 3RDOA 3ZUIA 3NX2A 4DQ4A 1UZ2X 2JU8A 2CZTA 3RY2A 4NLIA 2XKLA 4ORYA 4ARHA 2Q2MA 1STSB 5LJGA 2RA6A 3HK1A 1SWUA 4Z2OA 3FLLA 2ACOA 3TGCA 1BSYA 3FW5A 1SY0A 1T0VA 1SWKA 4UU2A 4D6BA 1YWAA 5FQ8E 5K06A 4PJ2A 4YGGA 1VWKB 1QFTA 4WHIA 5HCEC 1TW4A 1SLGB 4QNIA 2POAA 5LJEA 3AKNA 3B2KA 4GH7A 3EBWA 1N7YA 3FA8A 3D4RA 4JGLA 2JN3A 2L67A 3PH5A 1A57A 1BLRA 5FFHA 1X89A 2LBAA 2WR6A 1Y52X 4B55A 3VHIA 3HWFA 2YG2A 3PQSA 1IKEA 2IZFB 3WBGA 4WBKA 4IB7A 3S26A 4QGWA 1LELA 2MWHA 1JYDA 1KL5A 2VFBA 2WPUA 4HPCA 2IZIA 3FMZA 4ON1A 3SLTA 3WJBA 3H3IA 4ML7B 3S60A 2RTAA 4NYQA 3TF6A 4BJ8A 3I17A 2M4LA 4XMHA 4N7DA 2MF6A 5HAEA 4LQZA 1VWOB 1D2UA 3FIDA 4Y0QA 3RKGA 5HCDC 2NNEA 1EIIA 5B11O 1EXSA 3ZZVA 1MK5A 3CQRA 1KT3A 3STMX 1HXLA 2CBSA 2ZAIA 2RN4A 3RZYA 2DJGA 3DSZA 4HPBA 4IAXA 4QZTA 3T2WA 2WQ9A 3NBXX 1LIEA 4YGZA 2RCQA 1VYOA 1VPRA 2F01A 2KT4B 3FR5A 1X8NA 3RDQA 3AKMA 3RE6A 4AYHA 5HTDA 4BX6B 1E5PA 2W2FA 1X8OA 1I9HA 2RTEB 3PPTA 1XKIA 2A2UA 2Q9SA 4MVIA 1SWSA 2ALLX 1T68X 3D97A 4O3ZA 2AT3X 4WFUA 5LJHA 1SWTA 4GK9A 5IRAA 1SWJA 4CDEA 3BY0A 1YUPA 4NYRA 3HPEA 5HZ6A 1B0OA 1BWYA 3NQ9A 4DQ3A 5HA1A 2BHVA 4YMYA 3CR6A 3CKGA 1OEKA 2HZQA 1DZMA 3FA7A 4YDAA 2QO4A 3PEDA 3NX1A 2VFCA 3BDRA 5HTEA 2OY5O 4BCSA 3RSWA 3FDCA 1H91A 4GGTA 4NW4A 1EPAA 4N7CA 5L8NA 1LDQA 4A1HA 1QABE 2P8GA 2FHNX 3NP1A 5IRUA 1Y53X 3SAOA 5FQ6E 4YVBA 1BEBA 2RTRB 5L8IA 4BVMA 1KQXA 5BVTA 4HFOA 1S44A 1BM5A 1SLFB 2WWPA 1SWEA 1UYOX 4QGVA 1KZWA 5LKEA 3C77X 4NNTA 3WYPA 5LJBA 1KL3A 3APVA 2NNDA 4KCAA 1DF3A 1U18A 3G7XA 3APUA 1BRQA 3O2YA 3P6HA 1XCAA 1VWQB 3U9PC 3NADA 2AT8X 3SLOA 2G7BA 1GX3A 4TKHA 2L5PA 1VWGB 4CDFA 4YDBA 2RTPB 4CPEA 2IZDB 2IZCB 1JJUA 2AMMX 3WJCA 3KFGA 3RWXA 1SMPI 1BJ7A 1ICMA 2AKQA 1VYGA 1CBIA 2OF9A 3I0AA 2KW1A 4I3CA 1MVGA 2OVEA 1VYFA 3UAQA 1VWPB 1LCZA 2OVAA 1E00A 1JJJA 4ZJ0A 5IRWA 2R73A 3FR2A 5CHKA 5IO6A 2RTCB 4O4XA 4Y0RA 2C4IA 3HOEA 1NP1A 4JHQA 1O1VA 3B2HA 3SZIA 3KFHA 1WUBA 1OBPA 4OS0A 1W4TA 1HMRA 2UZ2A 4XMFA 5HA0A 1Y9LA 4BQUA 1GX9A 4Z27A 3TGBA 2RTKA 1A18A 4Y5DA 4U3QA 3P24A 3BRNA 2DJFA 1SRGA 5HZ8A 3VPJE 1W5RA 2GTFX 2KD2A 3KZAA 5HWZA 4ZR2A 1VWNB 2OVSA 1EI5A 3U0DA 1FENA 1A3YA 2K23A 1QY1A 1BSOA 1SXYA 2W2BA 2Y3FA 1PEEA 1Y55X 4ORRA 2Z4HA 1UYNX 4NLJA 3F6ZB 1MM9A 1P6PA 2LA7A 2ZSCA 3CWKA 2BC3A 5F1EA 1LIFA 5JD2A 2FR2A 2AL0X 5LJDA 5D47A 2RQ0A 1ZNHA 2ASNX 2OY8A 1G74A 3FYFA 4FGIB 2HYSA 3WZPA 4CDDA 3WZOA 5DG4A 3B2JA 2YMSA 1EQDA 3EW2A 1TVQA 2Z4IA 5AJCA 2BS5A 4GNWA 1I78A 1LNMA 2FWVA 2HLVA 4U8UM 3NQ3A 1GKAA 2FS6A 4GDAA 1LICA 1DC9A 4IB8A 1JV4A 5HCCC 2OY1O 1B4MA 1KFFA 3HWGA 4GGRA 1RLBE 3CBSA 1SRFA 3KFFA 4ZHDA 5LJKA 5HBSA 1SWGA 1LDOA
chains in the Genus database with same CATH topology
2R74A 3OD9A 2OFMX 4LZUA 2KTDA 4A60A 4D6AA 3F9DA 1U0XA 1FELA 3U03A 3OJYC 3T1DA 1TOUA 5H8TA 3VG6A 1IKJA 4YGHA 3ELXA 4YFRA 4TKBA 3JSQA 1AVGI 4XMEA 1EIOA 3FENA 1QWDA 4ZCBA 1LIDA 3JQOA 1X71A 3C78X 4QZUA 4XMCA 2GTLN 3VG4A 4QYNA 2HZRA 3ELZA 4U8UO 5EPQA 4M6SA 2AT6X 4TNNA 4WFVA 2PY1A 4BOEA 1HBQA 2OFRX 1FEMA 3PH6A 4UU3A 4YBUA 1KT4A 4FBVA 3MVFA 1I4UA 1ACDA 1ZNDA 4OS3A 1G85A 3P02A 1L6MA 5KICA 3TGAA 1PMPA 1B8EA 2G78A 2N93A 3BX8A 5EEEA 2JU7A 4LKPA 3FELA 5AEOA 4R0BA 1EPBA 3KQ0A 2WEXA 1AQBA 4COTA 1T8VA 2K62A 2HMBA 1KXOA 1OBUA 2Q39A 1X8QA 2RD7C 3SOTA 4CV7A 4ZH9A 4O4UA 4GZVA 5IO7A 1KZXA 5EEDA 3HWDA 4O3WA 1YP6A 1FDQA 2Q2PA 3RBYA 5CYBA 1IFBA 3CBCA 1LIBA 1ICNA 4RUNA 4AW8A 1KT7A 2X45A 3F8AA 1N0SA 2NP1A 3FEKA 2FT9A 4AZRA 3L4RA 3NR3A 1ZNGA 4GDZA 2L9CA 5DPQA 1GKAB 4Y0SA 3ZUOA 2QO6A 1JBHA 3ZW1A 3O19A 3TZSA 4ALBA 4YFPA 4ORXA 1A2DA 4I9SA 3WXQA 4A8ZA 4YH0A 2FR3A 1JIWI 1ADLA 4TKJA 3VG7A 3APXA 1YP7A 4QRLA 2A0AA 4KH8A 2Q4NA 3QKGA 1IW2A 3PECA 4O9SA 1YWDA 3FEPA 3HWEA 5D4AA 3NQKA 4IB9A 2W2AA 1PBOA 3V8UA 1ZNEA 1RBPA 1B56A 1OPAA 1SY3A 4XMGA 2JMBA 3CMPA 4ZHCA 5B29A 5BYPA 1GT3A 5F6ZA 1NP4A 1CRBA 4NP1A 2GC9A 1Z24A 3D95A 1GGLA 1LKEA 1TXLA 4AZMA 1DFVA 5C0NA 4EQAC 4IB6A 2CM4A 2CZUA 1HBPA 4TJZA 3WVMA 3UEXA 4EFGA 3P6GA 4KC8A 5D8JA 3ZI8A 3PQUA 1OBQA 1MDCA 3GE2A 5F58A 3ZWEA 1MUPA 3KFIA 3NPOA 3UEVA 4A1YA 1GX8A 5L8OA 4AZPA 4AZQA 2OZQA 4ZHFA 5FENA 5HZ5A 4FBRA 4FBOA 4LKTA 4O4OA 4KIIA 4ALOA 5FQ7E 2A3FX 2CBRA 3O22A 1D3SA 1ERXA 2X8SA 3Q6LA 2WEWA 4YCEA 2BLGA 1CBSA 3OE3A 4PSQA 4YKMA 4K19A 4AZNA 1G5WA 1LFOA 1OEEA 5KIDA 4EDEA 1R0UA 3ZW1B 2A2GA 1EUOA 4GRJA 1YWCA 1EALA 3BS2A 1GT4A 2ACPX 1ZNKA 1SXWA 1GM6A 3EBKA 5BVQA 1QY0A 3VU1A 1BBPA 4MVKA 4TLJA 2E4JA 1ZRYA 4ORWA 3GAQA 2G79A 4U9CA 2MM3A 3BU9A 3STNA 4QAEA 4CSBA 3P6FA 4OMWA 2GTLO 2JU3A 4ES7A 1I06A 4AZOA 5JR8A 3D96A 3CQNA 4ZHHA 1OPBA 4IABA 1SXUA 1FTPA 2FLJA 5H9NA 4O3XB 1SXXA 1YIVA 1LF7A 1OEJA 3WJDA 2L68A 3LV4A 2ZAGA 4EEJA 4I9RA 1A57A 4O3YA 3S5XA 4ZHGA 1DZJA 1EW3A 1MX7A 4YBPA 1KT6A 5H9LA 3S5VA 4ODDA 4O4SA 2QMIA 3PP6A 4YCHA 5D48A 4GU8A 3B2IA 1KT5A 2O62A 2WQAE 4KT5A 1GT1A 4RUUA 4U8UN 1FE3A 2X46A 5FAZA 3ZW0A 3BSZE 1S2PA 5D45A 1IIUA 2HNXA 4M7MA 3DTQA 1E02A 2AT5X 3C76X 2F73A 2NNQA 1GT5A 1S7DA 4ORSA 4MVEA 4MVLA 1JZUA 2FRSA 4HPAA 4I3DA 2JW1A 4EXZA 2XSTA 5B27A 1QFVA 3FIQA 4L1NA 4OS8A 3ZW2A 4KC7A 2QO5A 4ZGUA 1JJXA 5AQ6A 4GE1A 1NGLA 3FR4A 4INNA 2QOSC 4TQ2A 4O49A 1ZNLA 3VG5A 1ML7A 2A13A 5F6BA 1ERBA 1YWBA 1HQPA 1JYJA 3WJFA 2QM9A 5F7GA 2RCTA 3BX7A 1AELA 4I95A 3WJGA 2DM5A 5H9AA 2MO5A 3VG3A 3WOVA 5KHPA 2GJ5A 4MIRA 3MX7A 2AT0X 1KOIA 1KQWA 2LB6A 5LJCA 1BRPA 1QG5A 5H9KA 3HTYA 3LHNA 2X8TA 3P6EA 5AJBA 4LZVA 4ZFXA 3WJEA 2WUTA 4ID2A 2MHDA 4HPDA 2R56A 4GETA 1I04A 3UEUA 3JS1A 4IBAA 1HMSA 3STKA 3P6DA 2FS7A 2IFBA 1U17A 5HZQA 1G7NA 3EYCA 4YFQA 4XMDA 1O8VA 1IFCA 3IFBA 1KGLA 2KTSA 1E06A 4ZH6A 3UEWA 3EM0A 3IA8A 4L3RA 4ORUA 1LPJA 1PM1X 4I3BA 3APWA 3MBTA 2BS6A 3BLGA 4IMOA 1ALBA 4I6SA 1TOWA 2FTBA 2F09A 3VG2A 2WSJA 5IO5A 2BT9A 3FW4A 3ZW0B 3OBLA 2LKKA 3BU1A 3P6CA 1CJ5A 4MISA 1HMTA 1CBRA 2GTLM 2JOZA 2MJIA 4YKOA 2LFOA 3K3LA 3E3CA 3VE1A 4ZGFA 3EMMA 5LKFA 1Y9TA 3N91A 1DZPA 2EU7X 5EZ2A 2CM9A 5BVSA 1AB0A 1GXAA 3ZQ3A 3VE2A 1DZKA 1BSQA 1QQSA 4Y0PA 4GNYA 1DV9A 3B2LA 1HN2A 4FQBB 4IAWA 4QQ1A 1MX8A 3FA6A 4GKCA 1X8PA 1I05A 1X8UA 2AH7X 2LBVA 1O1UA 3FA9A 1QY2A 4NNSA 5EDBA 4CK4A 4HWMA 1UREA 2OVDA 5CE4A 5HZ9A 5EDCA 1SY1A 3HOLA 4IMNA 1SA8A 2ANSA 4QYPA 1CBQA 1SY2A 2X8FA 4QGXA 3ZUIA 3NX2A 4DQ4A 1UZ2X 2JU8A 2CZTA 4NLIA 2XKLA 4ORYA 4ARHA 2Q2MA 5LJGA 2RA6A 3HK1A 3FLLA 2ACOA 3TGCA 1BSYA 3FW5A 1SY0A 1T0VA 4UU2A 4D6BA 1YWAA 5FQ8E 5K06A 4PJ2A 4YGGA 1QFTA 4WHIA 5HCEC 1TW4A 4QNIA 2POAA 5LJEA 3AKNA 3B2KA 4GH7A 3EBWA 3FA8A 4JGLA 3D4RA 2JN3A 2L67A 3PH5A 1BLRA 5FFHA 1X89A 2LBAA 2WR6A 3HWFA 2YG2A 3PQSA 1IKEA 3WBGA 4WBKA 4IB7A 3S26A 4QGWA 2MWHA 1JYDA 4HPCA 3FMZA 4ON1A 3WJBA 3H3IA 4ML7B 3S60A 4NYQA 3TF6A 3I17A 2M4LA 4XMHA 4N7DA 5HAEA 4LQZA 1D2UA 4Y0QA 3RKGA 5HCDC 2NNEA 1EIIA 1EXSA 3ZZVA 3CQRA 1KT3A 3STMX 2CBSA 2ZAIA 2RN4A 3RZYA 3DSZA 4HPBA 4IAXA 4QZTA 2WQ9A 3NBXX 1LIEA 4YGZA 2RCQA 1VPRA 2KT4B 3FR5A 1X8NA 4AYHA 3AKMA 5HTDA 1E5PA 2W2FA 1X8OA 3PPTA 4OMXA 1XKIA 2A2UA 2Q9SA 4MVIA 4O3ZA 2ALLX 1T68X 3D97A 2AT3X 4WFUA 5LJHA 4GK9A 3BY0A 1YUPA 4NYRA 5HZ6A 1BWYA 1B0OA 3NQ9A 4DQ3A 5HA1A 2BHVA 4YMYA 3CR6A 1OEKA 2HZQA 1DZMA 3FA7A 4YDAA 2QO4A 3PEDA 3NX1A 3BDRA 5HTEA 3RSWA 5L8NA 1H91A 4NW4A 1EPAA 4N7CA 4A1HA 1QABE 2P8GA 3NP1A 3SAOA 5FQ6E 5BVTA 1BEBA 5L8IA 4BVMA 1KQXA 4HFOA 1S44A 1BM5A 2WWPA 4QGVA 1KZWA 5LKEA 3C77X 4NNTA 5LJBA 3APVA 2NNDA 4KCAA 1DF3A 1U18A 3G7XA 3APUA 1BRQA 3O2YA 3P6HA 1XCAA 3U9PC 3NADA 2AT8X 2G7BA 4TKHA 2L5PA 4YDBA 2AMMX 3WJCA 3KFGA 3RWXA 1SMPI 1BJ7A 1ICMA 2AKQA 1VYGA 1CBIA 3I0AA 2KW1A 4I3CA 1MVGA 2OVEA 1VYFA 3UAQA 2OVAA 1E00A 1JJJA 4ZJ0A 2R73A 3FR2A 5IO6A 4O4XA 4Y0RA 3HOEA 1NP1A 1O1VA 3B2HA 3KFHA 1OBPA 4OS0A 1HMRA 4XMFA 5HA0A 1Y9LA 4BQUA 1GX9A 3TGBA 1A18A 4U3QA 3P24A 3BRNA 5HZ8A 3VPJE 2GTFX 2KD2A 3KZAA 5HWZA 4ZR2A 2OVSA 1EI5A 3U0DA 1FENA 1A3YA 2K23A 1QY1A 1BSOA 1SXYA 2W2BA 1PEEA 4ORRA 2Z4HA 4NLJA 3F6ZB 1P6PA 2LA7A 3CWKA 5F1EA 1LIFA 2FR2A 2AL0X 5LJDA 5D47A 2RQ0A 1ZNHA 2ASNX 1G74A 3FYFA 4FGIB 2HYSA 5DG4A 3B2JA 2YMSA 1EQDA 1TVQA 2Z4IA 5AJCA 2BS5A 4GNWA 1LNMA 4U8UM 2FWVA 2HLVA 3NQ3A 1GKAA 2FS6A 1LICA 1DC9A 4IB8A 1JV4A 5HCCC 1B4MA 3HWGA 1RLBE 3CBSA 3KFFA 4ZHDA 5LJKA 5HBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R74 A;  4LZU A;  2OFM X;  2KTD A;  4A60 A;  4D6A A;  3F9D A;  1U0X A;  1FEL A;  3U03 A;  3OJY C;  3T1D A;  1TOU A;  5H8T A;  3VG6 A;  1IKJ A;  4YGH A;  3ELX A;  4YFR A;  4TKB A;  3JSQ A;  1AVG I;  4XME A;  1EIO A;  3FEN A;  1QWD A;  4ZCB A;  1LID A;  1X71 A;  3C78 X;  4QZU A;  4XMC A;  3VG4 A;  4QYN A;  2HZR A;  3ELZ A;  5EPQ A;  4M6S A;  2AT6 X;  4TNN A;  4WFV A;  2PY1 A;  4BOE A;  1HBQ A;  2OFR X;  1FEM A;  3PH6 A;  4UU3 A;  4YBU A;  1KT4 A;  3MVF A;  1I4U A;  1ACD A;  1ZND A;  4OS3 A;  1G85 A;  1L6M A;  5KIC A;  3TGA A;  1PMP A;  1B8E A;  2G78 A;  2N93 A;  3BX8 A;  5EEE A;  2JU7 A;  4LKP A;  3FEL A;  4R0B A;  1EPB A;  3KQ0 A;  2WEX A;  1AQB A;  3U0D A;  1T8V A;  2K62 A;  2HMB A;  1KXO A;  1OBU A;  2Q39 A;  1X8Q A;  2RD7 C;  5IO7 A;  4ZH9 A;  1KZX A;  5EED A;  3HWD A;  1YP6 A;  1FDQ A;  2Q2P A;  1IFB A;  3CBC A;  1LIB A;  1ICN A;  4RUN A;  4AW8 A;  1KT7 A;  2X45 A;  3F8A A;  1N0S A;  2NP1 A;  3FEK A;  2FT9 A;  4AZR A;  3L4R A;  3NR3 A;  1ZNG A;  2L9C A;  5DPQ A;  1GKA B;  4Y0S A;  3ZUO A;  2QO6 A;  1JBH A;  3O19 A;  3TZS A;  4ALB A;  4YFP A;  4ORX A;  1A2D A;  4I9S A;  3WXQ A;  4A8Z A;  4YH0 A;  2FR3 A;  1ADL A;  4TKJ A;  3VG7 A;  3APX A;  1YP7 A;  2A0A A;  2Q4N A;  3QKG A;  1IW2 A;  3PEC A;  4O9S A;  1YWD A;  3FEP A;  3HWE A;  5D4A A;  4IB9 A;  2W2A A;  1PBO A;  1ZNE A;  1RBP A;  1B56 A;  1OPA A;  1SY3 A;  4XMG A;  3CMP A;  5B29 A;  4ZHC A;  1GT3 A;  5F6Z A;  1NP4 A;  1CRB A;  4NP1 A;  2GC9 A;  1Z24 A;  3D95 A;  1GGL A;  1LKE A;  1TXL A;  4AZM A;  1DFV A;  5C0N A;  4IB6 A;  2CM4 A;  2CZU A;  1HBP A;  4TJZ A;  3WVM A;  3UEX A;  4EFG A;  3P6G A;  5D8J A;  1OBQ A;  1MDC A;  5F58 A;  1MUP A;  3KFI A;  3NPO A;  3UEV A;  4A1Y A;  1GX8 A;  5L8O A;  4AZP A;  4AZQ A;  2OZQ A;  4ZHF A;  5FEN A;  5HZ5 A;  4LKT A;  4ALO A;  4KII A;  2A3F X;  2CBR A;  3O22 A;  1D3S A;  1ERX A;  3Q6L A;  2WEW A;  4YCE A;  2BLG A;  1CBS A;  4PSQ A;  4YKM A;  4K19 A;  4AZN A;  1G5W A;  1LFO A;  1OEE A;  5KID A;  4EDE A;  1R0U A;  2A2G A;  1EUO A;  4GRJ A;  1YWC A;  1EAL A;  3BS2 A;  1GT4 A;  2ACP X;  1ZNK A;  1SXW A;  1GM6 A;  3EBK A;  5BVQ A;  1QY0 A;  1BBP A;  4MVK A;  4TLJ A;  2E4J A;  1ZRY A;  4ORW A;  3GAQ A;  2G79 A;  2MM3 A;  3BU9 A;  3STN A;  4QAE A;  3P6F A;  4OMW A;  2JU3 A;  4ES7 A;  1I06 A;  4AZO A;  5JR8 A;  3D96 A;  3CQN A;  4ZHH A;  1OPB A;  1SXU A;  1FTP A;  2FLJ A;  5H9N A;  1SXX A;  1YIV A;  1LF7 A;  1OEJ A;  3WJD A;  2L68 A;  4EEJ A;  4I9R A;  1A57 A;  4ZHG A;  1DZJ A;  1EW3 A;  1MX7 A;  4YBP A;  1KT6 A;  5H9L A;  4ODD A;  4YCH A;  3PP6 A;  5D48 A;  3B2I A;  1KT5 A;  2O62 A;  2WQA E;  1GT1 A;  4RUU A;  1FE3 A;  2X46 A;  5FAZ A;  3BSZ E;  1S2P A;  5D45 A;  1IIU A;  2HNX A;  4M7M A;  3DTQ A;  1E02 A;  2AT5 X;  3C76 X;  2F73 A;  2NNQ A;  1GT5 A;  1S7D A;  4ORS A;  4MVL A;  1JZU A;  2FRS A;  4HPA A;  4I3D A;  4EXZ A;  2XST A;  5B27 A;  1QFV A;  3FIQ A;  4OS8 A;  2QO5 A;  4ZGU A;  1JJX A;  5AQ6 A;  4GE1 A;  1NGL A;  3FR4 A;  2QOS C;  4TQ2 A;  1ZNL A;  3VG5 A;  1ML7 A;  2A13 A;  5F6B A;  1ERB A;  1YWB A;  1HQP A;  1JYJ A;  3WJF A;  2QM9 A;  5F7G A;  2RCT A;  3BX7 A;  1AEL A;  3WJG A;  2DM5 A;  5H9A A;  2MO5 A;  3VG3 A;  5KHP A;  2GJ5 A;  2AT0 X;  1KOI A;  1KQW A;  2LB6 A;  5LJC A;  1BRP A;  1QG5 A;  5H9K A;  3P6E A;  4LZV A;  4ZFX A;  3WJE A;  2WUT A;  4HPD A;  2R56 A;  4GET A;  1I04 A;  3UEU A;  3JS1 A;  4IBA A;  1HMS A;  3STK A;  3P6D A;  2FS7 A;  2IFB A;  1U17 A;  5HZQ A;  1G7N A;  3EYC A;  4YFQ A;  4XMD A;  1O8V A;  1IFC A;  3IFB A;  1KGL A;  4ZH6 A;  1E06 A;  3UEW A;  3EM0 A;  3IA8 A;  4ORU A;  1LPJ A;  1PM1 X;  4I3B A;  3APW A;  3MBT A;  3BLG A;  4IMO A;  1ALB A;  1TOW A;  2FTB A;  3VG2 A;  5IO5 A;  2WSJ A;  3FW4 A;  2LKK A;  3BU1 A;  3P6C A;  1CJ5 A;  4YKO A;  1HMT A;  1CBR A;  2JOZ A;  2MJI A;  2LFO A;  3K3L A;  3EMM A;  5LKF A;  1DZP A;  2EU7 X;  5EZ2 A;  2CM9 A;  5BVS A;  1AB0 A;  1GXA A;  3ZQ3 A;  1DZK A;  1BSQ A;  1QQS A;  4Y0P A;  4GNY A;  1DV9 A;  3B2L A;  1HN2 A;  4IAW A;  1MX8 A;  3FA6 A;  4GKC A;  1X8P A;  1I05 A;  1X8U A;  2AH7 X;  2LBV A;  1O1U A;  3FA9 A;  1QY2 A;  4NNS A;  5EDB A;  4CK4 A;  1URE A;  2OVD A;  5CE4 A;  5HZ9 A;  5EDC A;  1SY1 A;  4IMN A;  1SA8 A;  2ANS A;  4QYP A;  1CBQ A;  1SY2 A;  4QGX A;  3ZUI A;  3NX2 A;  4DQ4 A;  1UZ2 X;  2JU8 A;  2CZT A;  4NLI A;  2XKL A;  4ORY A;  4ARH A;  2Q2M A;  5LJG A;  2RA6 A;  3HK1 A;  3FLL A;  2ACO A;  3TGC A;  1BSY A;  3FW5 A;  1SY0 A;  1T0V A;  4UU2 A;  4D6B A;  1YWA A;  5K06 A;  4YGG A;  1QFT A;  5HCE C;  1TW4 A;  2POA A;  5LJE A;  3AKN A;  3B2K A;  4GH7 A;  3EBW A;  3FA8 A;  2JN3 A;  2L67 A;  3PH5 A;  1BLR A;  5FFH A;  1X89 A;  2LBA A;  2WR6 A;  3HWF A;  2YG2 A;  1IKE A;  3WBG A;  4WBK A;  4IB7 A;  3S26 A;  4QGW A;  1JYD A;  4HPC A;  3FMZ A;  3WJB A;  4NYQ A;  3TF6 A;  3I17 A;  4XMH A;  4N7D A;  5HAE A;  1D2U A;  4Y0Q A;  5HCD C;  2NNE A;  1EII A;  1EXS A;  3CQR A;  1KT3 A;  3STM X;  2CBS A;  3RZY A;  3DSZ A;  4HPB A;  4IAX A;  4QZT A;  2WQ9 A;  1LIE A;  4YGZ A;  2RCQ A;  1VPR A;  2KT4 B;  3FR5 A;  1X8N A;  4AYH A;  3AKM A;  5HTD A;  1E5P A;  2W2F A;  1X8O A;  3PPT A;  4OMX A;  1XKI A;  2A2U A;  2Q9S A;  4MVI A;  2ALL X;  1T68 X;  3D97 A;  2AT3 X;  4WFU A;  5LJH A;  3BY0 A;  1YUP A;  4NYR A;  5HZ6 A;  1BWY A;  1B0O A;  3NQ9 A;  4DQ3 A;  5HA1 A;  4YMY A;  3CR6 A;  1OEK A;  2HZQ A;  1DZM A;  3FA7 A;  4YDA A;  2QO4 A;  3PED A;  3NX1 A;  3BDR A;  5HTE A;  3RSW A;  5L8N A;  1H91 A;  1EPA A;  4N7C A;  4A1H A;  1QAB E;  2P8G A;  3NP1 A;  3SAO A;  5BVT A;  1BEB A;  5L8I A;  4BVM A;  1KQX A;  4HFO A;  1S44 A;  1BM5 A;  2WWP A;  4QGV A;  1KZW A;  5LKE A;  3C77 X;  4NNT A;  5LJB A;  3APV A;  2NND A;  1DF3 A;  1U18 A;  3G7X A;  3APU A;  1BRQ A;  3O2Y A;  3P6H A;  1XCA A;  3U9P C;  3NAD A;  2AT8 X;  2G7B A;  4TKH A;  2L5P A;  4YDB A;  2AMM X;  3WJC A;  3KFG A;  1BJ7 A;  1ICM A;  2AKQ A;  1VYG A;  1CBI A;  3I0A A;  4I3C A;  1MVG A;  2OVE A;  1VYF A;  2OVA A;  1E00 A;  1JJJ A;  4ZJ0 A;  2R73 A;  3FR2 A;  5IO6 A;  4Y0R A;  1NP1 A;  1O1V A;  3B2H A;  3KFH A;  1OBP A;  4OS0 A;  1HMR A;  4XMF A;  5HA0 A;  4BQU A;  1GX9 A;  3TGB A;  1A18 A;  3BRN A;  5HZ8 A;  2GTF X;  3KZA A;  5HWZ A;  4ZR2 A;  2W2B A;  1FEN A;  1A3Y A;  1QY1 A;  1BSO A;  1SXY A;  2K23 A;  1PEE A;  4ORR A;  4NLJ A;  1P6P A;  5F1E A;  3CWK A;  1LIF A;  2FR2 A;  2AL0 X;  5LJD A;  5D47 A;  2RQ0 A;  1ZNH A;  2ASN X;  1G74 A;  2HYS A;  5DG4 A;  3B2J A;  1EQD A;  1TVQ A;  4GNW A;  1LNM A;  2FWV A;  2HLV A;  3NQ3 A;  1GKA A;  2FS6 A;  1LIC A;  1DC9 A;  4IB8 A;  1JV4 A;  5HCC C;  1B4M A;  3HWG A;  1RLB E;  3CBS A;  3KFF A;  4ZHD A;  5LJK A;  5HBS A; 
#chains in the Genus database with same CATH topology
 2R74 A;  3OD9 A;  1NDJ A;  2OFM X;  2KTD A;  4LZU A;  4A60 A;  4D6A A;  3F9D A;  1U0X A;  1FEL A;  3U03 A;  3OJY C;  3T1D A;  1TOU A;  5H8T A;  1FJ1 E;  1IKJ A;  4YGH A;  3ELX A;  3VG6 A;  4YFR A;  4TKB A;  3JSQ A;  1AVG I;  4XME A;  1EIO A;  3FEN A;  1QWD A;  2X55 A;  1VWI B;  1LID A;  3JQO A;  1X71 A;  4ZCB A;  3C78 X;  4QZU A;  2OL7 A;  3PDF A;  1VWM B;  2GTL N;  4XMC A;  3VG4 A;  4QYN A;  2HZR A;  3ELZ A;  4U46 A;  4OEM A;  4U8U O;  5EPQ A;  4M6S A;  2AT6 X;  4TNN A;  4WFV A;  2RTI B;  2FHL A;  2PY1 A;  4BOE A;  1SWH A;  2FKJ A;  1HBQ A;  2OFR X;  1FEM A;  3PH6 A;  1VWL B;  4UU3 A;  1SWL A;  2Y3E A;  4YBU A;  1KT4 A;  3MM0 A;  4FBV A;  3MVF A;  1I4U A;  3LTW A;  4GJV A;  1ACD A;  4OMX A;  1ZND A;  4OS3 A;  5B5G A;  1G85 A;  3P02 A;  3CKF A;  1L6M A;  5KIC A;  3TGA A;  1PMP A;  1B8E A;  4BGF A;  2G78 A;  2N93 A;  3BX8 A;  5EEE A;  2JU7 A;  4LKP A;  3FEL A;  5AEO A;  4R0B A;  2RTD B;  1EPB A;  3KQ0 A;  4JNJ A;  5B10 O;  2VDF A;  2WEX A;  1AQB A;  1DF8 A;  2AVI A;  1SLD B;  4COT A;  1T8V A;  2K62 A;  2HMB A;  1KXO A;  1OBU A;  1NQN A;  1X8Q A;  2Q39 A;  2RD7 C;  3SOT A;  4ZH9 A;  4O4U A;  4GZV A;  4C5P A;  5IO7 A;  1KZX A;  5EED A;  3HWD A;  4O3W A;  1YP6 A;  1FDQ A;  2Q2P A;  3RBY A;  5CYB A;  1IFB A;  3CBC A;  4NV8 A;  3VHM A;  1LIB A;  1ICN A;  4NV7 A;  4RUN A;  4AW8 A;  1KT7 A;  2X45 A;  3F8A A;  5K67 A;  1N0S A;  2NP1 A;  3FEK A;  3T6F A;  2FT9 A;  4AZR A;  2IZH B;  3L4R A;  3NR3 A;  1ZNG A;  4GDZ A;  1E2T A;  2L9C A;  4I60 A;  1GKA B;  4Y0S A;  1SWN A;  5DPQ A;  2QO6 A;  4Z28 A;  3VGW A;  3ZUO A;  1JBH A;  2I5Z O;  3O19 A;  3ZW1 A;  3TZS A;  4ALB A;  4YFP A;  4ORX A;  1A2D A;  4BX7 A;  2A8G A;  4I9S A;  3WXQ A;  4YH0 A;  4A8Z A;  2FR3 A;  1JIW I;  1JQP A;  1ADL A;  4TKJ A;  3VG7 A;  3APX A;  1YP7 A;  1VWA B;  4QRL A;  2A0A A;  2RTL A;  4KH8 A;  2IZB A;  2Q4N A;  2OYB O;  3QKG A;  1IW2 A;  3PEC A;  4O9S A;  1YWD A;  3FEP A;  1IJ8 A;  3HWE A;  1SWP A;  5D4A A;  3NQK A;  4IB9 A;  4CDC A;  2W2A A;  4CPF A;  4CV7 A;  1PBO A;  3V8U A;  5B2A O;  1ZNE A;  1JMZ A;  2FKG A;  3SZJ A;  1LCV A;  1RBP A;  1B56 A;  3WYQ A;  1SRH A;  5K68 A;  1OPA A;  1SY3 A;  4XMG A;  2JMB A;  3CMP A;  4ZHC A;  5B29 A;  2C1Q A;  4GUZ A;  1GT3 A;  2AF5 A;  5F6Z A;  3T6L A;  1NP4 A;  5BYP A;  1CRB A;  4NP1 A;  1Z24 A;  2GC9 A;  2OF8 A;  3D95 A;  1GGL A;  1LKE A;  1TXL A;  5CSE A;  1DFV A;  4AZM A;  4BX5 A;  5C0N A;  4EQA C;  3AEH A;  4IB6 A;  2CM4 A;  2CZU A;  1HBP A;  4TJZ A;  3RE5 A;  1SWD A;  3UEX A;  2OL6 O;  3WVM A;  4EFG A;  1NC9 A;  3P6G A;  1VWR B;  4KC8 A;  5D8J A;  3ZI8 A;  1MOY A;  1PTS A;  3PQU A;  1OBQ A;  1MDC A;  1SRE A;  3D9W A;  3GE2 A;  5F58 A;  3ZWE A;  1MUP A;  3KFI A;  3NPO A;  1VWJ B;  3UEV A;  4A1Y A;  2C1S A;  4DNE A;  1GX8 A;  5L8O A;  1OSP O;  4AZP A;  1VWH B;  4AZQ A;  2OZQ A;  4ZHF A;  5B5F A;  5FEN A;  1VWF B;  5HZ5 A;  4FBR A;  1HY2 A;  1RST B;  1RXK A;  4FBO A;  4LKT A;  5IXG A;  4O4O A;  2RTH B;  4KII A;  5FQ7 E;  4ALO A;  1SWF A;  2A3F X;  2CBR A;  2IZK A;  3O22 A;  1D3S A;  1ERX A;  2X8S A;  3Q6L A;  2WEW A;  4YCE A;  2BLG A;  1CBS A;  3OE3 A;  4OEL A;  4PSQ A;  4YKM A;  4K19 A;  2UYW A;  3RDX A;  4AZN A;  1G5W A;  1LFO A;  1OEE A;  3AUM O;  5KID A;  4EDE A;  1N4J A;  4EKV A;  1SRJ A;  1R0U A;  3ZW1 B;  2A2G A;  1EUO A;  4GRJ A;  2X34 A;  1YWC A;  1EAL A;  3T2X A;  1HXZ A;  3BS2 A;  1W6F A;  1GT4 A;  1KL4 A;  4BX7 B;  2ACP X;  1ZNK A;  1Y0G A;  1SXW A;  1GM6 A;  3EBK A;  5BVQ A;  1QY0 A;  1N9M A;  3VU1 A;  1BBP A;  4MVK A;  4TLJ A;  2E4J A;  2Y32 A;  1ZRY A;  3KVN A;  2JGS A;  3GAQ A;  1NBX A;  2G79 A;  2MM3 A;  2PI3 O;  3PK2 A;  4ORW A;  3BU9 A;  1LUQ A;  4QAE A;  3RDM A;  3STN A;  4CSB A;  2X56 A;  1HQQ A;  3P6F A;  4OMW A;  2GTL O;  2JU3 A;  4ES7 A;  2GH7 A;  1I06 A;  2CAM A;  1STR B;  4AZO A;  5JR8 A;  3D96 A;  3CQN A;  2X4M A;  4ZHH A;  1OPB A;  4JO6 A;  5L3Y A;  4IAB A;  1SXU A;  1FTP A;  1RAV A;  2FLJ A;  5H9N A;  1AVE A;  4O3X B;  3WZQ A;  1SXX A;  1YIV A;  1LF7 A;  1OEJ A;  3WJD A;  2L68 A;  3VHH A;  3LV4 A;  2ZAG A;  3RDS A;  4I9R A;  4EEJ A;  1SWQ A;  4O3Y A;  3S5X A;  3SLJ A;  1DZJ A;  1EW3 A;  1MX7 A;  4ZHG A;  1VWE B;  3EC5 A;  4YBP A;  1KT6 A;  2HKD A;  5H9L A;  3S5V A;  4BX5 B;  4ODD A;  4O4S A;  2QMI A;  3PP6 A;  4YCH A;  1SLE B;  5D48 A;  4GGZ A;  4GU8 A;  4OKA A;  2RTJ A;  3B2I A;  1KT5 A;  1SWA A;  2O62 A;  3RY1 A;  2WQA E;  4KT5 A;  1GT1 A;  4RUU A;  4U8U N;  4U9C A;  1FE3 A;  2X46 A;  5FAZ A;  3ZW0 A;  3BSZ E;  1S2P A;  3Q34 A;  5D45 A;  2OL8 O;  1IIU A;  2HNX A;  4M7M A;  1PBY A;  3DTQ A;  1E02 A;  1N9Y A;  2AT5 X;  2RTB B;  3C76 X;  2F73 A;  2NNQ A;  1GT5 A;  1LCW A;  1S7D A;  4ORS A;  3SZH A;  2RTN B;  4MVE A;  4MVL A;  5B3M O;  1RXH A;  4MEE A;  2FRS A;  4HPA A;  1JZU A;  4I3D A;  2JW1 A;  4EXZ A;  2XST A;  1MEP A;  1N43 A;  5B27 A;  1QFV A;  3FIQ A;  1SWB A;  4L1N A;  4OS8 A;  4KC7 A;  3ZW2 A;  4Z2V A;  2QO5 A;  4ZGU A;  1JJX A;  5AQ6 A;  4GE1 A;  1NGL A;  3FR4 A;  4INN A;  2QOS C;  4TQ2 A;  4O49 A;  1VWB B;  1ZNL A;  3VG5 A;  1ML7 A;  2A13 A;  4CPH A;  4CPI A;  5F6B A;  1ERB A;  2RTF B;  1YWB A;  1HQP A;  1JYJ A;  1RSU B;  4GD9 A;  2QM9 A;  4IRW A;  5F7G A;  2RCT A;  3WJF A;  3BX7 A;  1AEL A;  4I95 A;  2OFA A;  2OFB A;  3WJG A;  1RXJ A;  1NQM A;  2DM5 A;  2MO5 A;  5H9A A;  3VG3 A;  3WOV A;  2FGS A;  5KHP A;  2G5L A;  2GJ5 A;  4MIR A;  3MX7 A;  2AT0 X;  1KOI A;  1WBI A;  1KQW A;  2LB6 A;  5LJC A;  2I5V O;  1BRP A;  1QG5 A;  5H9K A;  1SWC A;  3HTY A;  2IZJ A;  3LHN A;  2X8T A;  3P6E A;  1VWD B;  5AJB A;  4LZV A;  4ZFX A;  3WJE A;  2WUT A;  4ID2 A;  2MHD A;  4HPD A;  2R56 A;  4GET A;  1I04 A;  3UEU A;  3JS1 A;  4IBA A;  1HMS A;  3STK A;  3RDU A;  3P6D A;  2A5C A;  2FS7 A;  2IFB A;  1U17 A;  5HZQ A;  1G7N A;  3EYC A;  4YFQ A;  4XMD A;  1O8V A;  1K24 A;  1IFC A;  3IFB A;  1KGL A;  2QCB A;  2KTS A;  1E06 A;  1SWO A;  4ZH6 A;  2G8C O;  3EM0 A;  3IA8 A;  4L3R A;  4ORU A;  5F2B A;  3UEW A;  1LPJ A;  1PM1 X;  2IZL B;  3APW A;  3MBT A;  4I3B A;  4Y59 A;  2BS6 A;  3BLG A;  2IZA A;  2RTQ B;  3MG5 A;  4IMO A;  1ALB A;  1AVD A;  4I6S A;  1TOW A;  1STP A;  2QOM A;  2FTB A;  2F09 A;  3VG2 A;  2WSJ A;  5IO5 A;  1K3B A;  1JMX A;  2BT9 A;  3FW4 A;  3ZW0 B;  4DCB A;  3OBL A;  2LKK A;  3BU1 A;  3P6C A;  1CJ5 A;  4MIS A;  1HMT A;  1CBR A;  2GTL M;  2JOZ A;  2MJI A;  4YKO A;  2LFO A;  3X00 A;  3K3L A;  3E3C A;  3VE1 A;  3WZN A;  4Z2P A;  4ZGF A;  3EMM A;  5LKF A;  2BSZ A;  1SRI A;  4BX6 A;  2RTG B;  1Y9T A;  3N91 A;  1DZP A;  2EU7 X;  5EZ2 A;  2CM9 A;  5BVS A;  2IZE B;  1AB0 A;  1GXA A;  3ZQ3 A;  3VE2 A;  1SWR A;  1DZK A;  1BSQ A;  2IZG B;  1QQS A;  4Y0P A;  4GNY A;  1DV9 A;  4BBO A;  4CPH B;  3B2L A;  1HN2 A;  4FQB B;  4IAW A;  2A5B A;  4QQ1 A;  1MX8 A;  3FA6 A;  4GKC A;  1X8P A;  1I05 A;  1X8U A;  2RTM A;  3EW1 A;  2AH7 X;  2LBV A;  1VWC B;  1O1U A;  2RTO B;  3FA9 A;  1QY2 A;  4NNS A;  5EDB A;  2OY7 A;  4CK4 A;  4HWM A;  2X32 A;  1URE A;  2OVD A;  4Z6J A;  5CE4 A;  5HZ9 A;  5EDC A;  1SY1 A;  3HOL A;  3QQ2 A;  4IMN A;  1SA8 A;  2ANS A;  4GJS A;  4QYP A;  1CBQ A;  1SY2 A;  2X8F A;  4QGX A;  3RDO A;  3ZUI A;  3NX2 A;  4DQ4 A;  1UZ2 X;  2JU8 A;  2CZT A;  3RY2 A;  4NLI A;  2XKL A;  4ORY A;  4ARH A;  2Q2M A;  1STS B;  5LJG A;  2RA6 A;  3HK1 A;  1SWU A;  4Z2O A;  3FLL A;  2ACO A;  3TGC A;  1BSY A;  3FW5 A;  1SY0 A;  1T0V A;  1SWK A;  4UU2 A;  4D6B A;  1YWA A;  5FQ8 E;  5K06 A;  4PJ2 A;  4YGG A;  1VWK B;  1QFT A;  4WHI A;  5HCE C;  1TW4 A;  1SLG B;  4QNI A;  2POA A;  5LJE A;  3AKN A;  3B2K A;  4GH7 A;  3EBW A;  1N7Y A;  3FA8 A;  3D4R A;  4JGL A;  2JN3 A;  2L67 A;  3PH5 A;  1A57 A;  1BLR A;  5FFH A;  1X89 A;  2LBA A;  2WR6 A;  1Y52 X;  4B55 A;  3VHI A;  3HWF A;  2YG2 A;  3PQS A;  1IKE A;  2IZF B;  3WBG A;  4WBK A;  4IB7 A;  3S26 A;  4QGW A;  1LEL A;  2MWH A;  1JYD A;  1KL5 A;  2VFB A;  2WPU A;  4HPC A;  2IZI A;  3FMZ A;  4ON1 A;  3SLT A;  3WJB A;  3H3I A;  4ML7 B;  3S60 A;  2RTA A;  4NYQ A;  3TF6 A;  4BJ8 A;  3I17 A;  2M4L A;  4XMH A;  4N7D A;  2MF6 A;  5HAE A;  4LQZ A;  1VWO B;  1D2U A;  3FID A;  4Y0Q A;  3RKG A;  5HCD C;  2NNE A;  1EII A;  5B11 O;  1EXS A;  3ZZV A;  1MK5 A;  3CQR A;  1KT3 A;  3STM X;  1HXL A;  2CBS A;  2ZAI A;  2RN4 A;  3RZY A;  2DJG A;  3DSZ A;  4HPB A;  4IAX A;  4QZT A;  3T2W A;  2WQ9 A;  3NBX X;  1LIE A;  4YGZ A;  2RCQ A;  1VYO A;  1VPR A;  2F01 A;  2KT4 B;  3FR5 A;  1X8N A;  3RDQ A;  3AKM A;  3RE6 A;  4AYH A;  5HTD A;  4BX6 B;  1E5P A;  2W2F A;  1X8O A;  1I9H A;  2RTE B;  3PPT A;  1XKI A;  2A2U A;  2Q9S A;  4MVI A;  1SWS A;  2ALL X;  1T68 X;  3D97 A;  4O3Z A;  2AT3 X;  4WFU A;  5LJH A;  1SWT A;  4GK9 A;  5IRA A;  1SWJ A;  4CDE A;  3BY0 A;  1YUP A;  4NYR A;  3HPE A;  5HZ6 A;  1B0O A;  1BWY A;  3NQ9 A;  4DQ3 A;  5HA1 A;  2BHV A;  4YMY A;  3CR6 A;  3CKG A;  1OEK A;  2HZQ A;  1DZM A;  3FA7 A;  4YDA A;  2QO4 A;  3PED A;  3NX1 A;  2VFC A;  3BDR A;  5HTE A;  2OY5 O;  4BCS A;  3RSW A;  3FDC A;  1H91 A;  4GGT A;  4NW4 A;  1EPA A;  4N7C A;  5L8N A;  1LDQ A;  4A1H A;  1QAB E;  2P8G A;  2FHN X;  3NP1 A;  5IRU A;  1Y53 X;  3SAO A;  5FQ6 E;  4YVB A;  1BEB A;  2RTR B;  5L8I A;  4BVM A;  1KQX A;  5BVT A;  4HFO A;  1S44 A;  1BM5 A;  1SLF B;  2WWP A;  1SWE A;  1UYO X;  4QGV A;  1KZW A;  5LKE A;  3C77 X;  4NNT A;  3WYP A;  5LJB A;  1KL3 A;  3APV A;  2NND A;  4KCA A;  1DF3 A;  1U18 A;  3G7X A;  3APU A;  1BRQ A;  3O2Y A;  3P6H A;  1XCA A;  1VWQ B;  3U9P C;  3NAD A;  2AT8 X;  3SLO A;  2G7B A;  1GX3 A;  4TKH A;  2L5P A;  1VWG B;  4CDF A;  4YDB A;  2RTP B;  4CPE A;  2IZD B;  2IZC B;  1JJU A;  2AMM X;  3WJC A;  3KFG A;  3RWX A;  1SMP I;  1BJ7 A;  1ICM A;  2AKQ A;  1VYG A;  1CBI A;  2OF9 A;  3I0A A;  2KW1 A;  4I3C A;  1MVG A;  2OVE A;  1VYF A;  3UAQ A;  1VWP B;  1LCZ A;  2OVA A;  1E00 A;  1JJJ A;  4ZJ0 A;  5IRW A;  2R73 A;  3FR2 A;  5CHK A;  5IO6 A;  2RTC B;  4O4X A;  4Y0R A;  2C4I A;  3HOE A;  1NP1 A;  4JHQ A;  1O1V A;  3B2H A;  3SZI A;  3KFH A;  1WUB A;  1OBP A;  4OS0 A;  1W4T A;  1HMR A;  2UZ2 A;  4XMF A;  5HA0 A;  1Y9L A;  4BQU A;  1GX9 A;  4Z27 A;  3TGB A;  2RTK A;  1A18 A;  4Y5D A;  4U3Q A;  3P24 A;  3BRN A;  2DJF A;  1SRG A;  5HZ8 A;  3VPJ E;  1W5R A;  2GTF X;  2KD2 A;  3KZA A;  5HWZ A;  4ZR2 A;  1VWN B;  2OVS A;  1EI5 A;  3U0D A;  1FEN A;  1A3Y A;  2K23 A;  1QY1 A;  1BSO A;  1SXY A;  2W2B A;  2Y3F A;  1PEE A;  1Y55 X;  4ORR A;  2Z4H A;  1UYN X;  4NLJ A;  3F6Z B;  1MM9 A;  1P6P A;  2LA7 A;  2ZSC A;  3CWK A;  2BC3 A;  5F1E A;  1LIF A;  5JD2 A;  2FR2 A;  2AL0 X;  5LJD A;  5D47 A;  2RQ0 A;  1ZNH A;  2ASN X;  2OY8 A;  1G74 A;  3FYF A;  4FGI B;  2HYS A;  3WZP A;  4CDD A;  3WZO A;  5DG4 A;  3B2J A;  2YMS A;  1EQD A;  3EW2 A;  1TVQ A;  2Z4I A;  5AJC A;  2BS5 A;  4GNW A;  1I78 A;  1LNM A;  2FWV A;  2HLV A;  4U8U M;  3NQ3 A;  1GKA A;  2FS6 A;  4GDA A;  1LIC A;  1DC9 A;  4IB8 A;  1JV4 A;  5HCC C;  2OY1 O;  1B4M A;  1KFF A;  3HWG A;  4GGR A;  1RLB E;  3CBS A;  1SRF A;  3KFF A;  4ZHD A;  5LJK A;  5HBS A;  1SWG A;  1LDO A; 
#chains in the Genus database with same CATH homology
 2R74 A;  3OD9 A;  2OFM X;  4LZU A;  2KTD A;  4A60 A;  4D6A A;  3F9D A;  1U0X A;  1FEL A;  3U03 A;  3OJY C;  3T1D A;  1TOU A;  5H8T A;  3VG6 A;  1IKJ A;  4YGH A;  3ELX A;  4YFR A;  4TKB A;  3JSQ A;  1AVG I;  4XME A;  1EIO A;  3FEN A;  1QWD A;  4ZCB A;  1LID A;  3JQO A;  1X71 A;  3C78 X;  4QZU A;  4XMC A;  2GTL N;  3VG4 A;  4QYN A;  2HZR A;  3ELZ A;  4U8U O;  5EPQ A;  4M6S A;  2AT6 X;  4TNN A;  4WFV A;  2PY1 A;  4BOE A;  1HBQ A;  2OFR X;  1FEM A;  3PH6 A;  4UU3 A;  4YBU A;  1KT4 A;  4FBV A;  3MVF A;  1I4U A;  1ACD A;  1ZND A;  4OS3 A;  1G85 A;  3P02 A;  1L6M A;  5KIC A;  3TGA A;  1PMP A;  1B8E A;  2G78 A;  2N93 A;  3BX8 A;  5EEE A;  2JU7 A;  4LKP A;  3FEL A;  5AEO A;  4R0B A;  1EPB A;  3KQ0 A;  2WEX A;  1AQB A;  4COT A;  1T8V A;  2K62 A;  2HMB A;  1KXO A;  1OBU A;  2Q39 A;  1X8Q A;  2RD7 C;  3SOT A;  4CV7 A;  4ZH9 A;  4O4U A;  4GZV A;  5IO7 A;  1KZX A;  5EED A;  3HWD A;  4O3W A;  1YP6 A;  1FDQ A;  2Q2P A;  3RBY A;  5CYB A;  1IFB A;  3CBC A;  1LIB A;  1ICN A;  4RUN A;  4AW8 A;  1KT7 A;  2X45 A;  3F8A A;  1N0S A;  2NP1 A;  3FEK A;  2FT9 A;  4AZR A;  3L4R A;  3NR3 A;  1ZNG A;  4GDZ A;  2L9C A;  5DPQ A;  1GKA B;  4Y0S A;  3ZUO A;  2QO6 A;  1JBH A;  3ZW1 A;  3O19 A;  3TZS A;  4ALB A;  4YFP A;  4ORX A;  1A2D A;  4I9S A;  3WXQ A;  4A8Z A;  4YH0 A;  2FR3 A;  1JIW I;  1ADL A;  4TKJ A;  3VG7 A;  3APX A;  1YP7 A;  4QRL A;  2A0A A;  4KH8 A;  2Q4N A;  3QKG A;  1IW2 A;  3PEC A;  4O9S A;  1YWD A;  3FEP A;  3HWE A;  5D4A A;  3NQK A;  4IB9 A;  2W2A A;  1PBO A;  3V8U A;  1ZNE A;  1RBP A;  1B56 A;  1OPA A;  1SY3 A;  4XMG A;  2JMB A;  3CMP A;  4ZHC A;  5B29 A;  5BYP A;  1GT3 A;  5F6Z A;  1NP4 A;  1CRB A;  4NP1 A;  2GC9 A;  1Z24 A;  3D95 A;  1GGL A;  1LKE A;  1TXL A;  4AZM A;  1DFV A;  5C0N A;  4EQA C;  4IB6 A;  2CM4 A;  2CZU A;  1HBP A;  4TJZ A;  3WVM A;  3UEX A;  4EFG A;  3P6G A;  4KC8 A;  5D8J A;  3ZI8 A;  3PQU A;  1OBQ A;  1MDC A;  3GE2 A;  5F58 A;  3ZWE A;  1MUP A;  3KFI A;  3NPO A;  3UEV A;  4A1Y A;  1GX8 A;  5L8O A;  4AZP A;  4AZQ A;  2OZQ A;  4ZHF A;  5FEN A;  5HZ5 A;  4FBR A;  4FBO A;  4LKT A;  4O4O A;  4KII A;  4ALO A;  5FQ7 E;  2A3F X;  2CBR A;  3O22 A;  1D3S A;  1ERX A;  2X8S A;  3Q6L A;  2WEW A;  4YCE A;  2BLG A;  1CBS A;  3OE3 A;  4PSQ A;  4YKM A;  4K19 A;  4AZN A;  1G5W A;  1LFO A;  1OEE A;  5KID A;  4EDE A;  1R0U A;  3ZW1 B;  2A2G A;  1EUO A;  4GRJ A;  1YWC A;  1EAL A;  3BS2 A;  1GT4 A;  2ACP X;  1ZNK A;  1SXW A;  1GM6 A;  3EBK A;  5BVQ A;  1QY0 A;  3VU1 A;  1BBP A;  4MVK A;  4TLJ A;  2E4J A;  1ZRY A;  4ORW A;  3GAQ A;  2G79 A;  4U9C A;  2MM3 A;  3BU9 A;  3STN A;  4QAE A;  4CSB A;  3P6F A;  4OMW A;  2GTL O;  2JU3 A;  4ES7 A;  1I06 A;  4AZO A;  5JR8 A;  3D96 A;  3CQN A;  4ZHH A;  1OPB A;  4IAB A;  1SXU A;  1FTP A;  2FLJ A;  5H9N A;  4O3X B;  1SXX A;  1YIV A;  1LF7 A;  1OEJ A;  3WJD A;  2L68 A;  3LV4 A;  2ZAG A;  4EEJ A;  4I9R A;  1A57 A;  4O3Y A;  3S5X A;  4ZHG A;  1DZJ A;  1EW3 A;  1MX7 A;  4YBP A;  1KT6 A;  5H9L A;  3S5V A;  4ODD A;  4O4S A;  2QMI A;  3PP6 A;  4YCH A;  5D48 A;  4GU8 A;  3B2I A;  1KT5 A;  2O62 A;  2WQA E;  4KT5 A;  1GT1 A;  4RUU A;  4U8U N;  1FE3 A;  2X46 A;  5FAZ A;  3ZW0 A;  3BSZ E;  1S2P A;  5D45 A;  1IIU A;  2HNX A;  4M7M A;  3DTQ A;  1E02 A;  2AT5 X;  3C76 X;  2F73 A;  2NNQ A;  1GT5 A;  1S7D A;  4ORS A;  4MVE A;  4MVL A;  1JZU A;  2FRS A;  4HPA A;  4I3D A;  2JW1 A;  4EXZ A;  2XST A;  5B27 A;  1QFV A;  3FIQ A;  4L1N A;  4OS8 A;  3ZW2 A;  4KC7 A;  2QO5 A;  4ZGU A;  1JJX A;  5AQ6 A;  4GE1 A;  1NGL A;  3FR4 A;  4INN A;  2QOS C;  4TQ2 A;  4O49 A;  1ZNL A;  3VG5 A;  1ML7 A;  2A13 A;  5F6B A;  1ERB A;  1YWB A;  1HQP A;  1JYJ A;  3WJF A;  2QM9 A;  5F7G A;  2RCT A;  3BX7 A;  1AEL A;  4I95 A;  3WJG A;  2DM5 A;  5H9A A;  2MO5 A;  3VG3 A;  3WOV A;  5KHP A;  2GJ5 A;  4MIR A;  3MX7 A;  2AT0 X;  1KOI A;  1KQW A;  2LB6 A;  5LJC A;  1BRP A;  1QG5 A;  5H9K A;  3HTY A;  3LHN A;  2X8T A;  3P6E A;  5AJB A;  4LZV A;  4ZFX A;  3WJE A;  2WUT A;  4ID2 A;  2MHD A;  4HPD A;  2R56 A;  4GET A;  1I04 A;  3UEU A;  3JS1 A;  4IBA A;  1HMS A;  3STK A;  3P6D A;  2FS7 A;  2IFB A;  1U17 A;  5HZQ A;  1G7N A;  3EYC A;  4YFQ A;  4XMD A;  1O8V A;  1IFC A;  3IFB A;  1KGL A;  2KTS A;  1E06 A;  4ZH6 A;  3UEW A;  3EM0 A;  3IA8 A;  4L3R A;  4ORU A;  1LPJ A;  1PM1 X;  4I3B A;  3APW A;  3MBT A;  2BS6 A;  3BLG A;  4IMO A;  1ALB A;  4I6S A;  1TOW A;  2FTB A;  2F09 A;  3VG2 A;  2WSJ A;  5IO5 A;  2BT9 A;  3FW4 A;  3ZW0 B;  3OBL A;  2LKK A;  3BU1 A;  3P6C A;  1CJ5 A;  4MIS A;  1HMT A;  1CBR A;  2GTL M;  2JOZ A;  2MJI A;  4YKO A;  2LFO A;  3K3L A;  3E3C A;  3VE1 A;  4ZGF A;  3EMM A;  5LKF A;  1Y9T A;  3N91 A;  1DZP A;  2EU7 X;  5EZ2 A;  2CM9 A;  5BVS A;  1AB0 A;  1GXA A;  3ZQ3 A;  3VE2 A;  1DZK A;  1BSQ A;  1QQS A;  4Y0P A;  4GNY A;  1DV9 A;  3B2L A;  1HN2 A;  4FQB B;  4IAW A;  4QQ1 A;  1MX8 A;  3FA6 A;  4GKC A;  1X8P A;  1I05 A;  1X8U A;  2AH7 X;  2LBV A;  1O1U A;  3FA9 A;  1QY2 A;  4NNS A;  5EDB A;  4CK4 A;  4HWM A;  1URE A;  2OVD A;  5CE4 A;  5HZ9 A;  5EDC A;  1SY1 A;  3HOL A;  4IMN A;  1SA8 A;  2ANS A;  4QYP A;  1CBQ A;  1SY2 A;  2X8F A;  4QGX A;  3ZUI A;  3NX2 A;  4DQ4 A;  1UZ2 X;  2JU8 A;  2CZT A;  4NLI A;  2XKL A;  4ORY A;  4ARH A;  2Q2M A;  5LJG A;  2RA6 A;  3HK1 A;  3FLL A;  2ACO A;  3TGC A;  1BSY A;  3FW5 A;  1SY0 A;  1T0V A;  4UU2 A;  4D6B A;  1YWA A;  5FQ8 E;  5K06 A;  4PJ2 A;  4YGG A;  1QFT A;  4WHI A;  5HCE C;  1TW4 A;  4QNI A;  2POA A;  5LJE A;  3AKN A;  3B2K A;  4GH7 A;  3EBW A;  3FA8 A;  4JGL A;  3D4R A;  2JN3 A;  2L67 A;  3PH5 A;  1BLR A;  5FFH A;  1X89 A;  2LBA A;  2WR6 A;  3HWF A;  2YG2 A;  3PQS A;  1IKE A;  3WBG A;  4WBK A;  4IB7 A;  3S26 A;  4QGW A;  2MWH A;  1JYD A;  4HPC A;  3FMZ A;  4ON1 A;  3WJB A;  3H3I A;  4ML7 B;  3S60 A;  4NYQ A;  3TF6 A;  3I17 A;  2M4L A;  4XMH A;  4N7D A;  5HAE A;  4LQZ A;  1D2U A;  4Y0Q A;  3RKG A;  5HCD C;  2NNE A;  1EII A;  1EXS A;  3ZZV A;  3CQR A;  1KT3 A;  3STM X;  2CBS A;  2ZAI A;  2RN4 A;  3RZY A;  3DSZ A;  4HPB A;  4IAX A;  4QZT A;  2WQ9 A;  3NBX X;  1LIE A;  4YGZ A;  2RCQ A;  1VPR A;  2KT4 B;  3FR5 A;  1X8N A;  4AYH A;  3AKM A;  5HTD A;  1E5P A;  2W2F A;  1X8O A;  3PPT A;  4OMX A;  1XKI A;  2A2U A;  2Q9S A;  4MVI A;  4O3Z A;  2ALL X;  1T68 X;  3D97 A;  2AT3 X;  4WFU A;  5LJH A;  4GK9 A;  3BY0 A;  1YUP A;  4NYR A;  5HZ6 A;  1BWY A;  1B0O A;  3NQ9 A;  4DQ3 A;  5HA1 A;  2BHV A;  4YMY A;  3CR6 A;  1OEK A;  2HZQ A;  1DZM A;  3FA7 A;  4YDA A;  2QO4 A;  3PED A;  3NX1 A;  3BDR A;  5HTE A;  3RSW A;  5L8N A;  1H91 A;  4NW4 A;  1EPA A;  4N7C A;  4A1H A;  1QAB E;  2P8G A;  3NP1 A;  3SAO A;  5FQ6 E;  5BVT A;  1BEB A;  5L8I A;  4BVM A;  1KQX A;  4HFO A;  1S44 A;  1BM5 A;  2WWP A;  4QGV A;  1KZW A;  5LKE A;  3C77 X;  4NNT A;  5LJB A;  3APV A;  2NND A;  4KCA A;  1DF3 A;  1U18 A;  3G7X A;  3APU A;  1BRQ A;  3O2Y A;  3P6H A;  1XCA A;  3U9P C;  3NAD A;  2AT8 X;  2G7B A;  4TKH A;  2L5P A;  4YDB A;  2AMM X;  3WJC A;  3KFG A;  3RWX A;  1SMP I;  1BJ7 A;  1ICM A;  2AKQ A;  1VYG A;  1CBI A;  3I0A A;  2KW1 A;  4I3C A;  1MVG A;  2OVE A;  1VYF A;  3UAQ A;  2OVA A;  1E00 A;  1JJJ A;  4ZJ0 A;  2R73 A;  3FR2 A;  5IO6 A;  4O4X A;  4Y0R A;  3HOE A;  1NP1 A;  1O1V A;  3B2H A;  3KFH A;  1OBP A;  4OS0 A;  1HMR A;  4XMF A;  5HA0 A;  1Y9L A;  4BQU A;  1GX9 A;  3TGB A;  1A18 A;  4U3Q A;  3P24 A;  3BRN A;  5HZ8 A;  3VPJ E;  2GTF X;  2KD2 A;  3KZA A;  5HWZ A;  4ZR2 A;  2OVS A;  1EI5 A;  3U0D A;  1FEN A;  1A3Y A;  2K23 A;  1QY1 A;  1BSO A;  1SXY A;  2W2B A;  1PEE A;  4ORR A;  2Z4H A;  4NLJ A;  3F6Z B;  1P6P A;  2LA7 A;  3CWK A;  5F1E A;  1LIF A;  2FR2 A;  2AL0 X;  5LJD A;  5D47 A;  2RQ0 A;  1ZNH A;  2ASN X;  1G74 A;  3FYF A;  4FGI B;  2HYS A;  5DG4 A;  3B2J A;  2YMS A;  1EQD A;  1TVQ A;  2Z4I A;  5AJC A;  2BS5 A;  4GNW A;  1LNM A;  4U8U M;  2FWV A;  2HLV A;  3NQ3 A;  1GKA A;  2FS6 A;  1LIC A;  1DC9 A;  4IB8 A;  1JV4 A;  5HCC C;  1B4M A;  3HWG A;  1RLB E;  3CBS A;  3KFF A;  4ZHD A;  5LJK A;  5HBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...