3NADA

Crystal structure of phenolic acid decarboxylase from bacillus pumilus ui-670
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
161
structure length
161
Chain Sequence
MDQFVGLHMIYTYENGWEYEIYIKNDHTIDYRIHSGMVGGRWVRDQEVNIVKLTKGVYKVSWTEPTGTDVSLNFMPEEKRMHGVIFFPKWVHERPDITVCYQNDYIDLMKESREKYETYPKYVVPEFADITYIHHAGVNDETIIAEAPYEGMTDEIRAGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferulate decarboxylase
publication title Structural analysis of Bacillus pumilus phenolic acid decarboxylase, a lipocalin-fold enzyme.
pubmed doi rcsb
source organism Bacillus pumilus
total genus 43
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05870 PA_decarbox Phenolic acid decarboxylase (PAD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3nadA00
5JR8A 3JSQA 1TXLA 5HZQA 2X45A 4LZVA 1LIFA 4I9SA 2FS7A 1GT4A 4Y0QA 1GT5A 4HPAA 1EUOA 4A1HA 5FAZA 2ASNX 4YGHA 1KQXA 1X71A 1DZPA 5EDCA 4BOEA 5FENA 1ZRYA 4NLJA 1EPAA 1DF3A 1RBPA 3P6FA 4GE1A 2AL0X 2WR6A 4YDBA 1HMSA 4O9SA 1EW3A 4A60A 5F58A 2A2GA 3NX2A 1CBRA 4ALOA 5LKEA 4M7MA 3AKNA 1LPJA 2JU8A 4ZHCA 2XKLA 4R0BA 1D3SA 3QKGA 3WJBA 2JOZA 2OVEA 1KGLA 3BY0A 2OVAA 3G7XA 4ZJ0A 4ES7A 4TKHA 3IA8A 3P6HA 4IAXA 1ZNDA 1SXUA 3CBCA 4QYPA 1DV9A 4Y0PA 1SY2A 3ELZA 3FA7A 1QFTA 2NNQA 2GC9A 5D4AA 4UU3A 1YP7A 1IIUA 3WJDA 1JJXA 3GAQA 1HBPA 1HMTA 5LKFA 2W2AA 1BSQA 4GNWA 3BS2A 5HCEC 1A57A 2WWPA 1ADLA 3CR6A 4OMXA 3C77X 4TKJA 4YKOA 1UZ2X 1P6PA 3KZAA 5HTDA 3B2KA 3RZYA 3TZSA 2AT6X 4N7DA 4TLJA 4Y0SA 1EQDA 4ORUA 3UEUA 4K19A 4ALBA 3ZUOA 2AH7X 4EEJA 1AELA 1DZKA 5KHPA 3OJYC 4NYRA 1EPBA 5D48A 3FIQA 3APWA 4I3BA 4ORWA 1RLBE 3VG3A 4TNNA 1HMRA 4YMYA 2FRSA 4QYNA 4YCEA 5DPQA 1JV4A 2L68A 2Q2MA 2NNEA 3NPOA 2KTDA 1SY1A 4IB7A 5B29A 1QABE 5H9KA 3O19A 1O1UA 1U0XA 3FA6A 3NADA 2L5PA 3D97A 4XMFA 4XMGA 3APXA 2WQAE 2LB6A 4AZMA 3HK1A 3WJGA 4YKMA 4GH7A 2HNXA 4GETA 5C0NA 2OZQA 1Z24A 2AT3X 4Y0RA 4QAEA 2A3FX 2MO5A 5EPQA 1GX8A 2Q4NA 2R56A 3U0DA 3D96A 2FTBA 5DG4A 1OEJA 4ZFXA 4BVMA 1TW4A 2LKKA 1LIEA 4OS3A 1GXAA 1S7DA 4YBUA 1D2UA 4QZTA 1KT3A 2ALLX 5IO5A 2POAA 4PSQA 1B0OA 1MDCA 1BEBA 3WVMA 5HZ8A 4YCHA 1OBQA 4M6SA 2AKQA 3B2HA 3MBTA 1SY0A 2MM3A 5LJHA 1T8VA 3FEPA 1B4MA 4UU2A 2GJ5A 3C76X 1KT4A 2Q2PA 1KT6A 3STKA 1PMPA 5K06A 2QO5A 2LBAA 1HQPA 3FEKA 2O62A 1KOIA 3FA9A 3CMPA 3P6CA 1PBOA 4D6BA 1I4UA 1OBPA 4I3CA 1OEKA 1I05A 3ZUIA 5B27A 1ERBA 4ZHDA 3WJCA 3PH5A 1QG5A 4YFPA 5LJGA 4DQ4A 1ALBA 3IFBA 4GRJA 4TJZA 1KT5A 2CBRA 1NGLA 1X8NA 2FR2A 2OFRX 1JJJA 1FELA 2AT5X 4CK4A 2CM9A 1IKJA 4AW8A 2OVDA 1AQBA 4WFUA 3L4RA 1EXSA 1QQSA 3FR4A 4EFGA 4XMEA 3NR3A 1MVGA 1S2PA 4QGVA 3WBGA 3VG6A 3BDRA 1IFBA 4QGXA 1A18A 3JS1A 1LIDA 1YWBA 5LJEA 3B2JA 1O8VA 3KFGA 5F6ZA 5HTEA 3FELA 2GTFX 3CBSA 1ML7A 1DC9A 2ANSA 5HA1A 3KFIA 5F6BA 1CBQA 3BU9A 3FW4A 5FFHA 3APVA 1LIBA 2W2BA 3TF6A 3NQ9A 1SA8A 5LJCA 1PM1X 4YGZA 2A2UA 3CQRA 3FR2A 2WEXA 5L8OA 3DTQA 3P6GA 4XMCA 1GT1A 1PEEA 2G78A 3NP1A 3SAOA 2WEWA 1MX7A 1CBIA 1LICA 1LKEA 4LKTA 3HWEA 2FR3A 4IMNA 4ORYA 1ICNA 5IO6A 5BVTA 3F8AA 1VPRA 2HZQA 3S26A 4NP1A 4AYHA 5D8JA 1BLRA 3PECA 1FDQA 1X8QA 2E4JA 1GX9A 4WBKA 2IFBA 3Q6LA 4AZOA 2EU7X 4EDEA 2W2FA 5H8TA 4ZHGA 5D47A 1KZWA 3B2IA 4RUNA 4YFRA 4A1YA 1XKIA 1A2DA 1YWCA 3FR5A 1BSYA 1A3YA 4ZHHA 1E02A 5BVSA 5KIDA 3NQ3A 1E06A 1YUPA 3F9DA 2FWVA 1OPBA 2HYSA 3TGBA 1BBPA 2AT8X 5HZ5A 1QY2A 4YFQA 3C78X 1QY1A 1ERXA 5HA0A 1AVGI 2CBSA 4ZH6A 1CBSA 1LF7A 1G74A 3FMZA 3UEVA 2Q39A 2YG2A 4XMHA 5F7GA 4ZR2A 2CZTA 2RQ0A 2R73A 3P6EA 1FTPA 2RD7C 1OPAA 3KFFA 3VG5A 3U9PC 1XCAA 4OS0A 3VG7A 1OEEA 3HWGA 1LFOA 2RCQA 2A13A 1E00A 1SXWA 3ZQ3A 2P8GA 2HMBA 3BLGA 1ICMA 4IBAA 1R0UA 4ORRA 1BRQA 4D6AA 1YIVA 1DZMA 3BRNA 5LJDA 2N93A 2BLGA 1VYFA 1B56A 2FS6A 1N0SA 3KFHA 5AQ6A 4NNTA 5L8IA 4HPCA 2NP1A 3APUA 3BU1A 1ZNLA 1GKAB 4MVIA 5BVQA 1HN2A 1G5WA 2FLJA 4LKPA 4XMDA 4EXZA 1BM5A 2LFOA 1X89A 4HFOA 4DQ3A 5HZ6A 1JBHA 2JN3A 1TOUA 1NP1A 4LZUA 5H9LA 1YWAA 1MUPA 1ZNGA 2HLVA 3EYCA 2QOSC 4MVLA 3K3LA 5D45A 5L8NA 2CZUA 5HBSA 3VG2A 3WXQA 1GGLA 5HCDC 4NLIA 1FENA 1UREA 2ACPX 4ORXA 1QY0A 1KXOA 2K62A 2ACOA 5LJKA 3BSZE 3UEXA 4GKCA 5KICA 1EALA 1EIIA 1KT7A 1JYDA 2X46A 2AT0X 2HZRA 2XSTA 3P6DA 1HBQA 4HPDA 4IAWA 5HWZA 3ELXA 4I3DA 1AB0A 2A0AA 3MVFA 4BQUA 4TQ2A 1B8EA 1SXXA 3I17A 1IW2A 1I06A 3KQ0A 4AZRA 4IB9A 3BX8A 3EMMA 2WSJA 1QWDA 1VYGA 1KZXA 1QFVA 3TGAA 5EZ2A 3U03A 1ZNEA 2WQ9A 3D95A 4OS8A 1FEMA 5IO7A 1U18A 4AZQA 1NP4A 2G79A 2AMMX 4QGWA 1LNMA 3RSWA 1OBUA 2L9CA 3HWDA 4RUUA 2KT4B 1BSOA 2G7BA 3EM0A 5CE4A 3PPTA 2QM9A 1X8UA 1E5PA 3STMX 2LBVA 1L6MA 4ARHA 4NNSA 5HCCC 4YH0A 1FE3A 2F73A 2JU7A 4YDAA 4ZHFA 3O22A 1H91A 2QO4A 4YGGA 3FLLA 2OFMX 3O2YA 1GM6A 1SY3A 4I9RA 3WJEA 4KIIA 1X8OA 1BRPA 3DSZA 3PH6A 2PY1A 4GNYA 3UEWA 3STNA 1YP6A 1IFCA 3NX1A 1CJ5A 4WFVA 2CM4A 1U17A 1GT3A 1JZUA 3FW5A 4A8ZA 2WUTA 1O1VA 2QO6A 1EIOA 1YWDA 4QZUA 3TGCA 2DM5A 4N7CA 3WJFA 3EBWA 1CRBA 5F1EA 5EDBA 3BX7A 1BWYA 1BJ7A 3B2LA 1ZNHA 4HPBA 3EBKA 4ODDA 3CQNA 3T1DA 5LJBA 1ZNKA 2FT9A 1DZJA 3VG4A 3AKMA 4ZCBA 4ZH9A 4AZPA 1ACDA 1G85A 2MJIA 1SXYA 4IB6A 4MVKA 1S44A 2RCTA 1GKAA 1KQWA 3FENA 3CWKA 1T68X 2L67A 3HWFA 2K23A 5EEDA 1IKEA 2RA6A 1T0VA 1DFVA 3PP6A 2JU3A 1I04A 3PEDA 1JYJA 4IB8A 4OMWA 4AZNA 5EEEA 5H9AA 4NYQA 3I0AA 1TVQA 5HAEA 4ZGUA 1X8PA 2R74A 1G7NA 3FA8A 2Q9SA 4ORSA 4IMOA 4YBPA 5HZ9A 4TKBA 1MX8A 2NNDA 5H9NA 1TOWA
chains in the Genus database with same CATH superfamily
2FHLA 3LHNA 5JR8A 3JSQA 1RAVA 1FJ1E 2DJGA 1TXLA 5HZQA 2X45A 2OF9A 1OSPO 4LZVA 1LIFA 4I9SA 2FS7A 1GT4A 4Y0QA 1SWEA 4U8UM 1GT5A 4HPAA 4O3ZA 1EUOA 1VWBB 4A1HA 5AJBA 2ASNX 4YGHA 5FAZA 1NBXA 4NW4A 1KQXA 3RDUA 2RTBB 4Z2PA 1X71A 4CPEA 3T6FA 1VWJB 4YVBA 1DZPA 5EDCA 4BOEA 5FENA 1ZRYA 4NLJA 4OKAA 3QQ2A 1EPAA 1DF3A 1RBPA 3P6FA 4GE1A 2AL0X 2WR6A 4YDBA 1HMSA 4O9SA 1EW3A 4A60A 1SWBA 5F58A 2A2GA 1SRHA 3N91A 3NX2A 1CBRA 4BX7A 5L3YA 4ALOA 5LKEA 4M7MA 3AKNA 1LPJA 2JU8A 3HOEA 2RTCB 4ZHCA 2RTMA 1SWCA 2XKLA 4R0BA 1D3SA 3QKGA 2RTEB 3WJBA 1VWAB 2JOZA 2OVEA 1KGLA 3BY0A 2OVAA 3G7XA 4ZJ0A 4ES7A 4TKHA 3IA8A 3P6HA 4IAXA 3RDMA 1ZNDA 5IXGA 4BX6A 1SXUA 3CBCA 4O3YA 4QYPA 3WZPA 4KT5A 1DV9A 1SWSA 3AUMO 1SY2A 4KC8A 4U9CA 3ELZA 2RTKA 2X56A 1JJUA 2RTFB 2RTAA 3FA7A 1QFTA 5B5FA 2NNQA 2GC9A 5D4AA 4UU3A 1VWGB 1IIUA 1YP7A 4KC7A 3GAQA 3WJDA 1JJXA 1HBPA 1HMTA 5LKFA 2F09A 2RN4A 1BSQA 2W2AA 4GNWA 3BS2A 4AZOA 5HCEC 1A57A 2WWPA 1ADLA 3CR6A 4OMXA 3C77X 4TKJA 4YKOA 1UZ2X 1P6PA 3KZAA 3RY2A 3B2KA 3RZYA 5HTDA 3TZSA 3Q34A 5IRUA 2X32A 3ZW2A 4CPHA 2AT6X 2DJFA 2RTNB 4N7DA 4TLJA 4Y0SA 1EQDA 4ORUA 3UEUA 4K19A 1I78A 4Y0PA 4ALBA 4Z27A 3ZUOA 2AH7X 1N43A 4GUZA 2MF6A 4EEJA 1NDJA 1AELA 1DZKA 5KHPA 3OJYC 4I95A 4INNA 1EPBA 4NYRA 5D48A 3FIQA 3APWA 4I3BA 4ORWA 1RLBE 3S5XA 3VG3A 4TNNA 1HMRA 2ZSCA 4YMYA 2FRSA 4QYNA 4YCEA 5DPQA 4EKVA 1JV4A 2L68A 1HQQA 2Q2MA 3VHIA 2NNEA 4CPHB 5IRWA 2KD2A 3WOVA 1SLDB 2RTIB 3NPOA 1STSB 2KTDA 1SY1A 2X55A 4IB7A 4GGTA 3RDOA 1QABE 5B29A 5H9KA 4O3WA 2QCBA 2A5BA 3O19A 1O1UA 1U0XA 3FA6A 3NADA 5B5GA 2L5PA 2I5ZO 3D97A 4XMFA 4XMGA 4GJSA 3APXA 2WQAE 2LB6A 4MVEA 3HK1A 4AZMA 3WJGA 3VGWA 4YKMA 3P24A 4C5PA 4GH7A 2HNXA 4GETA 5C0NA 1MM9A 2OZQA 2IZKA 1Z24A 2AT3X 4Y0RA 4QAEA 2A3FX 2MO5A 5EPQA 1GX8A 1JMXA 2Q4NA 2R56A 3U0DA 3D96A 3SOTA 1VYOA 2CAMA 1Y52X 1VWLB 2FTBA 5DG4A 1OEJA 3JQOA 2RTJA 4L1NA 4ZFXA 4BVMA 1TW4A 2LKKA 4CSBA 1LIEA 4OS3A 1GXAA 1S7DA 4YBUA 1RSUB 1D2UA 4QZTA 1KT3A 2ALLX 5IO5A 1HXZA 2POAA 4PSQA 5K67A 1NQMA 3KVNA 2AVIA 4GGRA 1B0OA 3NQKA 2RTRB 1MDCA 1BEBA 3RDQA 3HTYA 3WVMA 5HZ8A 4YCHA 4Z6JA 1OBQA 4M6SA 2AKQA 3B2HA 3MBTA 1SY0A 2A5CA 2MM3A 5LJHA 3T2XA 4GZVA 1T8VA 3FEPA 3PQUA 4GGZA 1MEPA 1B4MA 4UU2A 2GJ5A 3C76X 1KT4A 2Q2PA 1KT6A 3STKA 1PMPA 5K06A 2QO5A 2LBAA 1HQPA 1WBIA 3FEKA 2O62A 1KOIA 3FA9A 3CMPA 2Y32A 3P6CA 3OD9A 1PBOA 1DF8A 4D6BA 2RTPB 1I4UA 1OBPA 4ZGFA 1K3BA 4I3CA 1OEKA 4O4UA 1N7YA 4I6SA 3WZNA 1I05A 2OY8A 3ZUIA 5B27A 1ERBA 5CHKA 3WJCA 1SREA 4ZHDA 3PH5A 1QG5A 4WHIA 4YFPA 5LJGA 1Y0GA 4DQ4A 1ALBA 3IFBA 2GTLN 2OL6O 1SWHA 4GRJA 4TJZA 1KT5A 2CBRA 1NGLA 1X8NA 2FR2A 2OFRX 5B10O 3RY1A 1JJJA 4CDDA 3ZW1A 1FELA 5F2BA 2AT5X 2ZAIA 4Y5DA 1SWGA 2X34A 2CM9A 4CK4A 1IKJA 1HXLA 4MISA 4AW8A 2OVDA 1AQBA 3F6ZB 1SLGB 3L4RA 1EXSA 1SWTA 1QQSA 3FR4A 4WFUA 4EFGA 4XMEA 3NR3A 4KCAA 1MVGA 3S60A 2IZEB 1VWHB 1S2PA 1Y9LA 1NC9A 2GH7A 3RDSA 3WBGA 4QGVA 1UYNX 3VG6A 3BDRA 1IFBA 1UYOX 5B11O 1STRB 4GJVA 4QGXA 1A18A 3JS1A 1LIDA 1YWBA 4ML7B 4O4SA 5LJEA 1SWDA 4U46A 1SRFA 3B2JA 1Y9TA 2IZDB 1O8VA 4GK9A 3KFGA 5F6ZA 1SMPI 3FELA 2GTFX 2IZFB 3CBSA 5HTEA 3RBYA 3ZW1B 4JO6A 1KFFA 1ML7A 1DC9A 2ANSA 1KL4A 3KFIA 5HA1A 5F6BA 1CBQA 1KL3A 2RTLA 3AEHA 3BU9A 3FW4A 3APVA 1LIBA 2W2BA 5FFHA 3RDXA 2IZIA 4CDFA 3TF6A 3E3CA 4Z2VA 3NQ9A 2M4LA 1RXHA 1SA8A 2WPUA 5LJCA 1SWPA 1PM1X 1AVEA 4YGZA 3SZIA 2A2UA 3CQRA 3VHHA 2GTLO 3FR2A 2WEXA 5L8OA 3DTQA 3MG5A 3P6GA 1N9MA 1SLFB 1VWKB 1GT1A 2UZ2A 4XMCA 2G78A 3NP1A 4PJ2A 1PEEA 3D4RA 2OF8A 3LTWA 3SAOA 2WEWA 3FIDA 1MX7A 4JGLA 1CBIA 1LICA 1LKEA 4LKTA 3HWEA 1VWFB 2FR3A 4IMNA 5AJCA 1SRGA 1ICNA 4ORYA 1SWUA 1SWOA 4O3XB 1K24A 3RE5A 3F8AA 4DNEA 5BVTA 5IO6A 1VPRA 2HZQA 5FQ6E 4NP1A 3S26A 2OY7A 4AYHA 3SLTA 4FBOA 5D8JA 1BLRA 1EIIA 3PECA 2RTDB 1AVDA 1FDQA 2JMBA 1X8QA 2IZBA 5JD2A 4GD9A 4CDCA 3HPEA 2E4JA 1GX9A 3PDFA 2IFBA 3Q6LA 4U8UO 4WBKA 5IRAA 2C1QA 2EU7X 2HKDA 2VFBA 2W2FA 4EDEA 3FYFA 5AEOA 5H8TA 4ZHGA 5FQ7E 2KW1A 5D47A 1KZWA 1VWOB 3B2IA 4RUNA 2A8GA 1I9HA 1SWJA 2PI3O 3SLOA 4YFRA 4A1YA 1XKIA 3ZW0A 1A2DA 1LDOA 4JNJA 3RWXA 1VWEB 1YWCA 2KTSA 3FR5A 1BSYA 1A3YA 4QRLA 4ZHHA 1E02A 1VWPB 2IZLB 5BVSA 5KIDA 1Y53X 3GE2A 2OFAA 3NQ3A 1E06A 1YUPA 1N4JA 3F9DA 2FWVA 1OPBA 2HYSA 3CKFA 1SWQA 5CSEA 3OE3A 3TGBA 1BBPA 2AT8X 5HZ5A 1QY2A 4YFQA 3WZOA 2YMSA 4GU8A 1VWCB 3C78X 1QY1A 1ERXA 5HA0A 1AVGI 2CBSA 4ZH6A 1CBSA 1LF7A 1G74A 3FMZA 4ID2A 2BS6A 2OYBO 3UEVA 2Q39A 2BT9A 2YG2A 4XMHA 5F7GA 3ZW0B 4ZR2A 1PBYA 3EW1A 2CZTA 3OBLA 2RQ0A 3LV4A 2R73A 2QOMA 4QNIA 2MHDA 3P6EA 1FTPA 4KH8A 1VWRB 2RD7C 4LQZA 4BGFA 4BBOA 1OPAA 3KFFA 3VG5A 3U9PC 1XCAA 4OS0A 4BX5B 1LCVA 2IZAA 4DCBA 3VG7A 1OEEA 1LDQA 3HWGA 1LFOA 2RCQA 2A13A 1E00A 1SXWA 3ZQ3A 4U3QA 2G5LA 3WYQA 2P8GA 2JGSA 4CDEA 1SWNA 2FGSA 3S5VA 2OFBA 2HMBA 3BLGA 1ICMA 4IBAA 1PTSA 1R0UA 4ORRA 1BRQA 3PQSA 4D6AA 3SZHA 1YIVA 1DZMA 1IJ8A 3BRNA 5LJDA 2BSZA 2N93A 2BLGA 1SWRA 1GX3A 1VYFA 1B56A 1RXKA 2FS6A 1KL5A 3T2WA 1N0SA 3RKGA 4GDZA 3KFHA 5AQ6A 4NNTA 4O4OA 5L8IA 1LCZA 4HPCA 1SLEB 2NP1A 3APUA 4Z28A 3BU1A 1VWNB 1ZNLA 2OY5O 1GKAB 4MVIA 5BVQA 1HN2A 1G5WA 2FLJA 4LKPA 3H3IA 4XMDA 3VPJE 4EXZA 2X8TA 2RTGB 1BM5A 2F01A 1X89A 2LFOA 4HFOA 2RTOB 4L3RA 4DQ3A 5HZ6A 4I60A 1JBHA 2JN3A 4O4XA 3CKGA 1TOUA 1NP1A 4LZUA 5H9LA 3SLJA 3X00A 1YWAA 1SRIA 4U8UN 1LCWA 1MUPA 5K68A 1VWMB 1ZNGA 2HLVA 3EYCA 2QOSC 4MVLA 3K3LA 5D45A 5L8NA 2CZUA 4CPFA 1SWKA 5BYPA 2VDFA 5HBSA 3VG2A 2BHVA 1GGLA 4HWMA 3WXQA 5HCDC 4NLIA 1FENA 1UREA 1VWIB 1W4TA 2ACPX 4BJ8A 4ORXA 3VE2A 3ZWEA 1QY0A 2RTHB 1KXOA 2BC3A 2ACOA 2K62A 5LJKA 3BSZE 3UEXA 4GKCA 3V8UA 4QQ1A 3WZQA 5KICA 1EALA 1KT7A 1JYDA 3PK2A 2X46A 2AT0X 2HZRA 2OVSA 2XSTA 3P6DA 3RE6A 2C4IA 1EI5A 1HBQA 4HPDA 4IAWA 5HWZA 3ELXA 4I3DA 4OEMA 1AB0A 2A0AA 4O49A 3SZJA 5LJBA 3MVFA 4BQUA 4TQ2A 1B8EA 1SXXA 3I17A 1SRJA 1IW2A 3UAQA 1I06A 3T6LA 3KQ0A 4AZRA 4IB9A 3BX8A 3EMMA 2WSJA 1QWDA 1VYGA 1KZXA 1QFVA 4GDAA 5EZ2A 3TGAA 3U03A 1ZNEA 1N9YA 4BX7B 2WQ9A 3D95A 4OS8A 3VHMA 4COTA 1LELA 2Z4IA 1FEMA 3D9WA 5IO7A 1U18A 4AZQA 1NP4A 2G79A 2G8CO 2AMMX 4FQBB 4QGWA 2BS5A 1LNMA 3RSWA 2LA7A 1OBUA 4FBRA 2L9CA 2FKJA 3HWDA 2IZCB 4MEEA 2I5VO 4RUUA 2KT4B 1BSOA 2G7BA 3EM0A 1Y55X 5CE4A 3PPTA 2QM9A 1X8UA 4NV7A 1E5PA 4BX6B 3STMX 2LBVA 1L6MA 1MOYA 2C1SA 4NNSA 1LUQA 4OELA 5FQ8E 4ARHA 5HCCC 4YH0A 1FE3A 2F73A 2JU7A 3EW2A 4YDAA 3O22A 3MX7A 1JMZA 3ZZVA 1H91A 4ZHFA 2QO4A 4IRWA 3FLLA 4YGGA 2OFMX 3O2YA 1GM6A 1SY3A 4I9RA 2QMIA 3WJEA 4Y59A 2VFCA 4KIIA 4CV7A 1RXJA 1X8OA 1BRPA 3DSZA 3PH6A 4ON1A 4CPIA 4BX5A 2PY1A 4GNYA 3UEWA 1VWDB 4FGIB 3STNA 1YP6A 3EC5A 1IFCA 3NX1A 2MWHA 4NV8A 2OL8O 1CJ5A 2AF5A 4WFVA 5B3MO 1SWFA 4BCSA 2CM4A 1U17A 1GT3A 3NBXX 1JZUA 3FW5A 4JHQA 1W5RA 4A8ZA 2X4MA 2IZJA 4IABA 2WUTA 2OL7A 2Z4HA 1O1VA 2QO6A 1EIOA 1YWDA 4QZUA 3WYPA 3TGCA 3ZI8A 2DM5A 4N7CA 3HOLA 4FBVA 2Y3EA 3WJFA 3EBWA 1CRBA 5F1EA 5EDBA 3BX7A 1BWYA 1HY2A 4MIRA 1BJ7A 2FHNX 1ZNHA 3B2LA 1E2TA 3EBKA 3CQNA 4HPBA 4ODDA 3T1DA 1ZNKA 2FT9A 1DZJA 2IZHB 2X8SA 3VG4A 3AKMA 1NQNA 4ZCBA 4ZH9A 4AZPA 3VE1A 1ACDA 1JIWI 1G85A 2Y3FA 2MJIA 4B55A 3MM0A 1JQPA 1SXYA 2OY1O 2X8FA 4IB6A 4MVKA 1S44A 2RCTA 1GKAA 1KQWA 3FENA 2GTLM 3CWKA 1T68X 5CYBA 3P02A 2L67A 3HWFA 1STPA 2K23A 5EEDA 1IKEA 2RA6A 1T0VA 2ZAGA 1DFVA 1W6FA 3PP6A 2JU3A 1I04A 3PEDA 1JYJA 1VWQB 4IB8A 4OMWA 4AZNA 1SWAA 5EEEA 5H9AA 2IZGB 4NYQA 3VU1A 1RSTB 2FKGA 4EQAC 3I0AA 1SWLA 1TVQA 2JW1A 2RTQB 5HAEA 1WUBA 4Z2OA 4ZGUA 3FDCA 1X8PA 1MK5A 1G7NA 2R74A 2Q9SA 3FA8A 4IMOA 4ORSA 5B2AO 4TKBA 1MX8A 4YBPA 5HZ9A 2UYWA 2NNDA 5H9NA 1TOWA
chains in the Genus database with same CATH topology
3LHNA 5JR8A 3JSQA 1TXLA 5HZQA 2X45A 4LZVA 1LIFA 4I9SA 2FS7A 1GT4A 4Y0QA 4U8UM 1GT5A 4HPAA 4O3ZA 1EUOA 4A1HA 5AJBA 2ASNX 4YGHA 5FAZA 4NW4A 1KQXA 1X71A 1DZPA 5EDCA 4BOEA 5FENA 1ZRYA 4NLJA 1EPAA 1DF3A 1RBPA 3P6FA 4GE1A 2AL0X 2WR6A 4YDBA 1HMSA 4O9SA 1EW3A 4A60A 5F58A 2A2GA 3N91A 3NX2A 1CBRA 4ALOA 5LKEA 4M7MA 3AKNA 1LPJA 2JU8A 3HOEA 4ZHCA 2XKLA 4R0BA 1D3SA 3QKGA 3WJBA 2JOZA 2OVEA 1KGLA 3BY0A 2OVAA 3G7XA 4ZJ0A 4ES7A 4TKHA 3IA8A 3P6HA 4IAXA 1ZNDA 1SXUA 3CBCA 4O3YA 4QYPA 4KT5A 1DV9A 4KC8A 4Y0PA 1SY2A 4U9CA 3ELZA 3FA7A 1QFTA 2NNQA 2GC9A 5D4AA 4UU3A 1YP7A 1IIUA 4KC7A 3WJDA 3GAQA 1JJXA 1HBPA 1HMTA 5LKFA 2F09A 2RN4A 1BSQA 2W2AA 4GNWA 3BS2A 5HCEC 1A57A 2WWPA 1ADLA 3CR6A 4OMXA 3C77X 4TKJA 4YKOA 1UZ2X 1P6PA 3KZAA 5HTDA 3B2KA 3RZYA 3TZSA 3ZW2A 2AT6X 4N7DA 4TLJA 4Y0SA 1EQDA 4ORUA 3UEUA 4K19A 4ALBA 3ZUOA 2AH7X 4EEJA 1AELA 1DZKA 5KHPA 3OJYC 4I95A 4INNA 1EPBA 4NYRA 5D48A 3FIQA 3APWA 4I3BA 4ORWA 1RLBE 3S5XA 3VG3A 4TNNA 1HMRA 4YMYA 2FRSA 4QYNA 4YCEA 5DPQA 1JV4A 2L68A 2Q2MA 2NNEA 2KD2A 3WOVA 4FBRA 3NPOA 2KTDA 1SY1A 4IB7A 5B29A 1QABE 5H9KA 4O3WA 3O19A 1O1UA 1U0XA 3FA6A 3NADA 2L5PA 3D97A 4XMFA 4XMGA 3APXA 2WQAE 2LB6A 4MVEA 3HK1A 4AZMA 3WJGA 4YKMA 3P24A 4GH7A 2HNXA 4GETA 5C0NA 2OZQA 1Z24A 2AT3X 4Y0RA 4QAEA 2A3FX 2MO5A 5EPQA 1GX8A 2Q4NA 2R56A 3U0DA 3D96A 3SOTA 2FTBA 5DG4A 1OEJA 3JQOA 4L1NA 4ZFXA 4BVMA 1TW4A 2LKKA 4CSBA 1LIEA 4OS3A 1GXAA 1S7DA 4YBUA 1D2UA 4QZTA 1KT3A 2ALLX 5IO5A 2POAA 4PSQA 1B0OA 3NQKA 1MDCA 1BEBA 3HTYA 3WVMA 5HZ8A 4YCHA 1OBQA 4M6SA 2AKQA 3B2HA 3MBTA 1SY0A 2MM3A 5LJHA 4GZVA 1T8VA 3FEPA 3PQUA 1B4MA 4UU2A 2GJ5A 3C76X 1KT4A 2Q2PA 1KT6A 3STKA 1PMPA 5K06A 2QO5A 2LBAA 1HQPA 3FEKA 2O62A 1KOIA 3FA9A 3CMPA 3P6CA 3OD9A 1PBOA 4D6BA 1I4UA 1OBPA 4ZGFA 4I3CA 1OEKA 4O4UA 4I6SA 1I05A 3ZUIA 5B27A 1ERBA 4ZHDA 3WJCA 3PH5A 1QG5A 4WHIA 4YFPA 5LJGA 4DQ4A 1ALBA 3IFBA 2GTLN 4GRJA 4TJZA 1KT5A 2CBRA 1NGLA 1X8NA 2FR2A 2OFRX 1JJJA 3ZW1A 1FELA 2AT5X 2ZAIA 4CK4A 2CM9A 1IKJA 4MISA 4AW8A 2OVDA 1AQBA 3F6ZB 4WFUA 3L4RA 1EXSA 1QQSA 3FR4A 4EFGA 4XMEA 3NR3A 4KCAA 1MVGA 3S60A 1S2PA 1Y9LA 4QGVA 3WBGA 3VG6A 3BDRA 1IFBA 4QGXA 1A18A 3JS1A 1LIDA 1YWBA 4ML7B 4O4SA 5LJEA 3B2JA 1Y9TA 1O8VA 4GK9A 3KFGA 5F6ZA 1SMPI 3FELA 2GTFX 3CBSA 5HTEA 3RBYA 3ZW1B 1ML7A 1DC9A 2ANSA 5HA1A 3KFIA 5F6BA 1CBQA 3BU9A 3FW4A 5FFHA 3APVA 1LIBA 2W2BA 3TF6A 3E3CA 3NQ9A 2M4LA 1SA8A 5LJCA 1PM1X 4YGZA 2A2UA 3CQRA 2GTLO 3FR2A 2WEXA 5L8OA 3DTQA 3P6GA 4XMCA 1GT1A 1PEEA 2G78A 3NP1A 4PJ2A 3D4RA 3SAOA 2WEWA 1MX7A 4JGLA 1CBIA 1LICA 1LKEA 4LKTA 3HWEA 2FR3A 4IMNA 5AJCA 4ORYA 1ICNA 4O3XB 5IO6A 5BVTA 3F8AA 1VPRA 2HZQA 5FQ6E 4NP1A 3S26A 4AYHA 4FBOA 5D8JA 1BLRA 3PECA 1FDQA 2JMBA 1X8QA 2E4JA 1GX9A 4U8UO 2IFBA 3Q6LA 4WBKA 4AZOA 5AEOA 2EU7X 4EDEA 2W2FA 3FYFA 5H8TA 4ZHGA 5FQ7E 2KW1A 5D47A 1KZWA 3B2IA 4RUNA 4YFRA 4A1YA 1XKIA 3ZW0A 1A2DA 3RWXA 1YWCA 2KTSA 3FR5A 1BSYA 1A3YA 4QRLA 4ZHHA 1E02A 5BVSA 5KIDA 3GE2A 3NQ3A 1E06A 1YUPA 3F9DA 2FWVA 1OPBA 2HYSA 3OE3A 3TGBA 1BBPA 2AT8X 5HZ5A 1QY2A 4YFQA 2YMSA 4GU8A 3C78X 1QY1A 1ERXA 5HA0A 1AVGI 2CBSA 4ZH6A 1CBSA 1LF7A 1G74A 3FMZA 4ID2A 2BS6A 3UEVA 2Q39A 2BT9A 2YG2A 4XMHA 5F7GA 3ZW0B 4ZR2A 3OBLA 2CZTA 2RQ0A 3LV4A 2R73A 4QNIA 2MHDA 3P6EA 1FTPA 4KH8A 2RD7C 4LQZA 1OPAA 3KFFA 3VG5A 3U9PC 1XCAA 4OS0A 3VG7A 1OEEA 3HWGA 1LFOA 2RCQA 2A13A 1E00A 1SXWA 3ZQ3A 4U3QA 2P8GA 3S5VA 2HMBA 3BLGA 1ICMA 4IBAA 1R0UA 4ORRA 1BRQA 3PQSA 4D6AA 1YIVA 1DZMA 3BRNA 5LJDA 2N93A 2BLGA 1VYFA 1B56A 2FS6A 1N0SA 3RKGA 4GDZA 3KFHA 5AQ6A 4NNTA 4O4OA 5L8IA 4HPCA 2NP1A 3APUA 3BU1A 1ZNLA 1GKAB 4MVIA 5BVQA 1HN2A 1G5WA 2FLJA 4LKPA 3H3IA 4XMDA 3VPJE 4EXZA 2X8TA 1BM5A 2LFOA 1X89A 4HFOA 4DQ3A 4L3RA 5HZ6A 1JBHA 2JN3A 4O4XA 1TOUA 1NP1A 4LZUA 5H9LA 1YWAA 4U8UN 1MUPA 1ZNGA 2HLVA 3EYCA 2QOSC 4MVLA 3K3LA 5D45A 5L8NA 2CZUA 5BYPA 5HBSA 3VG2A 2BHVA 1GGLA 4HWMA 3WXQA 5HCDC 4NLIA 1FENA 1UREA 2ACPX 4ORXA 3VE2A 3ZWEA 1QY0A 1KXOA 2K62A 2ACOA 5LJKA 3BSZE 3UEXA 4GKCA 3V8UA 4QQ1A 5KICA 1EALA 1EIIA 1KT7A 1JYDA 2X46A 2AT0X 2HZRA 2OVSA 2XSTA 3P6DA 1EI5A 1HBQA 4HPDA 4IAWA 5HWZA 3ELXA 4I3DA 1AB0A 2A0AA 4O49A 3MVFA 4BQUA 4TQ2A 1B8EA 1SXXA 3I17A 1IW2A 3UAQA 1I06A 3KQ0A 4AZRA 4IB9A 3BX8A 3EMMA 2WSJA 1QWDA 1VYGA 1KZXA 1QFVA 3TGAA 5EZ2A 3U03A 1ZNEA 2WQ9A 3D95A 4OS8A 4COTA 2Z4IA 1FEMA 5IO7A 1U18A 4AZQA 1NP4A 2G79A 2AMMX 4FQBB 4QGWA 2BS5A 1LNMA 3RSWA 2LA7A 1OBUA 2L9CA 3HWDA 4RUUA 2KT4B 1BSOA 2G7BA 3EM0A 5CE4A 3PPTA 2QM9A 1X8UA 1E5PA 3STMX 2LBVA 1L6MA 5FQ8E 4NNSA 4ARHA 5HCCC 4YH0A 1FE3A 2F73A 2JU7A 4YDAA 4ZHFA 3O22A 3MX7A 3ZZVA 1H91A 2QO4A 4YGGA 3FLLA 2OFMX 3O2YA 1GM6A 1SY3A 4I9RA 2QMIA 3WJEA 4KIIA 4CV7A 1X8OA 1BRPA 3DSZA 3PH6A 4ON1A 2PY1A 4GNYA 3UEWA 4FGIB 3STNA 1YP6A 1IFCA 3NX1A 2MWHA 1CJ5A 4WFVA 2CM4A 1U17A 1GT3A 3NBXX 1JZUA 3FW5A 4A8ZA 4IABA 2WUTA 2Z4HA 1O1VA 2QO6A 1EIOA 1YWDA 4QZUA 3TGCA 3ZI8A 2DM5A 4N7CA 3HOLA 4FBVA 3WJFA 3EBWA 1CRBA 5F1EA 5EDBA 3BX7A 1BWYA 4MIRA 1BJ7A 3B2LA 1ZNHA 4HPBA 3EBKA 4ODDA 3CQNA 3T1DA 5LJBA 1ZNKA 2FT9A 1DZJA 2X8SA 3VG4A 3AKMA 4ZCBA 4ZH9A 4AZPA 3VE1A 1ACDA 1JIWI 1G85A 2MJIA 1SXYA 2X8FA 4IB6A 4MVKA 1S44A 2RCTA 1GKAA 1KQWA 3FENA 2GTLM 3CWKA 1T68X 5CYBA 3P02A 2L67A 3HWFA 2K23A 5EEDA 1IKEA 2RA6A 1T0VA 2ZAGA 1DFVA 3PP6A 2JU3A 1I04A 3PEDA 1JYJA 4IB8A 4OMWA 4AZNA 5EEEA 5H9AA 4NYQA 3VU1A 4EQAC 3I0AA 1TVQA 5HAEA 2JW1A 4ZGUA 1X8PA 2R74A 1G7NA 3FA8A 2Q9SA 4ORSA 4IMOA 4YBPA 5HZ9A 4TKBA 1MX8A 2NNDA 5H9NA 1TOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR8 A;  3JSQ A;  1TXL A;  5HZQ A;  2X45 A;  4LZV A;  1LIF A;  4I9S A;  2FS7 A;  1GT4 A;  4Y0Q A;  1GT5 A;  4HPA A;  1EUO A;  4A1H A;  5FAZ A;  2ASN X;  4YGH A;  1KQX A;  1X71 A;  1DZP A;  5EDC A;  4BOE A;  5FEN A;  1ZRY A;  4NLJ A;  1EPA A;  1DF3 A;  1RBP A;  3P6F A;  4GE1 A;  2AL0 X;  2WR6 A;  4YDB A;  1HMS A;  4O9S A;  1EW3 A;  4A60 A;  5F58 A;  2A2G A;  3NX2 A;  1CBR A;  4ALO A;  5LKE A;  4M7M A;  3AKN A;  1LPJ A;  2JU8 A;  4ZHC A;  2XKL A;  4R0B A;  1D3S A;  3QKG A;  3WJB A;  2JOZ A;  2OVE A;  1KGL A;  3BY0 A;  2OVA A;  3G7X A;  4ZJ0 A;  4ES7 A;  4TKH A;  3IA8 A;  3P6H A;  4IAX A;  1ZND A;  1SXU A;  3CBC A;  4QYP A;  1DV9 A;  4Y0P A;  1SY2 A;  3ELZ A;  3FA7 A;  1QFT A;  2NNQ A;  2GC9 A;  5D4A A;  4UU3 A;  1YP7 A;  1IIU A;  3WJD A;  1JJX A;  3GAQ A;  1HBP A;  1HMT A;  5LKF A;  2W2A A;  1BSQ A;  4GNW A;  3BS2 A;  5HCE C;  1A57 A;  2WWP A;  1ADL A;  3CR6 A;  4OMX A;  3C77 X;  4TKJ A;  4YKO A;  1UZ2 X;  1P6P A;  3KZA A;  5HTD A;  3B2K A;  3RZY A;  3TZS A;  2AT6 X;  4N7D A;  4TLJ A;  4Y0S A;  1EQD A;  4ORU A;  3UEU A;  4K19 A;  4ALB A;  3ZUO A;  2AH7 X;  4EEJ A;  1AEL A;  1DZK A;  5KHP A;  3OJY C;  4NYR A;  1EPB A;  5D48 A;  3FIQ A;  3APW A;  4I3B A;  4ORW A;  1RLB E;  3VG3 A;  4TNN A;  1HMR A;  4YMY A;  2FRS A;  4QYN A;  4YCE A;  5DPQ A;  1JV4 A;  2L68 A;  2Q2M A;  2NNE A;  3NPO A;  2KTD A;  1SY1 A;  4IB7 A;  5B29 A;  1QAB E;  5H9K A;  3O19 A;  1O1U A;  1U0X A;  3FA6 A;  3NAD A;  2L5P A;  3D97 A;  4XMF A;  4XMG A;  3APX A;  2WQA E;  2LB6 A;  4AZM A;  3HK1 A;  3WJG A;  4YKM A;  4GH7 A;  2HNX A;  4GET A;  5C0N A;  2OZQ A;  1Z24 A;  2AT3 X;  4Y0R A;  4QAE A;  2A3F X;  2MO5 A;  5EPQ A;  1GX8 A;  2Q4N A;  2R56 A;  3U0D A;  3D96 A;  2FTB A;  5DG4 A;  1OEJ A;  4ZFX A;  4BVM A;  1TW4 A;  2LKK A;  1LIE A;  4OS3 A;  1GXA A;  1S7D A;  4YBU A;  1D2U A;  4QZT A;  1KT3 A;  2ALL X;  5IO5 A;  2POA A;  4PSQ A;  1B0O A;  1MDC A;  1BEB A;  3WVM A;  5HZ8 A;  4YCH A;  1OBQ A;  4M6S A;  2AKQ A;  3B2H A;  3MBT A;  1SY0 A;  2MM3 A;  5LJH A;  1T8V A;  3FEP A;  1B4M A;  4UU2 A;  2GJ5 A;  3C76 X;  1KT4 A;  2Q2P A;  1KT6 A;  3STK A;  1PMP A;  5K06 A;  2QO5 A;  2LBA A;  1HQP A;  3FEK A;  2O62 A;  1KOI A;  3FA9 A;  3CMP A;  3P6C A;  1PBO A;  4D6B A;  1I4U A;  1OBP A;  4I3C A;  1OEK A;  1I05 A;  3ZUI A;  5B27 A;  1ERB A;  4ZHD A;  3WJC A;  3PH5 A;  1QG5 A;  4YFP A;  5LJG A;  4DQ4 A;  1ALB A;  3IFB A;  4GRJ A;  4TJZ A;  1KT5 A;  2CBR A;  1NGL A;  1X8N A;  2FR2 A;  2OFR X;  1JJJ A;  1FEL A;  2AT5 X;  4CK4 A;  2CM9 A;  1IKJ A;  4AW8 A;  2OVD A;  1AQB A;  4WFU A;  3L4R A;  1EXS A;  1QQS A;  3FR4 A;  4EFG A;  4XME A;  3NR3 A;  1MVG A;  1S2P A;  4QGV A;  3WBG A;  3VG6 A;  3BDR A;  1IFB A;  4QGX A;  1A18 A;  3JS1 A;  1LID A;  1YWB A;  5LJE A;  3B2J A;  1O8V A;  3KFG A;  5F6Z A;  5HTE A;  3FEL A;  2GTF X;  3CBS A;  1ML7 A;  1DC9 A;  2ANS A;  5HA1 A;  3KFI A;  5F6B A;  1CBQ A;  3BU9 A;  3FW4 A;  5FFH A;  3APV A;  1LIB A;  2W2B A;  3TF6 A;  3NQ9 A;  1SA8 A;  5LJC A;  1PM1 X;  4YGZ A;  2A2U A;  3CQR A;  3FR2 A;  2WEX A;  5L8O A;  3DTQ A;  3P6G A;  4XMC A;  1GT1 A;  1PEE A;  2G78 A;  3NP1 A;  3SAO A;  2WEW A;  1MX7 A;  1CBI A;  1LIC A;  1LKE A;  4LKT A;  3HWE A;  2FR3 A;  4IMN A;  4ORY A;  1ICN A;  5IO6 A;  5BVT A;  3F8A A;  1VPR A;  2HZQ A;  3S26 A;  4NP1 A;  4AYH A;  5D8J A;  1BLR A;  3PEC A;  1FDQ A;  1X8Q A;  2E4J A;  1GX9 A;  4WBK A;  2IFB A;  3Q6L A;  4AZO A;  2EU7 X;  4EDE A;  2W2F A;  5H8T A;  4ZHG A;  5D47 A;  1KZW A;  3B2I A;  4RUN A;  4YFR A;  4A1Y A;  1XKI A;  1A2D A;  1YWC A;  3FR5 A;  1BSY A;  1A3Y A;  4ZHH A;  1E02 A;  5BVS A;  5KID A;  3NQ3 A;  1E06 A;  1YUP A;  3F9D A;  2FWV A;  1OPB A;  2HYS A;  3TGB A;  1BBP A;  2AT8 X;  5HZ5 A;  1QY2 A;  4YFQ A;  3C78 X;  1QY1 A;  1ERX A;  5HA0 A;  1AVG I;  2CBS A;  4ZH6 A;  1CBS A;  1LF7 A;  1G74 A;  3FMZ A;  3UEV A;  2Q39 A;  2YG2 A;  4XMH A;  5F7G A;  4ZR2 A;  2CZT A;  2RQ0 A;  2R73 A;  3P6E A;  1FTP A;  2RD7 C;  1OPA A;  3KFF A;  3VG5 A;  3U9P C;  1XCA A;  4OS0 A;  3VG7 A;  1OEE A;  3HWG A;  1LFO A;  2RCQ A;  2A13 A;  1E00 A;  1SXW A;  3ZQ3 A;  2P8G A;  2HMB A;  3BLG A;  1ICM A;  4IBA A;  1R0U A;  4ORR A;  1BRQ A;  4D6A A;  1YIV A;  1DZM A;  3BRN A;  5LJD A;  2N93 A;  2BLG A;  1VYF A;  1B56 A;  2FS6 A;  1N0S A;  3KFH A;  5AQ6 A;  4NNT A;  5L8I A;  4HPC A;  2NP1 A;  3APU A;  3BU1 A;  1ZNL A;  1GKA B;  4MVI A;  5BVQ A;  1HN2 A;  1G5W A;  2FLJ A;  4LKP A;  4XMD A;  4EXZ A;  1BM5 A;  2LFO A;  1X89 A;  4HFO A;  4DQ3 A;  5HZ6 A;  1JBH A;  2JN3 A;  1TOU A;  1NP1 A;  4LZU A;  5H9L A;  1YWA A;  1MUP A;  1ZNG A;  2HLV A;  3EYC A;  2QOS C;  4MVL A;  3K3L A;  5D45 A;  5L8N A;  2CZU A;  5HBS A;  3VG2 A;  3WXQ A;  1GGL A;  5HCD C;  4NLI A;  1FEN A;  1URE A;  2ACP X;  4ORX A;  1QY0 A;  1KXO A;  2K62 A;  2ACO A;  5LJK A;  3BSZ E;  3UEX A;  4GKC A;  5KIC A;  1EAL A;  1EII A;  1KT7 A;  1JYD A;  2X46 A;  2AT0 X;  2HZR A;  2XST A;  3P6D A;  1HBQ A;  4HPD A;  4IAW A;  5HWZ A;  3ELX A;  4I3D A;  1AB0 A;  2A0A A;  3MVF A;  4BQU A;  4TQ2 A;  1B8E A;  1SXX A;  3I17 A;  1IW2 A;  1I06 A;  3KQ0 A;  4AZR A;  4IB9 A;  3BX8 A;  3EMM A;  2WSJ A;  1QWD A;  1VYG A;  1KZX A;  1QFV A;  3TGA A;  5EZ2 A;  3U03 A;  1ZNE A;  2WQ9 A;  3D95 A;  4OS8 A;  1FEM A;  5IO7 A;  1U18 A;  4AZQ A;  1NP4 A;  2G79 A;  2AMM X;  4QGW A;  1LNM A;  3RSW A;  1OBU A;  2L9C A;  3HWD A;  4RUU A;  2KT4 B;  1BSO A;  2G7B A;  3EM0 A;  5CE4 A;  3PPT A;  2QM9 A;  1X8U A;  1E5P A;  3STM X;  2LBV A;  1L6M A;  4ARH A;  4NNS A;  5HCC C;  4YH0 A;  1FE3 A;  2F73 A;  2JU7 A;  4YDA A;  4ZHF A;  3O22 A;  1H91 A;  2QO4 A;  4YGG A;  3FLL A;  2OFM X;  3O2Y A;  1GM6 A;  1SY3 A;  4I9R A;  3WJE A;  4KII A;  1X8O A;  1BRP A;  3DSZ A;  3PH6 A;  2PY1 A;  4GNY A;  3UEW A;  3STN A;  1YP6 A;  1IFC A;  3NX1 A;  1CJ5 A;  4WFV A;  2CM4 A;  1U17 A;  1GT3 A;  1JZU A;  3FW5 A;  4A8Z A;  2WUT A;  1O1V A;  2QO6 A;  1EIO A;  1YWD A;  4QZU A;  3TGC A;  2DM5 A;  4N7C A;  3WJF A;  3EBW A;  1CRB A;  5F1E A;  5EDB A;  3BX7 A;  1BWY A;  1BJ7 A;  3B2L A;  1ZNH A;  4HPB A;  3EBK A;  4ODD A;  3CQN A;  3T1D A;  5LJB A;  1ZNK A;  2FT9 A;  1DZJ A;  3VG4 A;  3AKM A;  4ZCB A;  4ZH9 A;  4AZP A;  1ACD A;  1G85 A;  2MJI A;  1SXY A;  4IB6 A;  4MVK A;  1S44 A;  2RCT A;  1GKA A;  1KQW A;  3FEN A;  3CWK A;  1T68 X;  2L67 A;  3HWF A;  2K23 A;  5EED A;  1IKE A;  2RA6 A;  1T0V A;  1DFV A;  3PP6 A;  2JU3 A;  1I04 A;  3PED A;  1JYJ A;  4IB8 A;  4OMW A;  4AZN A;  5EEE A;  5H9A A;  4NYQ A;  3I0A A;  1TVQ A;  5HAE A;  4ZGU A;  1X8P A;  2R74 A;  1G7N A;  3FA8 A;  2Q9S A;  4ORS A;  4IMO A;  4YBP A;  5HZ9 A;  4TKB A;  1MX8 A;  2NND A;  5H9N A;  1TOW A; 
#chains in the Genus database with same CATH topology
 2FHL A;  3LHN A;  5JR8 A;  3JSQ A;  1RAV A;  1FJ1 E;  2DJG A;  1TXL A;  5HZQ A;  2X45 A;  2OF9 A;  1OSP O;  4LZV A;  1LIF A;  4I9S A;  2FS7 A;  1GT4 A;  4Y0Q A;  1SWE A;  4U8U M;  1GT5 A;  4HPA A;  4O3Z A;  1EUO A;  1VWB B;  4A1H A;  5AJB A;  2ASN X;  4YGH A;  5FAZ A;  1NBX A;  4NW4 A;  1KQX A;  3RDU A;  2RTB B;  4Z2P A;  1X71 A;  4CPE A;  3T6F A;  1VWJ B;  4YVB A;  1DZP A;  5EDC A;  4BOE A;  5FEN A;  1ZRY A;  4NLJ A;  4OKA A;  3QQ2 A;  1EPA A;  1DF3 A;  1RBP A;  3P6F A;  4GE1 A;  2AL0 X;  2WR6 A;  4YDB A;  1HMS A;  4O9S A;  1EW3 A;  4A60 A;  1SWB A;  5F58 A;  2A2G A;  1SRH A;  3N91 A;  3NX2 A;  1CBR A;  4BX7 A;  5L3Y A;  4ALO A;  5LKE A;  4M7M A;  3AKN A;  1LPJ A;  2JU8 A;  3HOE A;  2RTC B;  4ZHC A;  2RTM A;  1SWC A;  2XKL A;  4R0B A;  1D3S A;  3QKG A;  2RTE B;  3WJB A;  1VWA B;  2JOZ A;  2OVE A;  1KGL A;  3BY0 A;  2OVA A;  3G7X A;  4ZJ0 A;  4ES7 A;  4TKH A;  3IA8 A;  3P6H A;  4IAX A;  3RDM A;  1ZND A;  5IXG A;  4BX6 A;  1SXU A;  3CBC A;  4O3Y A;  4QYP A;  3WZP A;  4KT5 A;  1DV9 A;  1SWS A;  3AUM O;  1SY2 A;  4KC8 A;  4U9C A;  3ELZ A;  2RTK A;  2X56 A;  1JJU A;  2RTF B;  2RTA A;  3FA7 A;  1QFT A;  5B5F A;  2NNQ A;  2GC9 A;  5D4A A;  4UU3 A;  1VWG B;  1IIU A;  1YP7 A;  4KC7 A;  3GAQ A;  3WJD A;  1JJX A;  1HBP A;  1HMT A;  5LKF A;  2F09 A;  2RN4 A;  1BSQ A;  2W2A A;  4GNW A;  3BS2 A;  4AZO A;  5HCE C;  1A57 A;  2WWP A;  1ADL A;  3CR6 A;  4OMX A;  3C77 X;  4TKJ A;  4YKO A;  1UZ2 X;  1P6P A;  3KZA A;  3RY2 A;  3B2K A;  3RZY A;  5HTD A;  3TZS A;  3Q34 A;  5IRU A;  2X32 A;  3ZW2 A;  4CPH A;  2AT6 X;  2DJF A;  2RTN B;  4N7D A;  4TLJ A;  4Y0S A;  1EQD A;  4ORU A;  3UEU A;  4K19 A;  1I78 A;  4Y0P A;  4ALB A;  4Z27 A;  3ZUO A;  2AH7 X;  1N43 A;  4GUZ A;  2MF6 A;  4EEJ A;  1NDJ A;  1AEL A;  1DZK A;  5KHP A;  3OJY C;  4I95 A;  4INN A;  1EPB A;  4NYR A;  5D48 A;  3FIQ A;  3APW A;  4I3B A;  4ORW A;  1RLB E;  3S5X A;  3VG3 A;  4TNN A;  1HMR A;  2ZSC A;  4YMY A;  2FRS A;  4QYN A;  4YCE A;  5DPQ A;  4EKV A;  1JV4 A;  2L68 A;  1HQQ A;  2Q2M A;  3VHI A;  2NNE A;  4CPH B;  5IRW A;  2KD2 A;  3WOV A;  1SLD B;  2RTI B;  3NPO A;  1STS B;  2KTD A;  1SY1 A;  2X55 A;  4IB7 A;  4GGT A;  3RDO A;  1QAB E;  5B29 A;  5H9K A;  4O3W A;  2QCB A;  2A5B A;  3O19 A;  1O1U A;  1U0X A;  3FA6 A;  3NAD A;  5B5G A;  2L5P A;  2I5Z O;  3D97 A;  4XMF A;  4XMG A;  4GJS A;  3APX A;  2WQA E;  2LB6 A;  4MVE A;  3HK1 A;  4AZM A;  3WJG A;  3VGW A;  4YKM A;  3P24 A;  4C5P A;  4GH7 A;  2HNX A;  4GET A;  5C0N A;  1MM9 A;  2OZQ A;  2IZK A;  1Z24 A;  2AT3 X;  4Y0R A;  4QAE A;  2A3F X;  2MO5 A;  5EPQ A;  1GX8 A;  1JMX A;  2Q4N A;  2R56 A;  3U0D A;  3D96 A;  3SOT A;  1VYO A;  2CAM A;  1Y52 X;  1VWL B;  2FTB A;  5DG4 A;  1OEJ A;  3JQO A;  2RTJ A;  4L1N A;  4ZFX A;  4BVM A;  1TW4 A;  2LKK A;  4CSB A;  1LIE A;  4OS3 A;  1GXA A;  1S7D A;  4YBU A;  1RSU B;  1D2U A;  4QZT A;  1KT3 A;  2ALL X;  5IO5 A;  1HXZ A;  2POA A;  4PSQ A;  5K67 A;  1NQM A;  3KVN A;  2AVI A;  4GGR A;  1B0O A;  3NQK A;  2RTR B;  1MDC A;  1BEB A;  3RDQ A;  3HTY A;  3WVM A;  5HZ8 A;  4YCH A;  4Z6J A;  1OBQ A;  4M6S A;  2AKQ A;  3B2H A;  3MBT A;  1SY0 A;  2A5C A;  2MM3 A;  5LJH A;  3T2X A;  4GZV A;  1T8V A;  3FEP A;  3PQU A;  4GGZ A;  1MEP A;  1B4M A;  4UU2 A;  2GJ5 A;  3C76 X;  1KT4 A;  2Q2P A;  1KT6 A;  3STK A;  1PMP A;  5K06 A;  2QO5 A;  2LBA A;  1HQP A;  1WBI A;  3FEK A;  2O62 A;  1KOI A;  3FA9 A;  3CMP A;  2Y32 A;  3P6C A;  3OD9 A;  1PBO A;  1DF8 A;  4D6B A;  2RTP B;  1I4U A;  1OBP A;  4ZGF A;  1K3B A;  4I3C A;  1OEK A;  4O4U A;  1N7Y A;  4I6S A;  3WZN A;  1I05 A;  2OY8 A;  3ZUI A;  5B27 A;  1ERB A;  5CHK A;  3WJC A;  1SRE A;  4ZHD A;  3PH5 A;  1QG5 A;  4WHI A;  4YFP A;  5LJG A;  1Y0G A;  4DQ4 A;  1ALB A;  3IFB A;  2GTL N;  2OL6 O;  1SWH A;  4GRJ A;  4TJZ A;  1KT5 A;  2CBR A;  1NGL A;  1X8N A;  2FR2 A;  2OFR X;  5B10 O;  3RY1 A;  1JJJ A;  4CDD A;  3ZW1 A;  1FEL A;  5F2B A;  2AT5 X;  2ZAI A;  4Y5D A;  1SWG A;  2X34 A;  2CM9 A;  4CK4 A;  1IKJ A;  1HXL A;  4MIS A;  4AW8 A;  2OVD A;  1AQB A;  3F6Z B;  1SLG B;  3L4R A;  1EXS A;  1SWT A;  1QQS A;  3FR4 A;  4WFU A;  4EFG A;  4XME A;  3NR3 A;  4KCA A;  1MVG A;  3S60 A;  2IZE B;  1VWH B;  1S2P A;  1Y9L A;  1NC9 A;  2GH7 A;  3RDS A;  3WBG A;  4QGV A;  1UYN X;  3VG6 A;  3BDR A;  1IFB A;  1UYO X;  5B11 O;  1STR B;  4GJV A;  4QGX A;  1A18 A;  3JS1 A;  1LID A;  1YWB A;  4ML7 B;  4O4S A;  5LJE A;  1SWD A;  4U46 A;  1SRF A;  3B2J A;  1Y9T A;  2IZD B;  1O8V A;  4GK9 A;  3KFG A;  5F6Z A;  1SMP I;  3FEL A;  2GTF X;  2IZF B;  3CBS A;  5HTE A;  3RBY A;  3ZW1 B;  4JO6 A;  1KFF A;  1ML7 A;  1DC9 A;  2ANS A;  1KL4 A;  3KFI A;  5HA1 A;  5F6B A;  1CBQ A;  1KL3 A;  2RTL A;  3AEH A;  3BU9 A;  3FW4 A;  3APV A;  1LIB A;  2W2B A;  5FFH A;  3RDX A;  2IZI A;  4CDF A;  3TF6 A;  3E3C A;  4Z2V A;  3NQ9 A;  2M4L A;  1RXH A;  1SA8 A;  2WPU A;  5LJC A;  1SWP A;  1PM1 X;  1AVE A;  4YGZ A;  3SZI A;  2A2U A;  3CQR A;  3VHH A;  2GTL O;  3FR2 A;  2WEX A;  5L8O A;  3DTQ A;  3MG5 A;  3P6G A;  1N9M A;  1SLF B;  1VWK B;  1GT1 A;  2UZ2 A;  4XMC A;  2G78 A;  3NP1 A;  4PJ2 A;  1PEE A;  3D4R A;  2OF8 A;  3LTW A;  3SAO A;  2WEW A;  3FID A;  1MX7 A;  4JGL A;  1CBI A;  1LIC A;  1LKE A;  4LKT A;  3HWE A;  1VWF B;  2FR3 A;  4IMN A;  5AJC A;  1SRG A;  1ICN A;  4ORY A;  1SWU A;  1SWO A;  4O3X B;  1K24 A;  3RE5 A;  3F8A A;  4DNE A;  5BVT A;  5IO6 A;  1VPR A;  2HZQ A;  5FQ6 E;  4NP1 A;  3S26 A;  2OY7 A;  4AYH A;  3SLT A;  4FBO A;  5D8J A;  1BLR A;  1EII A;  3PEC A;  2RTD B;  1AVD A;  1FDQ A;  2JMB A;  1X8Q A;  2IZB A;  5JD2 A;  4GD9 A;  4CDC A;  3HPE A;  2E4J A;  1GX9 A;  3PDF A;  2IFB A;  3Q6L A;  4U8U O;  4WBK A;  5IRA A;  2C1Q A;  2EU7 X;  2HKD A;  2VFB A;  2W2F A;  4EDE A;  3FYF A;  5AEO A;  5H8T A;  4ZHG A;  5FQ7 E;  2KW1 A;  5D47 A;  1KZW A;  1VWO B;  3B2I A;  4RUN A;  2A8G A;  1I9H A;  1SWJ A;  2PI3 O;  3SLO A;  4YFR A;  4A1Y A;  1XKI A;  3ZW0 A;  1A2D A;  1LDO A;  4JNJ A;  3RWX A;  1VWE B;  1YWC A;  2KTS A;  3FR5 A;  1BSY A;  1A3Y A;  4QRL A;  4ZHH A;  1E02 A;  1VWP B;  2IZL B;  5BVS A;  5KID A;  1Y53 X;  3GE2 A;  2OFA A;  3NQ3 A;  1E06 A;  1YUP A;  1N4J A;  3F9D A;  2FWV A;  1OPB A;  2HYS A;  3CKF A;  1SWQ A;  5CSE A;  3OE3 A;  3TGB A;  1BBP A;  2AT8 X;  5HZ5 A;  1QY2 A;  4YFQ A;  3WZO A;  2YMS A;  4GU8 A;  1VWC B;  3C78 X;  1QY1 A;  1ERX A;  5HA0 A;  1AVG I;  2CBS A;  4ZH6 A;  1CBS A;  1LF7 A;  1G74 A;  3FMZ A;  4ID2 A;  2BS6 A;  2OYB O;  3UEV A;  2Q39 A;  2BT9 A;  2YG2 A;  4XMH A;  5F7G A;  3ZW0 B;  4ZR2 A;  1PBY A;  3EW1 A;  2CZT A;  3OBL A;  2RQ0 A;  3LV4 A;  2R73 A;  2QOM A;  4QNI A;  2MHD A;  3P6E A;  1FTP A;  4KH8 A;  1VWR B;  2RD7 C;  4LQZ A;  4BGF A;  4BBO A;  1OPA A;  3KFF A;  3VG5 A;  3U9P C;  1XCA A;  4OS0 A;  4BX5 B;  1LCV A;  2IZA A;  4DCB A;  3VG7 A;  1OEE A;  1LDQ A;  3HWG A;  1LFO A;  2RCQ A;  2A13 A;  1E00 A;  1SXW A;  3ZQ3 A;  4U3Q A;  2G5L A;  3WYQ A;  2P8G A;  2JGS A;  4CDE A;  1SWN A;  2FGS A;  3S5V A;  2OFB A;  2HMB A;  3BLG A;  1ICM A;  4IBA A;  1PTS A;  1R0U A;  4ORR A;  1BRQ A;  3PQS A;  4D6A A;  3SZH A;  1YIV A;  1DZM A;  1IJ8 A;  3BRN A;  5LJD A;  2BSZ A;  2N93 A;  2BLG A;  1SWR A;  1GX3 A;  1VYF A;  1B56 A;  1RXK A;  2FS6 A;  1KL5 A;  3T2W A;  1N0S A;  3RKG A;  4GDZ A;  3KFH A;  5AQ6 A;  4NNT A;  4O4O A;  5L8I A;  1LCZ A;  4HPC A;  1SLE B;  2NP1 A;  3APU A;  4Z28 A;  3BU1 A;  1VWN B;  1ZNL A;  2OY5 O;  1GKA B;  4MVI A;  5BVQ A;  1HN2 A;  1G5W A;  2FLJ A;  4LKP A;  3H3I A;  4XMD A;  3VPJ E;  4EXZ A;  2X8T A;  2RTG B;  1BM5 A;  2F01 A;  1X89 A;  2LFO A;  4HFO A;  2RTO B;  4L3R A;  4DQ3 A;  5HZ6 A;  4I60 A;  1JBH A;  2JN3 A;  4O4X A;  3CKG A;  1TOU A;  1NP1 A;  4LZU A;  5H9L A;  3SLJ A;  3X00 A;  1YWA A;  1SRI A;  4U8U N;  1LCW A;  1MUP A;  5K68 A;  1VWM B;  1ZNG A;  2HLV A;  3EYC A;  2QOS C;  4MVL A;  3K3L A;  5D45 A;  5L8N A;  2CZU A;  4CPF A;  1SWK A;  5BYP A;  2VDF A;  5HBS A;  3VG2 A;  2BHV A;  1GGL A;  4HWM A;  3WXQ A;  5HCD C;  4NLI A;  1FEN A;  1URE A;  1VWI B;  1W4T A;  2ACP X;  4BJ8 A;  4ORX A;  3VE2 A;  3ZWE A;  1QY0 A;  2RTH B;  1KXO A;  2BC3 A;  2ACO A;  2K62 A;  5LJK A;  3BSZ E;  3UEX A;  4GKC A;  3V8U A;  4QQ1 A;  3WZQ A;  5KIC A;  1EAL A;  1KT7 A;  1JYD A;  3PK2 A;  2X46 A;  2AT0 X;  2HZR A;  2OVS A;  2XST A;  3P6D A;  3RE6 A;  2C4I A;  1EI5 A;  1HBQ A;  4HPD A;  4IAW A;  5HWZ A;  3ELX A;  4I3D A;  4OEM A;  1AB0 A;  2A0A A;  4O49 A;  3SZJ A;  5LJB A;  3MVF A;  4BQU A;  4TQ2 A;  1B8E A;  1SXX A;  3I17 A;  1SRJ A;  1IW2 A;  3UAQ A;  1I06 A;  3T6L A;  3KQ0 A;  4AZR A;  4IB9 A;  3BX8 A;  3EMM A;  2WSJ A;  1QWD A;  1VYG A;  1KZX A;  1QFV A;  4GDA A;  5EZ2 A;  3TGA A;  3U03 A;  1ZNE A;  1N9Y A;  4BX7 B;  2WQ9 A;  3D95 A;  4OS8 A;  3VHM A;  4COT A;  1LEL A;  2Z4I A;  1FEM A;  3D9W A;  5IO7 A;  1U18 A;  4AZQ A;  1NP4 A;  2G79 A;  2G8C O;  2AMM X;  4FQB B;  4QGW A;  2BS5 A;  1LNM A;  3RSW A;  2LA7 A;  1OBU A;  4FBR A;  2L9C A;  2FKJ A;  3HWD A;  2IZC B;  4MEE A;  2I5V O;  4RUU A;  2KT4 B;  1BSO A;  2G7B A;  3EM0 A;  1Y55 X;  5CE4 A;  3PPT A;  2QM9 A;  1X8U A;  4NV7 A;  1E5P A;  4BX6 B;  3STM X;  2LBV A;  1L6M A;  1MOY A;  2C1S A;  4NNS A;  1LUQ A;  4OEL A;  5FQ8 E;  4ARH A;  5HCC C;  4YH0 A;  1FE3 A;  2F73 A;  2JU7 A;  3EW2 A;  4YDA A;  3O22 A;  3MX7 A;  1JMZ A;  3ZZV A;  1H91 A;  4ZHF A;  2QO4 A;  4IRW A;  3FLL A;  4YGG A;  2OFM X;  3O2Y A;  1GM6 A;  1SY3 A;  4I9R A;  2QMI A;  3WJE A;  4Y59 A;  2VFC A;  4KII A;  4CV7 A;  1RXJ A;  1X8O A;  1BRP A;  3DSZ A;  3PH6 A;  4ON1 A;  4CPI A;  4BX5 A;  2PY1 A;  4GNY A;  3UEW A;  1VWD B;  4FGI B;  3STN A;  1YP6 A;  3EC5 A;  1IFC A;  3NX1 A;  2MWH A;  4NV8 A;  2OL8 O;  1CJ5 A;  2AF5 A;  4WFV A;  5B3M O;  1SWF A;  4BCS A;  2CM4 A;  1U17 A;  1GT3 A;  3NBX X;  1JZU A;  3FW5 A;  4JHQ A;  1W5R A;  4A8Z A;  2X4M A;  2IZJ A;  4IAB A;  2WUT A;  2OL7 A;  2Z4H A;  1O1V A;  2QO6 A;  1EIO A;  1YWD A;  4QZU A;  3WYP A;  3TGC A;  3ZI8 A;  2DM5 A;  4N7C A;  3HOL A;  4FBV A;  2Y3E A;  3WJF A;  3EBW A;  1CRB A;  5F1E A;  5EDB A;  3BX7 A;  1BWY A;  1HY2 A;  4MIR A;  1BJ7 A;  2FHN X;  1ZNH A;  3B2L A;  1E2T A;  3EBK A;  3CQN A;  4HPB A;  4ODD A;  3T1D A;  1ZNK A;  2FT9 A;  1DZJ A;  2IZH B;  2X8S A;  3VG4 A;  3AKM A;  1NQN A;  4ZCB A;  4ZH9 A;  4AZP A;  3VE1 A;  1ACD A;  1JIW I;  1G85 A;  2Y3F A;  2MJI A;  4B55 A;  3MM0 A;  1JQP A;  1SXY A;  2OY1 O;  2X8F A;  4IB6 A;  4MVK A;  1S44 A;  2RCT A;  1GKA A;  1KQW A;  3FEN A;  2GTL M;  3CWK A;  1T68 X;  5CYB A;  3P02 A;  2L67 A;  3HWF A;  1STP A;  2K23 A;  5EED A;  1IKE A;  2RA6 A;  1T0V A;  2ZAG A;  1DFV A;  1W6F A;  3PP6 A;  2JU3 A;  1I04 A;  3PED A;  1JYJ A;  1VWQ B;  4IB8 A;  4OMW A;  4AZN A;  1SWA A;  5EEE A;  5H9A A;  2IZG B;  4NYQ A;  3VU1 A;  1RST B;  2FKG A;  4EQA C;  3I0A A;  1SWL A;  1TVQ A;  2JW1 A;  2RTQ B;  5HAE A;  1WUB A;  4Z2O A;  4ZGU A;  3FDC A;  1X8P A;  1MK5 A;  1G7N A;  2R74 A;  2Q9S A;  3FA8 A;  4IMO A;  4ORS A;  5B2A O;  4TKB A;  1MX8 A;  4YBP A;  5HZ9 A;  2UYW A;  2NND A;  5H9N A;  1TOW A; 
#chains in the Genus database with same CATH homology
 3LHN A;  5JR8 A;  3JSQ A;  1TXL A;  5HZQ A;  2X45 A;  4LZV A;  1LIF A;  4I9S A;  2FS7 A;  1GT4 A;  4Y0Q A;  4U8U M;  1GT5 A;  4HPA A;  4O3Z A;  1EUO A;  4A1H A;  5AJB A;  2ASN X;  4YGH A;  5FAZ A;  4NW4 A;  1KQX A;  1X71 A;  1DZP A;  5EDC A;  4BOE A;  5FEN A;  1ZRY A;  4NLJ A;  1EPA A;  1DF3 A;  1RBP A;  3P6F A;  4GE1 A;  2AL0 X;  2WR6 A;  4YDB A;  1HMS A;  4O9S A;  1EW3 A;  4A60 A;  5F58 A;  2A2G A;  3N91 A;  3NX2 A;  1CBR A;  4ALO A;  5LKE A;  4M7M A;  3AKN A;  1LPJ A;  2JU8 A;  3HOE A;  4ZHC A;  2XKL A;  4R0B A;  1D3S A;  3QKG A;  3WJB A;  2JOZ A;  2OVE A;  1KGL A;  3BY0 A;  2OVA A;  3G7X A;  4ZJ0 A;  4ES7 A;  4TKH A;  3IA8 A;  3P6H A;  4IAX A;  1ZND A;  1SXU A;  3CBC A;  4O3Y A;  4QYP A;  4KT5 A;  1DV9 A;  4KC8 A;  4Y0P A;  1SY2 A;  4U9C A;  3ELZ A;  3FA7 A;  1QFT A;  2NNQ A;  2GC9 A;  5D4A A;  4UU3 A;  1YP7 A;  1IIU A;  4KC7 A;  3WJD A;  3GAQ A;  1JJX A;  1HBP A;  1HMT A;  5LKF A;  2F09 A;  2RN4 A;  1BSQ A;  2W2A A;  4GNW A;  3BS2 A;  5HCE C;  1A57 A;  2WWP A;  1ADL A;  3CR6 A;  4OMX A;  3C77 X;  4TKJ A;  4YKO A;  1UZ2 X;  1P6P A;  3KZA A;  5HTD A;  3B2K A;  3RZY A;  3TZS A;  3ZW2 A;  2AT6 X;  4N7D A;  4TLJ A;  4Y0S A;  1EQD A;  4ORU A;  3UEU A;  4K19 A;  4ALB A;  3ZUO A;  2AH7 X;  4EEJ A;  1AEL A;  1DZK A;  5KHP A;  3OJY C;  4I95 A;  4INN A;  1EPB A;  4NYR A;  5D48 A;  3FIQ A;  3APW A;  4I3B A;  4ORW A;  1RLB E;  3S5X A;  3VG3 A;  4TNN A;  1HMR A;  4YMY A;  2FRS A;  4QYN A;  4YCE A;  5DPQ A;  1JV4 A;  2L68 A;  2Q2M A;  2NNE A;  2KD2 A;  3WOV A;  4FBR A;  3NPO A;  2KTD A;  1SY1 A;  4IB7 A;  5B29 A;  1QAB E;  5H9K A;  4O3W A;  3O19 A;  1O1U A;  1U0X A;  3FA6 A;  3NAD A;  2L5P A;  3D97 A;  4XMF A;  4XMG A;  3APX A;  2WQA E;  2LB6 A;  4MVE A;  3HK1 A;  4AZM A;  3WJG A;  4YKM A;  3P24 A;  4GH7 A;  2HNX A;  4GET A;  5C0N A;  2OZQ A;  1Z24 A;  2AT3 X;  4Y0R A;  4QAE A;  2A3F X;  2MO5 A;  5EPQ A;  1GX8 A;  2Q4N A;  2R56 A;  3U0D A;  3D96 A;  3SOT A;  2FTB A;  5DG4 A;  1OEJ A;  3JQO A;  4L1N A;  4ZFX A;  4BVM A;  1TW4 A;  2LKK A;  4CSB A;  1LIE A;  4OS3 A;  1GXA A;  1S7D A;  4YBU A;  1D2U A;  4QZT A;  1KT3 A;  2ALL X;  5IO5 A;  2POA A;  4PSQ A;  1B0O A;  3NQK A;  1MDC A;  1BEB A;  3HTY A;  3WVM A;  5HZ8 A;  4YCH A;  1OBQ A;  4M6S A;  2AKQ A;  3B2H A;  3MBT A;  1SY0 A;  2MM3 A;  5LJH A;  4GZV A;  1T8V A;  3FEP A;  3PQU A;  1B4M A;  4UU2 A;  2GJ5 A;  3C76 X;  1KT4 A;  2Q2P A;  1KT6 A;  3STK A;  1PMP A;  5K06 A;  2QO5 A;  2LBA A;  1HQP A;  3FEK A;  2O62 A;  1KOI A;  3FA9 A;  3CMP A;  3P6C A;  3OD9 A;  1PBO A;  4D6B A;  1I4U A;  1OBP A;  4ZGF A;  4I3C A;  1OEK A;  4O4U A;  4I6S A;  1I05 A;  3ZUI A;  5B27 A;  1ERB A;  4ZHD A;  3WJC A;  3PH5 A;  1QG5 A;  4WHI A;  4YFP A;  5LJG A;  4DQ4 A;  1ALB A;  3IFB A;  2GTL N;  4GRJ A;  4TJZ A;  1KT5 A;  2CBR A;  1NGL A;  1X8N A;  2FR2 A;  2OFR X;  1JJJ A;  3ZW1 A;  1FEL A;  2AT5 X;  2ZAI A;  4CK4 A;  2CM9 A;  1IKJ A;  4MIS A;  4AW8 A;  2OVD A;  1AQB A;  3F6Z B;  4WFU A;  3L4R A;  1EXS A;  1QQS A;  3FR4 A;  4EFG A;  4XME A;  3NR3 A;  4KCA A;  1MVG A;  3S60 A;  1S2P A;  1Y9L A;  4QGV A;  3WBG A;  3VG6 A;  3BDR A;  1IFB A;  4QGX A;  1A18 A;  3JS1 A;  1LID A;  1YWB A;  4ML7 B;  4O4S A;  5LJE A;  3B2J A;  1Y9T A;  1O8V A;  4GK9 A;  3KFG A;  5F6Z A;  1SMP I;  3FEL A;  2GTF X;  3CBS A;  5HTE A;  3RBY A;  3ZW1 B;  1ML7 A;  1DC9 A;  2ANS A;  5HA1 A;  3KFI A;  5F6B A;  1CBQ A;  3BU9 A;  3FW4 A;  5FFH A;  3APV A;  1LIB A;  2W2B A;  3TF6 A;  3E3C A;  3NQ9 A;  2M4L A;  1SA8 A;  5LJC A;  1PM1 X;  4YGZ A;  2A2U A;  3CQR A;  2GTL O;  3FR2 A;  2WEX A;  5L8O A;  3DTQ A;  3P6G A;  4XMC A;  1GT1 A;  1PEE A;  2G78 A;  3NP1 A;  4PJ2 A;  3D4R A;  3SAO A;  2WEW A;  1MX7 A;  4JGL A;  1CBI A;  1LIC A;  1LKE A;  4LKT A;  3HWE A;  2FR3 A;  4IMN A;  5AJC A;  4ORY A;  1ICN A;  4O3X B;  5IO6 A;  5BVT A;  3F8A A;  1VPR A;  2HZQ A;  5FQ6 E;  4NP1 A;  3S26 A;  4AYH A;  4FBO A;  5D8J A;  1BLR A;  3PEC A;  1FDQ A;  2JMB A;  1X8Q A;  2E4J A;  1GX9 A;  4U8U O;  2IFB A;  3Q6L A;  4WBK A;  4AZO A;  5AEO A;  2EU7 X;  4EDE A;  2W2F A;  3FYF A;  5H8T A;  4ZHG A;  5FQ7 E;  2KW1 A;  5D47 A;  1KZW A;  3B2I A;  4RUN A;  4YFR A;  4A1Y A;  1XKI A;  3ZW0 A;  1A2D A;  3RWX A;  1YWC A;  2KTS A;  3FR5 A;  1BSY A;  1A3Y A;  4QRL A;  4ZHH A;  1E02 A;  5BVS A;  5KID A;  3GE2 A;  3NQ3 A;  1E06 A;  1YUP A;  3F9D A;  2FWV A;  1OPB A;  2HYS A;  3OE3 A;  3TGB A;  1BBP A;  2AT8 X;  5HZ5 A;  1QY2 A;  4YFQ A;  2YMS A;  4GU8 A;  3C78 X;  1QY1 A;  1ERX A;  5HA0 A;  1AVG I;  2CBS A;  4ZH6 A;  1CBS A;  1LF7 A;  1G74 A;  3FMZ A;  4ID2 A;  2BS6 A;  3UEV A;  2Q39 A;  2BT9 A;  2YG2 A;  4XMH A;  5F7G A;  3ZW0 B;  4ZR2 A;  3OBL A;  2CZT A;  2RQ0 A;  3LV4 A;  2R73 A;  4QNI A;  2MHD A;  3P6E A;  1FTP A;  4KH8 A;  2RD7 C;  4LQZ A;  1OPA A;  3KFF A;  3VG5 A;  3U9P C;  1XCA A;  4OS0 A;  3VG7 A;  1OEE A;  3HWG A;  1LFO A;  2RCQ A;  2A13 A;  1E00 A;  1SXW A;  3ZQ3 A;  4U3Q A;  2P8G A;  3S5V A;  2HMB A;  3BLG A;  1ICM A;  4IBA A;  1R0U A;  4ORR A;  1BRQ A;  3PQS A;  4D6A A;  1YIV A;  1DZM A;  3BRN A;  5LJD A;  2N93 A;  2BLG A;  1VYF A;  1B56 A;  2FS6 A;  1N0S A;  3RKG A;  4GDZ A;  3KFH A;  5AQ6 A;  4NNT A;  4O4O A;  5L8I A;  4HPC A;  2NP1 A;  3APU A;  3BU1 A;  1ZNL A;  1GKA B;  4MVI A;  5BVQ A;  1HN2 A;  1G5W A;  2FLJ A;  4LKP A;  3H3I A;  4XMD A;  3VPJ E;  4EXZ A;  2X8T A;  1BM5 A;  2LFO A;  1X89 A;  4HFO A;  4DQ3 A;  4L3R A;  5HZ6 A;  1JBH A;  2JN3 A;  4O4X A;  1TOU A;  1NP1 A;  4LZU A;  5H9L A;  1YWA A;  4U8U N;  1MUP A;  1ZNG A;  2HLV A;  3EYC A;  2QOS C;  4MVL A;  3K3L A;  5D45 A;  5L8N A;  2CZU A;  5BYP A;  5HBS A;  3VG2 A;  2BHV A;  1GGL A;  4HWM A;  3WXQ A;  5HCD C;  4NLI A;  1FEN A;  1URE A;  2ACP X;  4ORX A;  3VE2 A;  3ZWE A;  1QY0 A;  1KXO A;  2K62 A;  2ACO A;  5LJK A;  3BSZ E;  3UEX A;  4GKC A;  3V8U A;  4QQ1 A;  5KIC A;  1EAL A;  1EII A;  1KT7 A;  1JYD A;  2X46 A;  2AT0 X;  2HZR A;  2OVS A;  2XST A;  3P6D A;  1EI5 A;  1HBQ A;  4HPD A;  4IAW A;  5HWZ A;  3ELX A;  4I3D A;  1AB0 A;  2A0A A;  4O49 A;  3MVF A;  4BQU A;  4TQ2 A;  1B8E A;  1SXX A;  3I17 A;  1IW2 A;  3UAQ A;  1I06 A;  3KQ0 A;  4AZR A;  4IB9 A;  3BX8 A;  3EMM A;  2WSJ A;  1QWD A;  1VYG A;  1KZX A;  1QFV A;  3TGA A;  5EZ2 A;  3U03 A;  1ZNE A;  2WQ9 A;  3D95 A;  4OS8 A;  4COT A;  2Z4I A;  1FEM A;  5IO7 A;  1U18 A;  4AZQ A;  1NP4 A;  2G79 A;  2AMM X;  4FQB B;  4QGW A;  2BS5 A;  1LNM A;  3RSW A;  2LA7 A;  1OBU A;  2L9C A;  3HWD A;  4RUU A;  2KT4 B;  1BSO A;  2G7B A;  3EM0 A;  5CE4 A;  3PPT A;  2QM9 A;  1X8U A;  1E5P A;  3STM X;  2LBV A;  1L6M A;  5FQ8 E;  4NNS A;  4ARH A;  5HCC C;  4YH0 A;  1FE3 A;  2F73 A;  2JU7 A;  4YDA A;  4ZHF A;  3O22 A;  3MX7 A;  3ZZV A;  1H91 A;  2QO4 A;  4YGG A;  3FLL A;  2OFM X;  3O2Y A;  1GM6 A;  1SY3 A;  4I9R A;  2QMI A;  3WJE A;  4KII A;  4CV7 A;  1X8O A;  1BRP A;  3DSZ A;  3PH6 A;  4ON1 A;  2PY1 A;  4GNY A;  3UEW A;  4FGI B;  3STN A;  1YP6 A;  1IFC A;  3NX1 A;  2MWH A;  1CJ5 A;  4WFV A;  2CM4 A;  1U17 A;  1GT3 A;  3NBX X;  1JZU A;  3FW5 A;  4A8Z A;  4IAB A;  2WUT A;  2Z4H A;  1O1V A;  2QO6 A;  1EIO A;  1YWD A;  4QZU A;  3TGC A;  3ZI8 A;  2DM5 A;  4N7C A;  3HOL A;  4FBV A;  3WJF A;  3EBW A;  1CRB A;  5F1E A;  5EDB A;  3BX7 A;  1BWY A;  4MIR A;  1BJ7 A;  3B2L A;  1ZNH A;  4HPB A;  3EBK A;  4ODD A;  3CQN A;  3T1D A;  5LJB A;  1ZNK A;  2FT9 A;  1DZJ A;  2X8S A;  3VG4 A;  3AKM A;  4ZCB A;  4ZH9 A;  4AZP A;  3VE1 A;  1ACD A;  1JIW I;  1G85 A;  2MJI A;  1SXY A;  2X8F A;  4IB6 A;  4MVK A;  1S44 A;  2RCT A;  1GKA A;  1KQW A;  3FEN A;  2GTL M;  3CWK A;  1T68 X;  5CYB A;  3P02 A;  2L67 A;  3HWF A;  2K23 A;  5EED A;  1IKE A;  2RA6 A;  1T0V A;  2ZAG A;  1DFV A;  3PP6 A;  2JU3 A;  1I04 A;  3PED A;  1JYJ A;  4IB8 A;  4OMW A;  4AZN A;  5EEE A;  5H9A A;  4NYQ A;  3VU1 A;  4EQA C;  3I0A A;  1TVQ A;  5HAE A;  2JW1 A;  4ZGU A;  1X8P A;  2R74 A;  1G7N A;  3FA8 A;  2Q9S A;  4ORS A;  4IMO A;  4YBP A;  5HZ9 A;  4TKB A;  1MX8 A;  2NND A;  5H9N A;  1TOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...