3NADA

Crystal structure of phenolic acid decarboxylase from bacillus pumilus ui-670
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
161
structure length
161
Chain Sequence
MDQFVGLHMIYTYENGWEYEIYIKNDHTIDYRIHSGMVGGRWVRDQEVNIVKLTKGVYKVSWTEPTGTDVSLNFMPEEKRMHGVIFFPKWVHERPDITVCYQNDYIDLMKESREKYETYPKYVVPEFADITYIHHAGVNDETIIAEAPYEGMTDEIRAGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferulate decarboxylase
publication title Structural analysis of Bacillus pumilus phenolic acid decarboxylase, a lipocalin-fold enzyme.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Lyase
total genus 43
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05870 PA_decarbox Phenolic acid decarboxylase (PAD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3nadA00
2L68A 2OFRX 1YWAA 3PH5A 4RUUA 2L9CA 4XMEA 1ML7A 2G7BA 2OZQA 1LF7A 4ZHFA 2K23A 5LJEA 3AKNA 4OS0A 4QAEA 3K3LA 1NGLA 2A3FX 1VYFA 4QYPA 5HA1A 2F73A 4HPAA 1FEMA 5EEDA 5EPQA 1OBQA 5HZ9A 5LJDA 2POAA 5EDCA 1GKAB 2YG2A 4AZOA 5AQ6A 1MDCA 4YFQA 1S7DA 4OMWA 3WJGA 4EDEA 1X8PA 2AT0X 2A2UA 1SXUA 4R0BA 1TVQA 2CM4A 4AW8A 4OS8A 2WSJA 2QO6A 4ZJ0A 4AZNA 1IIUA 3FLLA 3TF6A 1XCAA 3P6CA 3D97A 1KZWA 2P8GA 4KIIA 4BOEA 1KT3A 1CBRA 1ICMA 1E02A 2CBRA 3TGBA 1L6MA 4NP1A 2RCQA 4CK4A 4GRJA 1GXAA 3IFBA 4NYQA 1EUOA 3PECA 5HTEA 3EBWA 3KFIA 3ZUOA 5EDBA 1QFVA 3VG3A 1BEBA 3STMX 1FE3A 1JBHA 3FA9A 5D48A 5L8IA 1GT4A 4QGWA 1EIOA 2CBSA 2FTBA 3T1DA 4AYHA 1I4UA 5LJHA 1GX8A 2FRSA 5LJGA 1A57A 4HPBA 4AZRA 1G74A 3C78X 4QYNA 2RD7C 1JYJA 2CM9A 1X89A 2DM5A 3WJDA 3B2KA 3BU1A 1KXOA 3FR4A 4AZPA 5L8NA 3KFHA 1E06A 1R0UA 1DV9A 2A0AA 2EU7X 2QO5A 1DZMA 2LFOA 2R56A 3KZAA 5K06A 3TGAA 3FA6A 2LBAA 1S44A 2AT8X 3HWGA 4IBAA 3UEUA 1BRQA 1A2DA 2FR2A 2PY1A 1U0XA 4BQUA 1X8OA 1O1VA 4ZHCA 2NNEA 4K19A 1SY1A 3BX8A 5JR8A 4I9RA 4A8ZA 2XSTA 1KGLA 1SY3A 2OFMX 4ZHHA 1CBSA 5FFHA 2JU8A 1E5PA 5D45A 1O8VA 4ALOA 1SXXA 4YBUA 1B0OA 4ORXA 3P6HA 2MM3A 5HCCC 5BVQA 4IAXA 4XMGA 2Q4NA 4MVIA 1EQDA 2G78A 3HK1A 5KHPA 2WQ9A 2FWVA 4GE1A 1T8VA 2GJ5A 3HWEA 2E4JA 3FA8A 4ODDA 1HN2A 3WJEA 5DPQA 2RA6A 3I0AA 1IFBA 1I06A 2WUTA 2QO4A 4YMYA 3EYCA 2ASNX 4Y0PA 1OBPA 3APWA 1AVGI 3P6DA 4YKMA 1SA8A 1BRPA 1G5WA 3BS2A 1KQXA 3B2LA 2AH7X 4QGVA 3C76X 2AKQA 1KT4A 3D95A 2OVDA 1BSQA 2Q9SA 1LIEA 3AKMA 5HZ8A 2K62A 4ORSA 2Q2PA 4A1YA 5DG4A 5H9AA 4A1HA 3UEWA 2WQAE 1CRBA 2FR3A 2QOSC 1SXWA 2XKLA 5HZ6A 1LKEA 4GETA 1YIVA 2W2FA 3C77X 5HTDA 4LKTA 2WEXA 1MUPA 4N7DA 2X45A 4TKBA 3HWFA 4M6SA 1B56A 3F9DA 1UREA 5LJBA 1GM6A 2GTFX 1QFTA 1ZNGA 1G7NA 3B2JA 1I04A 1P6PA 1VYGA 1YWBA 1HMTA 1FELA 2FS6A 4ZHDA 1SY2A 5B29A 3O22A 1X71A 2RCTA 1YWDA 2WWPA 3WXQA 4IB8A 1VPRA 5BVSA 4ARHA 3NADA 3P6EA 3O19A 4UU2A 2MJIA 4AZQA 4YFRA 1E00A 1MX7A 3FR2A 1A3YA 1NP4A 4GKCA 1JYDA 2AT3X 3BSZE 4HFOA 4YGHA 1QY2A 3I17A 5BVTA 1DZKA 1QWDA 5D47A 3EM0A 4YDBA 3BU9A 2NP1A 2Q39A 3O2YA 5HCDC 3BDRA 4I3CA 5L8OA 3FEPA 2IFBA 2AMMX 2CZTA 3MBTA 4YDAA 1X8QA 3FA7A 2FT9A 4M7MA 1U18A 3FIQA 1ZNDA 1A18A 3S26A 3FW4A 4IB7A 1HMSA 4A60A 3Q6LA 4UU3A 4Y0RA 1YP7A 3FENA 5H9NA 2ANSA 3U0DA 1KOIA 1H91A 4YKOA 1S2PA 5FENA 1LIBA 4QZUA 2ACPX 1IW2A 2HMBA 2LB6A 5FAZA 4DQ4A 1OPAA 1JV4A 2ALLX 1YUPA 3STNA 2CZUA 4O9SA 3VG2A 2Q2MA 3VG5A 4YFPA 3WVMA 3GAQA 3UEVA 2KT4B 1ALBA 1LIFA 5B27A 1LICA 1YP6A 2FS7A 2A2GA 3ZUIA 4ALBA 3FR5A 5LJKA 1ZNEA 5H8TA 1EXSA 5IO5A 1DZJA 3NX1A 1TW4A 3QKGA 5LJCA 1BWYA 2JOZA 1AB0A 1EW3A 4I3DA 4OMXA 3UEXA 4NYRA 3EMMA 3IA8A 3ELZA 4ES7A 1BM5A 1B8EA 5IO7A 4MVKA 2AL0X 3PPTA 3KFFA 1U17A 3BLGA 1SY0A 1Z24A 5F7GA 2W2AA 3G7XA 1GT3A 1HBQA 3RSWA 3BRNA 1JZUA 4TNNA 5H9KA 1ADLA 1ERBA 1EIIA 1OBUA 1BSYA 3FMZA 3JS1A 4HPDA 3P6GA 4IMOA 1TOWA 1MX8A 1HQPA 4EEJA 1KT5A 4WBKA 2X46A 5HBSA 2A13A 4BVMA 4YCEA 3DTQA 1DZPA 1EPAA 4AZMA 1ERXA 5IO6A 5EEEA 1DC9A 5KICA 3APVA 3NQ3A 4PSQA 4TKHA 3OJYC 4EFGA 5H9LA 3NPOA 4NNSA 1OEJA 4NNTA 1KT6A 4ORUA 1IFCA 4LZUA 5F58A 4TJZA 3CWKA 1QQSA 1G85A 3D96A 4OS3A 1PEEA 3WJCA 3KQ0A 4TLJA 4NLJA 1IKJA 1CBIA 4Y0SA 5HZQA 4ZHGA 5KIDA 5HA0A 4ORYA 1GX9A 2LBVA 1NP1A 3TGCA 3U9PC 1RLBE 3WJBA 1DFVA 1JJJA 4D6BA 2HNXA 1JJXA 4XMFA 4ZR2A 4ZH9A 2W2BA 1EPBA 1ZNHA 5EZ2A 3SAOA 4ORWA 1I05A 1B4MA 3CBCA 5HCEC 2OVAA 3PH6A 3L4RA 4HPCA 1IKEA 1KQWA 2NNQA 2RQ0A 4LZVA 3BY0A 1T68X 4ZH6A 1BBPA 2FLJA 1OEKA 3FELA 3CMPA 4I3BA 5F6BA 1SXYA 2WEWA 2ACOA 1XKIA 2LKKA 4TQ2A 4N7CA 2L5PA 3PP6A 3NQ9A 3VG7A 2QM9A 2OVEA 4MVLA 2NNDA 4YGZA 1UZ2X 1DF3A 2GC9A 2HZQA 3DSZA 4YCHA 1BLRA 3RZYA 4D6AA 3WJFA 2JU3A 1AELA 5HAEA 2MO5A 1T0VA 1OPBA 4ORRA 2R73A 1D2UA 1LPJA 3JSQA 4ZCBA 1HMRA 2AT6X 5HZ5A 3KFGA 4WFUA 3STKA 3BX7A 4TKJA 5HWZA 1BSOA 4XMCA 3P6FA 3ELXA 3B2IA 4YBPA 2JN3A 1AQBA 1MVGA 1YWCA 3FW5A 3NR3A 4RUNA 4IB6A 1EALA 3VG4A 1N0SA 2KTDA 2R74A 1PBOA 4EXZA 1CBQA 3ZQ3A 2HLVA 3CBSA 3TZSA 1GT5A 3APUA 5LKFA 5C0NA 5LKEA 1KT7A 1KZXA 1GKAA 1QY0A 4WFVA 5D4AA 3CQRA 4YH0A 4GNWA 4QZTA 1FTPA 2N93A 3EBKA 4IAWA 3CR6A 1GGLA 1GT1A 1LNMA 2AT5X 3VG6A 4I9SA 5F1EA 4ZFXA 1X8NA 2JU7A 3NP1A 4DQ3A 1BJ7A 4IMNA 3PEDA 3B2HA 3HWDA 4GNYA 1ACDA 1PM1X 4QGXA 1TXLA 1PMPA 1QG5A 2L67A 5CE4A 1LIDA 2BLGA 1FDQA 4XMHA 2HZRA 1ZRYA 1X8UA 3APXA 4LKPA 3CQNA 3U03A 1OEEA 1QABE 1ZNLA 4GH7A 1FENA 1D3SA 1O1UA 2WR6A 1ICNA 1TOUA 5F6ZA 3WBGA 1QY1A 1CJ5A 2HYSA 4YGGA 3F8AA 3NX2A 2G79A 1LFOA 1HBPA 4NLIA 1ZNKA 3FEKA 5D8JA 4XMDA 4IB9A 4ZGUA 4Y0QA 1RBPA 3MVFA 2O62A
chains in the Genus database with same CATH superfamily
2L68A 2OFRX 1YWAA 2CAMA 3PH5A 4GZVA 4RUUA 2GH7A 2L9CA 1UYOX 1ML7A 2G7BA 2OZQA 1LF7A 4XMEA 1MEPA 2K23A 3PDFA 2X8SA 3HTYA 4ZHFA 5LJEA 3AKNA 3KVNA 4OS0A 3VE2A 1LDQA 1VWEB 1NGLA 2A3FX 3K3LA 4QAEA 1VYFA 2UZ2A 1MM9A 4QYPA 1KL5A 5HA1A 1VWIB 2F73A 4L1NA 4HPAA 2FKGA 1FEMA 5EEDA 5EPQA 1OBQA 3RDXA 2G5LA 5HZ9A 1W6FA 1VWAB 4WHIA 2POAA 2IZJA 1SWCA 5LJDA 4EQAC 1N9MA 5EDCA 1GKAB 2YG2A 4AZOA 5AQ6A 3SZHA 1SLFB 4O3YA 1MDCA 4YFQA 1S7DA 4OMWA 2C1QA 3WJGA 4EDEA 1X8PA 2AT0X 1SWJA 1SXUA 2A2UA 4R0BA 1TVQA 2CM4A 2IZAA 4AW8A 4OS8A 2WSJA 4BX6A 2QO6A 4ZJ0A 4AZNA 1IIUA 2QCBA 2RTJA 3FLLA 2RTEB 1SLDB 3TF6A 1VWRB 1XCAA 1GX3A 4FBVA 3P6CA 4ID2A 3D97A 1KZWA 5B2AO 1IJ8A 1STSB 2P8GA 4JGLA 4KIIA 4O3ZA 2IZCB 4BOEA 1KT3A 1CBRA 2IZLB 1ICMA 1E02A 2CBRA 3TGBA 2F01A 1L6MA 4NP1A 3T2XA 2RCQA 5K67A 4CK4A 1VWPB 4GRJA 1GXAA 3IFBA 4NYQA 1EUOA 4NV8A 3PECA 4COTA 2IZBA 5HTEA 3EBWA 3KFIA 3ZUOA 2OF8A 5EDBA 5FQ6E 1QFVA 3VG3A 1BEBA 3STMX 2HKDA 1FE3A 1W5RA 4NV7A 4C5PA 4Z2OA 1JBHA 3FA9A 5D48A 5L8IA 1GT4A 4QGWA 1SWGA 4GJSA 1EIOA 2CBSA 2FTBA 3Q34A 1VWBB 3T1DA 3X00A 1I4UA 5B5GA 2IZKA 2DJGA 4AYHA 5LJHA 1GX8A 2FRSA 5LJGA 1VWLB 1A57A 4HPBA 3SZJA 4AZRA 1G74A 1VWHB 4YVBA 1SRIA 2Y3EA 2MHDA 3C78X 2RD7C 4QYNA 1JYJA 2CM9A 1X89A 2A5BA 2DM5A 3LTWA 4KC8A 3WJDA 3F6ZB 2RTLA 3B2KA 3BU1A 1KXOA 3FR4A 1NBXA 4GD9A 4AZPA 5L8NA 3KFHA 1SRHA 5HTDA 1E06A 4MEEA 1R0UA 1DV9A 2A0AA 2EU7X 2QO5A 1DZMA 2LFOA 2R56A 2X8TA 3KZAA 4OEMA 3FA6A 3RDQA 3RY1A 3TGAA 5B11O 3WZOA 5K06A 2LBAA 1S44A 1VWMB 2AT8X 3HWGA 4IBAA 2VFBA 3UEUA 1BRQA 1MOYA 1NQNA 4U9CA 1A2DA 2FR2A 2PY1A 1U0XA 4BQUA 4CPHA 1Y0GA 1X8OA 1O1VA 2RTQB 4ZHCA 2NNEA 4K19A 1SY1A 1N9YA 3BX8A 5JR8A 4I9RA 3SLJA 4A8ZA 2XSTA 2OY1O 1JJUA 1KGLA 1SY3A 2OFMX 4ZHHA 4GJVA 1WUBA 2I5ZO 4MIRA 3FDCA 5K68A 3V8UA 1CBSA 1SWLA 2A8GA 5FFHA 4IRWA 4Z2PA 2JU8A 1E5PA 5D45A 1O8VA 2RTOB 4ALOA 1SXXA 4YBUA 1B0OA 4ORXA 4OELA 3P6HA 1SWHA 5B3MO 3N91A 4QQ1A 3VHMA 2MM3A 5HCCC 4CDFA 5BVQA 4GK9A 4IAXA 4XMGA 2Q4NA 5B5FA 4MVIA 1EQDA 2G78A 3HK1A 5KHPA 2WQ9A 2FWVA 1Y52X 4GE1A 4ML7B 3T2WA 2RTGB 1T8VA 4FBRA 2GJ5A 3HWEA 2DJFA 2E4JA 3FA8A 4BX7B 4ODDA 1HN2A 3WJEA 4CV7A 5DPQA 2RA6A 4I6SA 3I0AA 1IFBA 1I06A 2WUTA 1SWEA 2QO4A 3EYCA 4YMYA 2IZFB 4DCBA 1SWUA 2ASNX 4Y0PA 1OBPA 3APWA 1AVGI 3P6DA 4DNEA 4YKMA 1SA8A 3VE1A 1BRPA 3GE2A 3JQOA 4GUZA 1G5WA 3BS2A 1KQXA 4B55A 3B2LA 2AH7X 4QGVA 3C76X 2AKQA 1KT4A 3D95A 1SWOA 2OVDA 1BSQA 2Q9SA 2RTHB 3WYQA 1LIEA 3AKMA 4O49A 2K62A 5HZ8A 1OSPO 2RTKA 4ORSA 2Q2PA 4A1YA 5DG4A 3H3IA 5H9AA 4A1HA 3UEWA 2WQAE 1CRBA 2FR3A 2QOSC 1SXWA 2XKLA 1VWOB 1K3BA 1LKEA 5HZ6A 1RXJA 1VWQB 2OVSA 2RTFB 4GETA 1YIVA 2W2FA 3LHNA 1JMXA 3C77X 4LKTA 5CHKA 4O4UA 2WEXA 1LCZA 1MUPA 4N7DA 2X45A 1PTSA 4TKBA 5FQ8E 2JMBA 3HWFA 4M6SA 1B56A 3OBLA 3F9DA 2VDFA 1UREA 2AVIA 5LJBA 3VHIA 1GM6A 1VWJB 5L3YA 2GTFX 3NQKA 4CPHB 1QFTA 1ZNGA 1G7NA 3B2JA 3MX7A 3WOVA 1I04A 2OFAA 2RTCB 4PJ2A 5IRWA 1P6PA 1VYGA 1SWAA 1YWBA 1HMTA 1FELA 2FS6A 4ZHDA 1SY2A 5B29A 3O22A 1X71A 3SZIA 2RCTA 2MWHA 1YWDA 2WWPA 1HXLA 4LQZA 1VWCB 3WXQA 4IB8A 1VPRA 5BVSA 4ARHA 1SWPA 3NADA 1RSUB 3P6EA 3S5XA 3O19A 4UU2A 2MJIA 4AZQA 4YFRA 1E00A 1MX7A 3FR2A 4INNA 1A3YA 1NP4A 1LDOA 4GKCA 1JYDA 2AT3X 4O4OA 3BSZE 4HFOA 3SLOA 4YGHA 3T6LA 3ZZVA 1QY2A 3I17A 2MF6A 4JHQA 5BVTA 4FBOA 1DZKA 1QWDA 2Z4IA 1LELA 3EM0A 3EW1A 1N7YA 4YDBA 5D47A 3BU9A 2NP1A 2BC3A 4HWMA 2Q39A 2JW1A 3O2YA 5HCDC 3BDRA 4I3CA 1VWFB 5L8OA 3FEPA 2IFBA 4JNJA 2AMMX 2CZTA 4KCAA 3MBTA 1HQQA 1SRFA 2PI3O 4YDAA 1WBIA 2F09A 1VWDB 1X8QA 3PQUA 3FA7A 2WPUA 2FT9A 4M7MA 1N43A 3ZW1A 4GGZA 1U18A 3QQ2A 3FIQA 1ZNDA 3RDMA 1A18A 4O3XB 3S26A 3FW4A 2RTNB 4IB7A 1HMSA 5B10O 3RDOA 4A60A 4CDDA 3Q6LA 4UU3A 4Y0RA 1YP7A 1I78A 3FENA 3HPEA 5H9NA 2ANSA 3WZPA 3U0DA 1KOIA 1H91A 2Y32A 1S2PA 4GDAA 4I95A 4YKOA 4Z28A 5FENA 4Z2VA 1LIBA 2BSZA 4QZUA 2ACPX 2OF9A 4U8UM 1IW2A 1EI5A 2HMBA 2LB6A 4GGRA 2RTMA 5FAZA 4DQ4A 1OPAA 1JV4A 2ALLX 1YUPA 3STNA 1VYOA 2CZUA 4O9SA 2Q2MA 3VG2A 3VG5A 4YFPA 5CYBA 5AEOA 3WVMA 1KFFA 3GAQA 3UEVA 4O4SA 1N4JA 2KT4B 1ALBA 1JIWI 1LIFA 5B27A 1LICA 1YP6A 3SLTA 2FS7A 2A2GA 3ZUIA 2X55A 2GTLM 2X4MA 4ALBA 3FR5A 5LJKA 1ZNEA 5H8TA 1EXSA 5IO5A 1DZJA 3NX1A 1TW4A 3QKGA 5CSEA 4U8UO 1E2TA 4U3QA 4BX5A 4BX6B 2JOZA 5LJCA 1BWYA 1AB0A 4ON1A 1KL4A 1EW3A 1LCVA 4I3DA 4OMXA 3UEXA 4QRLA 4CSBA 4NYRA 3SOTA 3EMMA 2UYWA 4FGIB 3IA8A 3ELZA 4ES7A 1BM5A 1B8EA 2LA7A 5IO7A 4MVKA 2AL0X 2BS5A 5IRAA 2GTLO 2YMSA 3PPTA 3KFFA 1U17A 3BLGA 2RTAA 1SY0A 1Z24A 5F7GA 2JGSA 4OKAA 2AF5A 2W2AA 2Z4HA 1GT3A 1HBQA 3G7XA 3RSWA 3RKGA 3BRNA 4CPEA 1JZUA 3ZW0A 4TNNA 2RTPB 5H9KA 2Y3FA 1K24A 1ADLA 2QOMA 1ERBA 3OD9A 1EIIA 2ZAGA 1OBUA 1BSYA 3FMZA 3FYFA 3JS1A 4HPDA 3P6GA 4IMOA 4U46A 3D9WA 1TOWA 4IABA 1MX8A 1HQPA 4EEJA 1KT5A 3E3CA 1Y53X 2X46A 4WBKA 2A13A 5HBSA 4YCEA 4BBOA 2OY5O 4BVMA 3DTQA 5BYPA 4ZGFA 1DZPA 1EPAA 4AZMA 4BJ8A 1ERXA 5IO6A 5EEEA 1DC9A 4MISA 5KICA 3APVA 3NQ3A 4PSQA 4TKHA 1Y55X 3OJYC 1DF8A 4EFGA 5H9LA 3NPOA 4NNSA 1OEJA 4NNTA 1KT6A 4ORUA 3D4RA 1IFCA 4LZUA 5F58A 4TJZA 3CWKA 1QQSA 1G85A 1HXZA 1RAVA 2BT9A 3D96A 3FIDA 4DQ3A 2ZAIA 4OS3A 1LUQA 1SRJA 5IXGA 1SMPI 4I60A 1PEEA 2OL6O 3WJCA 5IRUA 3KQ0A 3MG5A 4FQBB 4GGTA 1IKJA 3CKGA 1CBIA 4NLJA 4JO6A 4TLJA 2OYBO 4Y0SA 5HZQA 1STPA 3ZI8A 4ZHGA 5KIDA 3EW2A 5HA0A 3EC5A 4ORYA 3P24A 1GX9A 5F2BA 2LBVA 3WZQA 1NP1A 3TGCA 3U9PC 1RLBE 3WJBA 1DFVA 2RN4A 4D6BA 1JJJA 2HNXA 4BX5B 3AEHA 1JJXA 4XMFA 4ZR2A 4ZH9A 2X32A 2W2BA 1EPBA 2BHVA 1SWNA 1ZNHA 4GDZA 5EZ2A 3SAOA 2IZGB 4ORWA 1I05A 3VGWA 1B4MA 3CBCA 5HCEC 2OVAA 4KC7A 5AJCA 1AVEA 3PH6A 3L4RA 4HPCA 1IKEA 1KQWA 2NNQA 2RQ0A 2VFCA 4LZVA 3BY0A 1RSTB 4GU8A 1T68X 4ZH6A 4Z6JA 1BBPA 2A5CA 1SRGA 2FLJA 2OL7A 1OEKA 3FELA 3CMPA 4I3BA 5F6BA 1UYNX 2FGSA 4Y5DA 1SXYA 3LV4A 3RWXA 2WEWA 2ACOA 1FJ1E 1XKIA 2LKKA 2RTDB 1JQPA 4N7CA 2L5PA 4TQ2A 2QMIA 3PP6A 3VPJE 3NQ9A 3ZW0B 5AJBA 2QM9A 3VG7A 1JMZA 2OVEA 3PK2A 2NNDA 4MVLA 4YGZA 1UZ2X 1W4TA 1DF3A 2GC9A 4CPIA 2HZQA 3DSZA 4YCHA 2OFBA 1BLRA 2IZEB 3RZYA 3WJFA 4D6AA 2JU3A 1AELA 5HAEA 2MO5A 3RY2A 1VWGB 4BX7A 3AUMO 1T0VA 1OPBA 4ORRA 2OL8O 2R73A 1D2UA 1LPJA 2C1SA 3JSQA 4ZCBA 3WYPA 5FQ7E 1HMRA 4Y59A 2AT6X 5HZ5A 3KFGA 4WFUA 3STKA 2I5VO 3BX7A 2X8FA 4KH8A 4KT5A 2IZIA 4TKJA 3ZW2A 5HWZA 1BSOA 3PQSA 3P6FA 4XMCA 3HOLA 3ELXA 3B2IA 4L3RA 2JN3A 1NQMA 4MVEA 4YBPA 3RE6A 1AQBA 1MVGA 1YWCA 2RTIB 3FW5A 3NR3A 4U8UN 2IZDB 3OE3A 4RUNA 2X34A 4IB6A 2IZHB 3VG4A 1EALA 1N0SA 2KTDA 2R74A 1PBOA 2X56A 2FHNX 4EXZA 1CBQA 1SWDA 3ZQ3A 2HLVA 2GTLN 3CBSA 1GT5A 3RDSA 3TZSA 1SWBA 3APUA 5LKFA 5C0NA 5LKEA 1KT7A 1AVDA 1KZXA 3ZWEA 4BCSA 1GKAA 1QY0A 1SREA 4NW4A 4WFVA 3CQRA 5D4AA 2FKJA 4YH0A 3VHHA 4GNWA 2OY7A 4QZTA 2OY8A 1FTPA 1NC9A 1SWFA 1MK5A 2N93A 3EBKA 3CR6A 1GGLA 3CKFA 3HOEA 4IAWA 1SWTA 1GT1A 1LNMA 1VWNB 1SWSA 2AT5X 1RXHA 1SWRA 3VG6A 2G8CO 4I9SA 4Z27A 3MM0A 5F1EA 1X8NA 1SLGB 1LCWA 2JU7A 2RTBB 1STRB 2RTRB 3NP1A 1I9HA 4QNIA 3RE5A 3UAQA 1BJ7A 4IMNA 5JD2A 3PEDA 4CDCA 4ZFXA 3B2HA 3HWDA 4EKVA 4GNYA 1ACDA 1Y9LA 1HY2A 1PM1X 4QGXA 3S5VA 1PBYA 2KD2A 1TXLA 1PMPA 1QG5A 4O4XA 2BS6A 2L67A 5CE4A 2KTSA 3S60A 1LIDA 2BLGA 4CPFA 3T6FA 1FDQA 1SLEB 2HZRA 4XMHA 1ZRYA 3RDUA 1X8UA 2M4LA 3APXA 4LKPA 3CQNA 3U03A 1OEEA 1QABE 1RXKA 1ZNLA 4GH7A 1FENA 1D3SA 1O1UA 3P02A 2WR6A 1ICNA 1TOUA 5F6ZA 2ZSCA 3WBGA 1QY1A 4BGFA 1CJ5A 2HYSA 4YGGA 2C4IA 3ZW1B 3F8AA 1SWQA 3NX2A 2G79A 1KL3A 1HBPA 1LFOA 4NLIA 1ZNKA 1SWKA 3FEKA 1Y9TA 5D8JA 3WZNA 2KW1A 4XMDA 4CDEA 2FHLA 1NDJA 3NBXX 4IB9A 4Y0QA 3VU1A 4ZGUA 1VWKB 1RBPA 4O3WA 3MVFA 2O62A 3RBYA
chains in the Genus database with same CATH topology
2L68A 2OFRX 1YWAA 3PH5A 4GZVA 4RUUA 2L9CA 4XMEA 1ML7A 2G7BA 2OZQA 1LF7A 4ZHFA 2K23A 2X8SA 3HTYA 5LJEA 3AKNA 4OS0A 3VE2A 4QAEA 3K3LA 1NGLA 2A3FX 1VYFA 4QYPA 5HA1A 2F73A 4L1NA 4HPAA 1FEMA 5EEDA 5EPQA 1OBQA 5HZ9A 5LJDA 4WHIA 4EQAC 2POAA 5EDCA 1GKAB 2YG2A 4AZOA 5AQ6A 4O3YA 1MDCA 4YFQA 1S7DA 4OMWA 3WJGA 4EDEA 1X8PA 2AT0X 2A2UA 1SXUA 4R0BA 1TVQA 2CM4A 4AW8A 4OS8A 2WSJA 2QO6A 4ZJ0A 4AZNA 1IIUA 3FLLA 3TF6A 1XCAA 4FBVA 3P6CA 4ID2A 3D97A 1KZWA 2P8GA 4JGLA 4KIIA 4O3ZA 4BOEA 1KT3A 1CBRA 1ICMA 1E02A 2CBRA 3TGBA 1L6MA 4NP1A 2RCQA 4CK4A 4GRJA 1GXAA 3IFBA 4NYQA 1EUOA 3PECA 4COTA 5HTEA 3EBWA 3KFIA 3ZUOA 5EDBA 5FQ6E 1QFVA 3VG3A 1BEBA 3STMX 1FE3A 1JBHA 3FA9A 5D48A 5L8IA 1GT4A 4QGWA 1EIOA 2CBSA 2FTBA 3T1DA 4AYHA 1I4UA 5LJHA 1GX8A 2FRSA 5LJGA 1A57A 4HPBA 4AZRA 1G74A 2MHDA 3C78X 2RD7C 4QYNA 1JYJA 2CM9A 1X89A 2DM5A 3WJDA 4KC8A 3F6ZB 3B2KA 3BU1A 1KXOA 3FR4A 4AZPA 5L8NA 3KFHA 1E06A 1R0UA 1DV9A 2A0AA 2EU7X 2QO5A 1DZMA 2LFOA 2R56A 2X8TA 3KZAA 3TGAA 3FA6A 5K06A 2LBAA 1S44A 2AT8X 3HWGA 4IBAA 3UEUA 1BRQA 4U9CA 1A2DA 2FR2A 2PY1A 1U0XA 4BQUA 1X8OA 1O1VA 4ZHCA 2NNEA 4K19A 1SY1A 3BX8A 5JR8A 4I9RA 4A8ZA 2XSTA 1KGLA 1SY3A 2OFMX 4ZHHA 4MIRA 3V8UA 1CBSA 5FFHA 2JU8A 1E5PA 5D45A 1O8VA 4ALOA 1SXXA 4YBUA 1B0OA 4ORXA 3P6HA 3N91A 4QQ1A 2MM3A 5HCCC 5BVQA 4GK9A 4IAXA 4XMGA 2Q4NA 4MVIA 1EQDA 2G78A 3HK1A 5KHPA 2WQ9A 2FWVA 4GE1A 4ML7B 1T8VA 4FBRA 2GJ5A 3HWEA 2E4JA 3FA8A 4ODDA 1HN2A 3WJEA 4CV7A 5DPQA 2RA6A 4I6SA 3I0AA 1IFBA 1I06A 2WUTA 2QO4A 4YMYA 3EYCA 2ASNX 4Y0PA 1OBPA 3APWA 1AVGI 3P6DA 4YKMA 1SA8A 3VE1A 1BRPA 3GE2A 3JQOA 1G5WA 3BS2A 1KQXA 3B2LA 2AH7X 4QGVA 3C76X 2AKQA 1KT4A 3D95A 2OVDA 1BSQA 2Q9SA 1LIEA 3AKMA 4O49A 2K62A 5HZ8A 4ORSA 2Q2PA 4A1YA 5DG4A 3H3IA 5H9AA 4A1HA 3UEWA 2WQAE 1CRBA 2FR3A 2QOSC 1SXWA 2XKLA 5HZ6A 1LKEA 2OVSA 4GETA 1YIVA 2W2FA 3LHNA 3C77X 5HTDA 4LKTA 4O4UA 2WEXA 1MUPA 4N7DA 2X45A 4TKBA 5FQ8E 2JMBA 3HWFA 4M6SA 1B56A 3OBLA 3F9DA 1UREA 5LJBA 1GM6A 2GTFX 3NQKA 1QFTA 1ZNGA 1G7NA 3B2JA 3MX7A 3WOVA 1I04A 4PJ2A 1P6PA 1VYGA 1YWBA 1HMTA 1FELA 2FS6A 4ZHDA 1SY2A 5B29A 3O22A 1X71A 2RCTA 2MWHA 1YWDA 2WWPA 4LQZA 3WXQA 4IB8A 1VPRA 5BVSA 4ARHA 3NADA 3P6EA 3S5XA 3O19A 4UU2A 2MJIA 4AZQA 4YFRA 1E00A 1MX7A 3FR2A 4INNA 1A3YA 1NP4A 4GKCA 1JYDA 2AT3X 4O4OA 3BSZE 4HFOA 4YGHA 3ZZVA 1QY2A 3I17A 5BVTA 4FBOA 1DZKA 1QWDA 2Z4IA 3EM0A 5D47A 4ZGFA 4YDBA 3BU9A 2NP1A 4HWMA 2Q39A 2JW1A 3O2YA 5HCDC 3BDRA 4I3CA 5L8OA 3FEPA 2IFBA 2AMMX 2CZTA 4KCAA 3MBTA 4YDAA 2F09A 1X8QA 3PQUA 3FA7A 2FT9A 4M7MA 3ZW1A 1U18A 3FIQA 1ZNDA 1A18A 4O3XB 3S26A 3FW4A 4IB7A 1HMSA 4A60A 3Q6LA 4UU3A 4Y0RA 1YP7A 3FENA 5H9NA 2ANSA 3U0DA 1KOIA 1H91A 4I95A 1S2PA 4YKOA 5FENA 1LIBA 4QZUA 2ACPX 4U8UM 1IW2A 1EI5A 2HMBA 2LB6A 5FAZA 4DQ4A 1OPAA 1JV4A 2ALLX 1YUPA 3STNA 2CZUA 4O9SA 3VG2A 2Q2MA 3VG5A 5AEOA 4YFPA 5CYBA 3WVMA 3GAQA 3UEVA 4O4SA 2KT4B 1ALBA 1JIWI 1LIFA 5B27A 1LICA 1YP6A 2FS7A 2A2GA 3ZUIA 2GTLM 4ALBA 3FR5A 5LJKA 1ZNEA 5H8TA 1EXSA 5IO5A 1DZJA 3NX1A 1TW4A 3QKGA 4U8UO 4U3QA 5LJCA 1BWYA 2JOZA 1AB0A 4ON1A 1EW3A 4I3DA 4OMXA 3UEXA 4QRLA 4CSBA 4NYRA 3SOTA 3EMMA 4FGIB 3IA8A 3ELZA 4ES7A 1BM5A 1B8EA 2LA7A 5IO7A 4MVKA 2AL0X 2BS5A 2GTLO 2YMSA 3PPTA 3KFFA 1U17A 3BLGA 1SY0A 1Z24A 5F7GA 2W2AA 2Z4HA 3G7XA 1GT3A 1HBQA 3RSWA 3RKGA 3BRNA 1JZUA 3ZW0A 4TNNA 5H9KA 3OD9A 1ADLA 1ERBA 1EIIA 2ZAGA 1OBUA 1BSYA 3FMZA 3FYFA 3JS1A 4HPDA 3P6GA 4IMOA 1TOWA 4IABA 1MX8A 1HQPA 4EEJA 1KT5A 3E3CA 2X46A 4WBKA 5HBSA 2A13A 4BVMA 4YCEA 3DTQA 5BYPA 1DZPA 1EPAA 4AZMA 1ERXA 5IO6A 5EEEA 1DC9A 4MISA 5KICA 3APVA 3NQ3A 4PSQA 4TKHA 3OJYC 4EFGA 5H9LA 3NPOA 4NNSA 1OEJA 4NNTA 1KT6A 4ORUA 3D4RA 1IFCA 4LZUA 5F58A 4TJZA 3CWKA 1QQSA 1G85A 3D96A 2BT9A 2ZAIA 4OS3A 1SMPI 1PEEA 3WJCA 3KQ0A 4TLJA 4FQBB 4NLJA 1IKJA 1CBIA 4Y0SA 5HZQA 3ZI8A 4ZHGA 5KIDA 5HA0A 4ORYA 3P24A 1GX9A 2LBVA 1NP1A 3TGCA 3U9PC 1RLBE 3WJBA 1DFVA 2RN4A 4D6BA 1JJJA 2HNXA 1JJXA 4XMFA 4ZR2A 4ZH9A 2W2BA 1EPBA 2BHVA 1ZNHA 4GDZA 5EZ2A 3SAOA 4ORWA 1I05A 1B4MA 3CBCA 5HCEC 2OVAA 4KC7A 5AJCA 3PH6A 3L4RA 4HPCA 1IKEA 1KQWA 2NNQA 2RQ0A 4LZVA 3BY0A 4GU8A 1T68X 4ZH6A 1BBPA 2FLJA 1OEKA 3FELA 3CMPA 4I3BA 5F6BA 1SXYA 3LV4A 3RWXA 2WEWA 2ACOA 1XKIA 2LKKA 4TQ2A 4N7CA 2L5PA 2QMIA 3PP6A 3VPJE 3NQ9A 3ZW0B 5AJBA 2QM9A 3VG7A 2OVEA 4MVLA 2NNDA 4YGZA 1UZ2X 1DF3A 2GC9A 2HZQA 3DSZA 4YCHA 1BLRA 3RZYA 4D6AA 3WJFA 2JU3A 1AELA 5HAEA 2MO5A 1T0VA 1OPBA 4ORRA 2R73A 1D2UA 1LPJA 3JSQA 4ZCBA 5FQ7E 1HMRA 2AT6X 5HZ5A 3KFGA 4WFUA 3STKA 3BX7A 4KT5A 2X8FA 4KH8A 4TKJA 3ZW2A 5HWZA 1BSOA 3PQSA 3P6FA 4XMCA 3HOLA 3ELXA 3B2IA 4L3RA 2JN3A 4MVEA 4YBPA 1AQBA 1MVGA 1YWCA 3FW5A 3NR3A 4U8UN 3OE3A 4RUNA 4IB6A 1EALA 3VG4A 1N0SA 2KTDA 2R74A 1PBOA 4EXZA 1CBQA 3ZQ3A 2HLVA 2GTLN 3CBSA 1GT5A 3TZSA 3APUA 5LKFA 5C0NA 5LKEA 1KT7A 1KZXA 3ZWEA 1GKAA 1QY0A 4NW4A 4WFVA 5D4AA 3CQRA 4YH0A 4GNWA 4QZTA 1FTPA 3HOEA 2N93A 3EBKA 4IAWA 3CR6A 1GGLA 1GT1A 1LNMA 2AT5X 3VG6A 4I9SA 5F1EA 4ZFXA 1X8NA 2JU7A 3NP1A 4QNIA 4DQ3A 3UAQA 1BJ7A 4IMNA 3PEDA 3B2HA 3HWDA 4GNYA 1ACDA 1Y9LA 1PM1X 3S5VA 4QGXA 2KD2A 1TXLA 1PMPA 1QG5A 4O4XA 2BS6A 2L67A 5CE4A 2KTSA 3S60A 1LIDA 2BLGA 1FDQA 4XMHA 2HZRA 1ZRYA 1X8UA 2M4LA 3APXA 4LKPA 3CQNA 3U03A 1OEEA 1QABE 1ZNLA 4GH7A 1FENA 1D3SA 1O1UA 3P02A 2WR6A 1ICNA 1TOUA 5F6ZA 3WBGA 1QY1A 1CJ5A 2HYSA 4YGGA 3ZW1B 3F8AA 3NX2A 2G79A 1LFOA 1HBPA 4NLIA 1ZNKA 3FEKA 1Y9TA 5D8JA 2KW1A 4XMDA 4IB9A 3NBXX 3VU1A 4ZGUA 4Y0QA 1RBPA 4O3WA 3MVFA 2O62A 3RBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L68 A;  2OFR X;  1YWA A;  3PH5 A;  4RUU A;  2L9C A;  4XME A;  1ML7 A;  2G7B A;  2OZQ A;  1LF7 A;  4ZHF A;  2K23 A;  5LJE A;  3AKN A;  4OS0 A;  4QAE A;  3K3L A;  1NGL A;  2A3F X;  1VYF A;  4QYP A;  5HA1 A;  2F73 A;  4HPA A;  1FEM A;  5EED A;  5EPQ A;  1OBQ A;  5HZ9 A;  5LJD A;  2POA A;  5EDC A;  1GKA B;  2YG2 A;  4AZO A;  5AQ6 A;  1MDC A;  4YFQ A;  1S7D A;  4OMW A;  3WJG A;  4EDE A;  1X8P A;  2AT0 X;  2A2U A;  1SXU A;  4R0B A;  1TVQ A;  2CM4 A;  4AW8 A;  4OS8 A;  2WSJ A;  2QO6 A;  4ZJ0 A;  4AZN A;  1IIU A;  3FLL A;  3TF6 A;  1XCA A;  3P6C A;  3D97 A;  1KZW A;  2P8G A;  4KII A;  4BOE A;  1KT3 A;  1CBR A;  1ICM A;  1E02 A;  2CBR A;  3TGB A;  1L6M A;  4NP1 A;  2RCQ A;  4CK4 A;  4GRJ A;  1GXA A;  3IFB A;  4NYQ A;  1EUO A;  3PEC A;  5HTE A;  3EBW A;  3KFI A;  3ZUO A;  5EDB A;  1QFV A;  3VG3 A;  1BEB A;  3STM X;  1FE3 A;  1JBH A;  3FA9 A;  5D48 A;  5L8I A;  1GT4 A;  4QGW A;  1EIO A;  2CBS A;  2FTB A;  3T1D A;  4AYH A;  1I4U A;  5LJH A;  1GX8 A;  2FRS A;  5LJG A;  1A57 A;  4HPB A;  4AZR A;  1G74 A;  3C78 X;  4QYN A;  2RD7 C;  1JYJ A;  2CM9 A;  1X89 A;  2DM5 A;  3WJD A;  3B2K A;  3BU1 A;  1KXO A;  3FR4 A;  4AZP A;  5L8N A;  3KFH A;  1E06 A;  1R0U A;  1DV9 A;  2A0A A;  2EU7 X;  2QO5 A;  1DZM A;  2LFO A;  2R56 A;  3KZA A;  5K06 A;  3TGA A;  3FA6 A;  2LBA A;  1S44 A;  2AT8 X;  3HWG A;  4IBA A;  3UEU A;  1BRQ A;  1A2D A;  2FR2 A;  2PY1 A;  1U0X A;  4BQU A;  1X8O A;  1O1V A;  4ZHC A;  2NNE A;  4K19 A;  1SY1 A;  3BX8 A;  5JR8 A;  4I9R A;  4A8Z A;  2XST A;  1KGL A;  1SY3 A;  2OFM X;  4ZHH A;  1CBS A;  5FFH A;  2JU8 A;  1E5P A;  5D45 A;  1O8V A;  4ALO A;  1SXX A;  4YBU A;  1B0O A;  4ORX A;  3P6H A;  2MM3 A;  5HCC C;  5BVQ A;  4IAX A;  4XMG A;  2Q4N A;  4MVI A;  1EQD A;  2G78 A;  3HK1 A;  5KHP A;  2WQ9 A;  2FWV A;  4GE1 A;  1T8V A;  2GJ5 A;  3HWE A;  2E4J A;  3FA8 A;  4ODD A;  1HN2 A;  3WJE A;  5DPQ A;  2RA6 A;  3I0A A;  1IFB A;  1I06 A;  2WUT A;  2QO4 A;  4YMY A;  3EYC A;  2ASN X;  4Y0P A;  1OBP A;  3APW A;  1AVG I;  3P6D A;  4YKM A;  1SA8 A;  1BRP A;  1G5W A;  3BS2 A;  1KQX A;  3B2L A;  2AH7 X;  4QGV A;  3C76 X;  2AKQ A;  1KT4 A;  3D95 A;  2OVD A;  1BSQ A;  2Q9S A;  1LIE A;  3AKM A;  5HZ8 A;  2K62 A;  4ORS A;  2Q2P A;  4A1Y A;  5DG4 A;  5H9A A;  4A1H A;  3UEW A;  2WQA E;  1CRB A;  2FR3 A;  2QOS C;  1SXW A;  2XKL A;  5HZ6 A;  1LKE A;  4GET A;  1YIV A;  2W2F A;  3C77 X;  5HTD A;  4LKT A;  2WEX A;  1MUP A;  4N7D A;  2X45 A;  4TKB A;  3HWF A;  4M6S A;  1B56 A;  3F9D A;  1URE A;  5LJB A;  1GM6 A;  2GTF X;  1QFT A;  1ZNG A;  1G7N A;  3B2J A;  1I04 A;  1P6P A;  1VYG A;  1YWB A;  1HMT A;  1FEL A;  2FS6 A;  4ZHD A;  1SY2 A;  5B29 A;  3O22 A;  1X71 A;  2RCT A;  1YWD A;  2WWP A;  3WXQ A;  4IB8 A;  1VPR A;  5BVS A;  4ARH A;  3NAD A;  3P6E A;  3O19 A;  4UU2 A;  2MJI A;  4AZQ A;  4YFR A;  1E00 A;  1MX7 A;  3FR2 A;  1A3Y A;  1NP4 A;  4GKC A;  1JYD A;  2AT3 X;  3BSZ E;  4HFO A;  4YGH A;  1QY2 A;  3I17 A;  5BVT A;  1DZK A;  1QWD A;  5D47 A;  3EM0 A;  4YDB A;  3BU9 A;  2NP1 A;  2Q39 A;  3O2Y A;  5HCD C;  3BDR A;  4I3C A;  5L8O A;  3FEP A;  2IFB A;  2AMM X;  2CZT A;  3MBT A;  4YDA A;  1X8Q A;  3FA7 A;  2FT9 A;  4M7M A;  1U18 A;  3FIQ A;  1ZND A;  1A18 A;  3S26 A;  3FW4 A;  4IB7 A;  1HMS A;  4A60 A;  3Q6L A;  4UU3 A;  4Y0R A;  1YP7 A;  3FEN A;  5H9N A;  2ANS A;  3U0D A;  1KOI A;  1H91 A;  4YKO A;  1S2P A;  5FEN A;  1LIB A;  4QZU A;  2ACP X;  1IW2 A;  2HMB A;  2LB6 A;  5FAZ A;  4DQ4 A;  1OPA A;  1JV4 A;  2ALL X;  1YUP A;  3STN A;  2CZU A;  4O9S A;  3VG2 A;  2Q2M A;  3VG5 A;  4YFP A;  3WVM A;  3GAQ A;  3UEV A;  2KT4 B;  1ALB A;  1LIF A;  5B27 A;  1LIC A;  1YP6 A;  2FS7 A;  2A2G A;  3ZUI A;  4ALB A;  3FR5 A;  5LJK A;  1ZNE A;  5H8T A;  1EXS A;  5IO5 A;  1DZJ A;  3NX1 A;  1TW4 A;  3QKG A;  5LJC A;  1BWY A;  2JOZ A;  1AB0 A;  1EW3 A;  4I3D A;  4OMX A;  3UEX A;  4NYR A;  3EMM A;  3IA8 A;  3ELZ A;  4ES7 A;  1BM5 A;  1B8E A;  5IO7 A;  4MVK A;  2AL0 X;  3PPT A;  3KFF A;  1U17 A;  3BLG A;  1SY0 A;  1Z24 A;  5F7G A;  2W2A A;  3G7X A;  1GT3 A;  1HBQ A;  3RSW A;  3BRN A;  1JZU A;  4TNN A;  5H9K A;  1ADL A;  1ERB A;  1EII A;  1OBU A;  1BSY A;  3FMZ A;  3JS1 A;  4HPD A;  3P6G A;  4IMO A;  1TOW A;  1MX8 A;  1HQP A;  4EEJ A;  1KT5 A;  4WBK A;  2X46 A;  5HBS A;  2A13 A;  4BVM A;  4YCE A;  3DTQ A;  1DZP A;  1EPA A;  4AZM A;  1ERX A;  5IO6 A;  5EEE A;  1DC9 A;  5KIC A;  3APV A;  3NQ3 A;  4PSQ A;  4TKH A;  3OJY C;  4EFG A;  5H9L A;  3NPO A;  4NNS A;  1OEJ A;  4NNT A;  1KT6 A;  4ORU A;  1IFC A;  4LZU A;  5F58 A;  4TJZ A;  3CWK A;  1QQS A;  1G85 A;  3D96 A;  4OS3 A;  1PEE A;  3WJC A;  3KQ0 A;  4TLJ A;  4NLJ A;  1IKJ A;  1CBI A;  4Y0S A;  5HZQ A;  4ZHG A;  5KID A;  5HA0 A;  4ORY A;  1GX9 A;  2LBV A;  1NP1 A;  3TGC A;  3U9P C;  1RLB E;  3WJB A;  1DFV A;  1JJJ A;  4D6B A;  2HNX A;  1JJX A;  4XMF A;  4ZR2 A;  4ZH9 A;  2W2B A;  1EPB A;  1ZNH A;  5EZ2 A;  3SAO A;  4ORW A;  1I05 A;  1B4M A;  3CBC A;  5HCE C;  2OVA A;  3PH6 A;  3L4R A;  4HPC A;  1IKE A;  1KQW A;  2NNQ A;  2RQ0 A;  4LZV A;  3BY0 A;  1T68 X;  4ZH6 A;  1BBP A;  2FLJ A;  1OEK A;  3FEL A;  3CMP A;  4I3B A;  5F6B A;  1SXY A;  2WEW A;  2ACO A;  1XKI A;  2LKK A;  4TQ2 A;  4N7C A;  2L5P A;  3PP6 A;  3NQ9 A;  3VG7 A;  2QM9 A;  2OVE A;  4MVL A;  2NND A;  4YGZ A;  1UZ2 X;  1DF3 A;  2GC9 A;  2HZQ A;  3DSZ A;  4YCH A;  1BLR A;  3RZY A;  4D6A A;  3WJF A;  2JU3 A;  1AEL A;  5HAE A;  2MO5 A;  1T0V A;  1OPB A;  4ORR A;  2R73 A;  1D2U A;  1LPJ A;  3JSQ A;  4ZCB A;  1HMR A;  2AT6 X;  5HZ5 A;  3KFG A;  4WFU A;  3STK A;  3BX7 A;  4TKJ A;  5HWZ A;  1BSO A;  4XMC A;  3P6F A;  3ELX A;  3B2I A;  4YBP A;  2JN3 A;  1AQB A;  1MVG A;  1YWC A;  3FW5 A;  3NR3 A;  4RUN A;  4IB6 A;  1EAL A;  3VG4 A;  1N0S A;  2KTD A;  2R74 A;  1PBO A;  4EXZ A;  1CBQ A;  3ZQ3 A;  2HLV A;  3CBS A;  3TZS A;  1GT5 A;  3APU A;  5LKF A;  5C0N A;  5LKE A;  1KT7 A;  1KZX A;  1GKA A;  1QY0 A;  4WFV A;  5D4A A;  3CQR A;  4YH0 A;  4GNW A;  4QZT A;  1FTP A;  2N93 A;  3EBK A;  4IAW A;  3CR6 A;  1GGL A;  1GT1 A;  1LNM A;  2AT5 X;  3VG6 A;  4I9S A;  5F1E A;  4ZFX A;  1X8N A;  2JU7 A;  3NP1 A;  4DQ3 A;  1BJ7 A;  4IMN A;  3PED A;  3B2H A;  3HWD A;  4GNY A;  1ACD A;  1PM1 X;  4QGX A;  1TXL A;  1PMP A;  1QG5 A;  2L67 A;  5CE4 A;  1LID A;  2BLG A;  1FDQ A;  4XMH A;  2HZR A;  1ZRY A;  1X8U A;  3APX A;  4LKP A;  3CQN A;  3U03 A;  1OEE A;  1QAB E;  1ZNL A;  4GH7 A;  1FEN A;  1D3S A;  1O1U A;  2WR6 A;  1ICN A;  1TOU A;  5F6Z A;  3WBG A;  1QY1 A;  1CJ5 A;  2HYS A;  4YGG A;  3F8A A;  3NX2 A;  2G79 A;  1LFO A;  1HBP A;  4NLI A;  1ZNK A;  3FEK A;  5D8J A;  4XMD A;  4IB9 A;  4ZGU A;  4Y0Q A;  1RBP A;  3MVF A;  2O62 A; 
#chains in the Genus database with same CATH topology
 2L68 A;  2OFR X;  1YWA A;  2CAM A;  3PH5 A;  4GZV A;  4RUU A;  2GH7 A;  2L9C A;  1UYO X;  1ML7 A;  2G7B A;  2OZQ A;  1LF7 A;  4XME A;  1MEP A;  2K23 A;  3PDF A;  2X8S A;  3HTY A;  4ZHF A;  5LJE A;  3AKN A;  3KVN A;  4OS0 A;  3VE2 A;  1LDQ A;  1VWE B;  1NGL A;  2A3F X;  3K3L A;  4QAE A;  1VYF A;  2UZ2 A;  1MM9 A;  4QYP A;  1KL5 A;  5HA1 A;  1VWI B;  2F73 A;  4L1N A;  4HPA A;  2FKG A;  1FEM A;  5EED A;  5EPQ A;  1OBQ A;  3RDX A;  2G5L A;  5HZ9 A;  1W6F A;  1VWA B;  4WHI A;  2POA A;  2IZJ A;  1SWC A;  5LJD A;  4EQA C;  1N9M A;  5EDC A;  1GKA B;  2YG2 A;  4AZO A;  5AQ6 A;  3SZH A;  1SLF B;  4O3Y A;  1MDC A;  4YFQ A;  1S7D A;  4OMW A;  2C1Q A;  3WJG A;  4EDE A;  1X8P A;  2AT0 X;  1SWJ A;  1SXU A;  2A2U A;  4R0B A;  1TVQ A;  2CM4 A;  2IZA A;  4AW8 A;  4OS8 A;  2WSJ A;  4BX6 A;  2QO6 A;  4ZJ0 A;  4AZN A;  1IIU A;  2QCB A;  2RTJ A;  3FLL A;  2RTE B;  1SLD B;  3TF6 A;  1VWR B;  1XCA A;  1GX3 A;  4FBV A;  3P6C A;  4ID2 A;  3D97 A;  1KZW A;  5B2A O;  1IJ8 A;  1STS B;  2P8G A;  4JGL A;  4KII A;  4O3Z A;  2IZC B;  4BOE A;  1KT3 A;  1CBR A;  2IZL B;  1ICM A;  1E02 A;  2CBR A;  3TGB A;  2F01 A;  1L6M A;  4NP1 A;  3T2X A;  2RCQ A;  5K67 A;  4CK4 A;  1VWP B;  4GRJ A;  1GXA A;  3IFB A;  4NYQ A;  1EUO A;  4NV8 A;  3PEC A;  4COT A;  2IZB A;  5HTE A;  3EBW A;  3KFI A;  3ZUO A;  2OF8 A;  5EDB A;  5FQ6 E;  1QFV A;  3VG3 A;  1BEB A;  3STM X;  2HKD A;  1FE3 A;  1W5R A;  4NV7 A;  4C5P A;  4Z2O A;  1JBH A;  3FA9 A;  5D48 A;  5L8I A;  1GT4 A;  4QGW A;  1SWG A;  4GJS A;  1EIO A;  2CBS A;  2FTB A;  3Q34 A;  1VWB B;  3T1D A;  3X00 A;  1I4U A;  5B5G A;  2IZK A;  2DJG A;  4AYH A;  5LJH A;  1GX8 A;  2FRS A;  5LJG A;  1VWL B;  1A57 A;  4HPB A;  3SZJ A;  4AZR A;  1G74 A;  1VWH B;  4YVB A;  1SRI A;  2Y3E A;  2MHD A;  3C78 X;  2RD7 C;  4QYN A;  1JYJ A;  2CM9 A;  1X89 A;  2A5B A;  2DM5 A;  3LTW A;  4KC8 A;  3WJD A;  3F6Z B;  2RTL A;  3B2K A;  3BU1 A;  1KXO A;  3FR4 A;  1NBX A;  4GD9 A;  4AZP A;  5L8N A;  3KFH A;  1SRH A;  5HTD A;  1E06 A;  4MEE A;  1R0U A;  1DV9 A;  2A0A A;  2EU7 X;  2QO5 A;  1DZM A;  2LFO A;  2R56 A;  2X8T A;  3KZA A;  4OEM A;  3FA6 A;  3RDQ A;  3RY1 A;  3TGA A;  5B11 O;  3WZO A;  5K06 A;  2LBA A;  1S44 A;  1VWM B;  2AT8 X;  3HWG A;  4IBA A;  2VFB A;  3UEU A;  1BRQ A;  1MOY A;  1NQN A;  4U9C A;  1A2D A;  2FR2 A;  2PY1 A;  1U0X A;  4BQU A;  4CPH A;  1Y0G A;  1X8O A;  1O1V A;  2RTQ B;  4ZHC A;  2NNE A;  4K19 A;  1SY1 A;  1N9Y A;  3BX8 A;  5JR8 A;  4I9R A;  3SLJ A;  4A8Z A;  2XST A;  2OY1 O;  1JJU A;  1KGL A;  1SY3 A;  2OFM X;  4ZHH A;  4GJV A;  1WUB A;  2I5Z O;  4MIR A;  3FDC A;  5K68 A;  3V8U A;  1CBS A;  1SWL A;  2A8G A;  5FFH A;  4IRW A;  4Z2P A;  2JU8 A;  1E5P A;  5D45 A;  1O8V A;  2RTO B;  4ALO A;  1SXX A;  4YBU A;  1B0O A;  4ORX A;  4OEL A;  3P6H A;  1SWH A;  5B3M O;  3N91 A;  4QQ1 A;  3VHM A;  2MM3 A;  5HCC C;  4CDF A;  5BVQ A;  4GK9 A;  4IAX A;  4XMG A;  2Q4N A;  5B5F A;  4MVI A;  1EQD A;  2G78 A;  3HK1 A;  5KHP A;  2WQ9 A;  2FWV A;  1Y52 X;  4GE1 A;  4ML7 B;  3T2W A;  2RTG B;  1T8V A;  4FBR A;  2GJ5 A;  3HWE A;  2DJF A;  2E4J A;  3FA8 A;  4BX7 B;  4ODD A;  1HN2 A;  3WJE A;  4CV7 A;  5DPQ A;  2RA6 A;  4I6S A;  3I0A A;  1IFB A;  1I06 A;  2WUT A;  1SWE A;  2QO4 A;  3EYC A;  4YMY A;  2IZF B;  4DCB A;  1SWU A;  2ASN X;  4Y0P A;  1OBP A;  3APW A;  1AVG I;  3P6D A;  4DNE A;  4YKM A;  1SA8 A;  3VE1 A;  1BRP A;  3GE2 A;  3JQO A;  4GUZ A;  1G5W A;  3BS2 A;  1KQX A;  4B55 A;  3B2L A;  2AH7 X;  4QGV A;  3C76 X;  2AKQ A;  1KT4 A;  3D95 A;  1SWO A;  2OVD A;  1BSQ A;  2Q9S A;  2RTH B;  3WYQ A;  1LIE A;  3AKM A;  4O49 A;  2K62 A;  5HZ8 A;  1OSP O;  2RTK A;  4ORS A;  2Q2P A;  4A1Y A;  5DG4 A;  3H3I A;  5H9A A;  4A1H A;  3UEW A;  2WQA E;  1CRB A;  2FR3 A;  2QOS C;  1SXW A;  2XKL A;  1VWO B;  1K3B A;  1LKE A;  5HZ6 A;  1RXJ A;  1VWQ B;  2OVS A;  2RTF B;  4GET A;  1YIV A;  2W2F A;  3LHN A;  1JMX A;  3C77 X;  4LKT A;  5CHK A;  4O4U A;  2WEX A;  1LCZ A;  1MUP A;  4N7D A;  2X45 A;  1PTS A;  4TKB A;  5FQ8 E;  2JMB A;  3HWF A;  4M6S A;  1B56 A;  3OBL A;  3F9D A;  2VDF A;  1URE A;  2AVI A;  5LJB A;  3VHI A;  1GM6 A;  1VWJ B;  5L3Y A;  2GTF X;  3NQK A;  4CPH B;  1QFT A;  1ZNG A;  1G7N A;  3B2J A;  3MX7 A;  3WOV A;  1I04 A;  2OFA A;  2RTC B;  4PJ2 A;  5IRW A;  1P6P A;  1VYG A;  1SWA A;  1YWB A;  1HMT A;  1FEL A;  2FS6 A;  4ZHD A;  1SY2 A;  5B29 A;  3O22 A;  1X71 A;  3SZI A;  2RCT A;  2MWH A;  1YWD A;  2WWP A;  1HXL A;  4LQZ A;  1VWC B;  3WXQ A;  4IB8 A;  1VPR A;  5BVS A;  4ARH A;  1SWP A;  3NAD A;  1RSU B;  3P6E A;  3S5X A;  3O19 A;  4UU2 A;  2MJI A;  4AZQ A;  4YFR A;  1E00 A;  1MX7 A;  3FR2 A;  4INN A;  1A3Y A;  1NP4 A;  1LDO A;  4GKC A;  1JYD A;  2AT3 X;  4O4O A;  3BSZ E;  4HFO A;  3SLO A;  4YGH A;  3T6L A;  3ZZV A;  1QY2 A;  3I17 A;  2MF6 A;  4JHQ A;  5BVT A;  4FBO A;  1DZK A;  1QWD A;  2Z4I A;  1LEL A;  3EM0 A;  3EW1 A;  1N7Y A;  4YDB A;  5D47 A;  3BU9 A;  2NP1 A;  2BC3 A;  4HWM A;  2Q39 A;  2JW1 A;  3O2Y A;  5HCD C;  3BDR A;  4I3C A;  1VWF B;  5L8O A;  3FEP A;  2IFB A;  4JNJ A;  2AMM X;  2CZT A;  4KCA A;  3MBT A;  1HQQ A;  1SRF A;  2PI3 O;  4YDA A;  1WBI A;  2F09 A;  1VWD B;  1X8Q A;  3PQU A;  3FA7 A;  2WPU A;  2FT9 A;  4M7M A;  1N43 A;  3ZW1 A;  4GGZ A;  1U18 A;  3QQ2 A;  3FIQ A;  1ZND A;  3RDM A;  1A18 A;  4O3X B;  3S26 A;  3FW4 A;  2RTN B;  4IB7 A;  1HMS A;  5B10 O;  3RDO A;  4A60 A;  4CDD A;  3Q6L A;  4UU3 A;  4Y0R A;  1YP7 A;  1I78 A;  3FEN A;  3HPE A;  5H9N A;  2ANS A;  3WZP A;  3U0D A;  1KOI A;  1H91 A;  2Y32 A;  1S2P A;  4GDA A;  4I95 A;  4YKO A;  4Z28 A;  5FEN A;  4Z2V A;  1LIB A;  2BSZ A;  4QZU A;  2ACP X;  2OF9 A;  4U8U M;  1IW2 A;  1EI5 A;  2HMB A;  2LB6 A;  4GGR A;  2RTM A;  5FAZ A;  4DQ4 A;  1OPA A;  1JV4 A;  2ALL X;  1YUP A;  3STN A;  1VYO A;  2CZU A;  4O9S A;  2Q2M A;  3VG2 A;  3VG5 A;  4YFP A;  5CYB A;  5AEO A;  3WVM A;  1KFF A;  3GAQ A;  3UEV A;  4O4S A;  1N4J A;  2KT4 B;  1ALB A;  1JIW I;  1LIF A;  5B27 A;  1LIC A;  1YP6 A;  3SLT A;  2FS7 A;  2A2G A;  3ZUI A;  2X55 A;  2GTL M;  2X4M A;  4ALB A;  3FR5 A;  5LJK A;  1ZNE A;  5H8T A;  1EXS A;  5IO5 A;  1DZJ A;  3NX1 A;  1TW4 A;  3QKG A;  5CSE A;  4U8U O;  1E2T A;  4U3Q A;  4BX5 A;  4BX6 B;  2JOZ A;  5LJC A;  1BWY A;  1AB0 A;  4ON1 A;  1KL4 A;  1EW3 A;  1LCV A;  4I3D A;  4OMX A;  3UEX A;  4QRL A;  4CSB A;  4NYR A;  3SOT A;  3EMM A;  2UYW A;  4FGI B;  3IA8 A;  3ELZ A;  4ES7 A;  1BM5 A;  1B8E A;  2LA7 A;  5IO7 A;  4MVK A;  2AL0 X;  2BS5 A;  5IRA A;  2GTL O;  2YMS A;  3PPT A;  3KFF A;  1U17 A;  3BLG A;  2RTA A;  1SY0 A;  1Z24 A;  5F7G A;  2JGS A;  4OKA A;  2AF5 A;  2W2A A;  2Z4H A;  1GT3 A;  1HBQ A;  3G7X A;  3RSW A;  3RKG A;  3BRN A;  4CPE A;  1JZU A;  3ZW0 A;  4TNN A;  2RTP B;  5H9K A;  2Y3F A;  1K24 A;  1ADL A;  2QOM A;  1ERB A;  3OD9 A;  1EII A;  2ZAG A;  1OBU A;  1BSY A;  3FMZ A;  3FYF A;  3JS1 A;  4HPD A;  3P6G A;  4IMO A;  4U46 A;  3D9W A;  1TOW A;  4IAB A;  1MX8 A;  1HQP A;  4EEJ A;  1KT5 A;  3E3C A;  1Y53 X;  2X46 A;  4WBK A;  2A13 A;  5HBS A;  4YCE A;  4BBO A;  2OY5 O;  4BVM A;  3DTQ A;  5BYP A;  4ZGF A;  1DZP A;  1EPA A;  4AZM A;  4BJ8 A;  1ERX A;  5IO6 A;  5EEE A;  1DC9 A;  4MIS A;  5KIC A;  3APV A;  3NQ3 A;  4PSQ A;  4TKH A;  1Y55 X;  3OJY C;  1DF8 A;  4EFG A;  5H9L A;  3NPO A;  4NNS A;  1OEJ A;  4NNT A;  1KT6 A;  4ORU A;  3D4R A;  1IFC A;  4LZU A;  5F58 A;  4TJZ A;  3CWK A;  1QQS A;  1G85 A;  1HXZ A;  1RAV A;  2BT9 A;  3D96 A;  3FID A;  4DQ3 A;  2ZAI A;  4OS3 A;  1LUQ A;  1SRJ A;  5IXG A;  1SMP I;  4I60 A;  1PEE A;  2OL6 O;  3WJC A;  5IRU A;  3KQ0 A;  3MG5 A;  4FQB B;  4GGT A;  1IKJ A;  3CKG A;  1CBI A;  4NLJ A;  4JO6 A;  4TLJ A;  2OYB O;  4Y0S A;  5HZQ A;  1STP A;  3ZI8 A;  4ZHG A;  5KID A;  3EW2 A;  5HA0 A;  3EC5 A;  4ORY A;  3P24 A;  1GX9 A;  5F2B A;  2LBV A;  3WZQ A;  1NP1 A;  3TGC A;  3U9P C;  1RLB E;  3WJB A;  1DFV A;  2RN4 A;  4D6B A;  1JJJ A;  2HNX A;  4BX5 B;  3AEH A;  1JJX A;  4XMF A;  4ZR2 A;  4ZH9 A;  2X32 A;  2W2B A;  1EPB A;  2BHV A;  1SWN A;  1ZNH A;  4GDZ A;  5EZ2 A;  3SAO A;  2IZG B;  4ORW A;  1I05 A;  3VGW A;  1B4M A;  3CBC A;  5HCE C;  2OVA A;  4KC7 A;  5AJC A;  1AVE A;  3PH6 A;  3L4R A;  4HPC A;  1IKE A;  1KQW A;  2NNQ A;  2RQ0 A;  2VFC A;  4LZV A;  3BY0 A;  1RST B;  4GU8 A;  1T68 X;  4ZH6 A;  4Z6J A;  1BBP A;  2A5C A;  1SRG A;  2FLJ A;  2OL7 A;  1OEK A;  3FEL A;  3CMP A;  4I3B A;  5F6B A;  1UYN X;  2FGS A;  4Y5D A;  1SXY A;  3LV4 A;  3RWX A;  2WEW A;  2ACO A;  1FJ1 E;  1XKI A;  2LKK A;  2RTD B;  1JQP A;  4N7C A;  2L5P A;  4TQ2 A;  2QMI A;  3PP6 A;  3VPJ E;  3NQ9 A;  3ZW0 B;  5AJB A;  2QM9 A;  3VG7 A;  1JMZ A;  2OVE A;  3PK2 A;  2NND A;  4MVL A;  4YGZ A;  1UZ2 X;  1W4T A;  1DF3 A;  2GC9 A;  4CPI A;  2HZQ A;  3DSZ A;  4YCH A;  2OFB A;  1BLR A;  2IZE B;  3RZY A;  3WJF A;  4D6A A;  2JU3 A;  1AEL A;  5HAE A;  2MO5 A;  3RY2 A;  1VWG B;  4BX7 A;  3AUM O;  1T0V A;  1OPB A;  4ORR A;  2OL8 O;  2R73 A;  1D2U A;  1LPJ A;  2C1S A;  3JSQ A;  4ZCB A;  3WYP A;  5FQ7 E;  1HMR A;  4Y59 A;  2AT6 X;  5HZ5 A;  3KFG A;  4WFU A;  3STK A;  2I5V O;  3BX7 A;  2X8F A;  4KH8 A;  4KT5 A;  2IZI A;  4TKJ A;  3ZW2 A;  5HWZ A;  1BSO A;  3PQS A;  3P6F A;  4XMC A;  3HOL A;  3ELX A;  3B2I A;  4L3R A;  2JN3 A;  1NQM A;  4MVE A;  4YBP A;  3RE6 A;  1AQB A;  1MVG A;  1YWC A;  2RTI B;  3FW5 A;  3NR3 A;  4U8U N;  2IZD B;  3OE3 A;  4RUN A;  2X34 A;  4IB6 A;  2IZH B;  3VG4 A;  1EAL A;  1N0S A;  2KTD A;  2R74 A;  1PBO A;  2X56 A;  2FHN X;  4EXZ A;  1CBQ A;  1SWD A;  3ZQ3 A;  2HLV A;  2GTL N;  3CBS A;  1GT5 A;  3RDS A;  3TZS A;  1SWB A;  3APU A;  5LKF A;  5C0N A;  5LKE A;  1KT7 A;  1AVD A;  1KZX A;  3ZWE A;  4BCS A;  1GKA A;  1QY0 A;  1SRE A;  4NW4 A;  4WFV A;  3CQR A;  5D4A A;  2FKJ A;  4YH0 A;  3VHH A;  4GNW A;  2OY7 A;  4QZT A;  2OY8 A;  1FTP A;  1NC9 A;  1SWF A;  1MK5 A;  2N93 A;  3EBK A;  3CR6 A;  1GGL A;  3CKF A;  3HOE A;  4IAW A;  1SWT A;  1GT1 A;  1LNM A;  1VWN B;  1SWS A;  2AT5 X;  1RXH A;  1SWR A;  3VG6 A;  2G8C O;  4I9S A;  4Z27 A;  3MM0 A;  5F1E A;  1X8N A;  1SLG B;  1LCW A;  2JU7 A;  2RTB B;  1STR B;  2RTR B;  3NP1 A;  1I9H A;  4QNI A;  3RE5 A;  3UAQ A;  1BJ7 A;  4IMN A;  5JD2 A;  3PED A;  4CDC A;  4ZFX A;  3B2H A;  3HWD A;  4EKV A;  4GNY A;  1ACD A;  1Y9L A;  1HY2 A;  1PM1 X;  4QGX A;  3S5V A;  1PBY A;  2KD2 A;  1TXL A;  1PMP A;  1QG5 A;  4O4X A;  2BS6 A;  2L67 A;  5CE4 A;  2KTS A;  3S60 A;  1LID A;  2BLG A;  4CPF A;  3T6F A;  1FDQ A;  1SLE B;  2HZR A;  4XMH A;  1ZRY A;  3RDU A;  1X8U A;  2M4L A;  3APX A;  4LKP A;  3CQN A;  3U03 A;  1OEE A;  1QAB E;  1RXK A;  1ZNL A;  4GH7 A;  1FEN A;  1D3S A;  1O1U A;  3P02 A;  2WR6 A;  1ICN A;  1TOU A;  5F6Z A;  2ZSC A;  3WBG A;  1QY1 A;  4BGF A;  1CJ5 A;  2HYS A;  4YGG A;  2C4I A;  3ZW1 B;  3F8A A;  1SWQ A;  3NX2 A;  2G79 A;  1KL3 A;  1HBP A;  1LFO A;  4NLI A;  1ZNK A;  1SWK A;  3FEK A;  1Y9T A;  5D8J A;  3WZN A;  2KW1 A;  4XMD A;  4CDE A;  2FHL A;  1NDJ A;  3NBX X;  4IB9 A;  4Y0Q A;  3VU1 A;  4ZGU A;  1VWK B;  1RBP A;  4O3W A;  3MVF A;  2O62 A;  3RBY A; 
#chains in the Genus database with same CATH homology
 2L68 A;  2OFR X;  1YWA A;  3PH5 A;  4GZV A;  4RUU A;  2L9C A;  4XME A;  1ML7 A;  2G7B A;  2OZQ A;  1LF7 A;  4ZHF A;  2K23 A;  2X8S A;  3HTY A;  5LJE A;  3AKN A;  4OS0 A;  3VE2 A;  4QAE A;  3K3L A;  1NGL A;  2A3F X;  1VYF A;  4QYP A;  5HA1 A;  2F73 A;  4L1N A;  4HPA A;  1FEM A;  5EED A;  5EPQ A;  1OBQ A;  5HZ9 A;  5LJD A;  4WHI A;  4EQA C;  2POA A;  5EDC A;  1GKA B;  2YG2 A;  4AZO A;  5AQ6 A;  4O3Y A;  1MDC A;  4YFQ A;  1S7D A;  4OMW A;  3WJG A;  4EDE A;  1X8P A;  2AT0 X;  2A2U A;  1SXU A;  4R0B A;  1TVQ A;  2CM4 A;  4AW8 A;  4OS8 A;  2WSJ A;  2QO6 A;  4ZJ0 A;  4AZN A;  1IIU A;  3FLL A;  3TF6 A;  1XCA A;  4FBV A;  3P6C A;  4ID2 A;  3D97 A;  1KZW A;  2P8G A;  4JGL A;  4KII A;  4O3Z A;  4BOE A;  1KT3 A;  1CBR A;  1ICM A;  1E02 A;  2CBR A;  3TGB A;  1L6M A;  4NP1 A;  2RCQ A;  4CK4 A;  4GRJ A;  1GXA A;  3IFB A;  4NYQ A;  1EUO A;  3PEC A;  4COT A;  5HTE A;  3EBW A;  3KFI A;  3ZUO A;  5EDB A;  5FQ6 E;  1QFV A;  3VG3 A;  1BEB A;  3STM X;  1FE3 A;  1JBH A;  3FA9 A;  5D48 A;  5L8I A;  1GT4 A;  4QGW A;  1EIO A;  2CBS A;  2FTB A;  3T1D A;  4AYH A;  1I4U A;  5LJH A;  1GX8 A;  2FRS A;  5LJG A;  1A57 A;  4HPB A;  4AZR A;  1G74 A;  2MHD A;  3C78 X;  2RD7 C;  4QYN A;  1JYJ A;  2CM9 A;  1X89 A;  2DM5 A;  3WJD A;  4KC8 A;  3F6Z B;  3B2K A;  3BU1 A;  1KXO A;  3FR4 A;  4AZP A;  5L8N A;  3KFH A;  1E06 A;  1R0U A;  1DV9 A;  2A0A A;  2EU7 X;  2QO5 A;  1DZM A;  2LFO A;  2R56 A;  2X8T A;  3KZA A;  3TGA A;  3FA6 A;  5K06 A;  2LBA A;  1S44 A;  2AT8 X;  3HWG A;  4IBA A;  3UEU A;  1BRQ A;  4U9C A;  1A2D A;  2FR2 A;  2PY1 A;  1U0X A;  4BQU A;  1X8O A;  1O1V A;  4ZHC A;  2NNE A;  4K19 A;  1SY1 A;  3BX8 A;  5JR8 A;  4I9R A;  4A8Z A;  2XST A;  1KGL A;  1SY3 A;  2OFM X;  4ZHH A;  4MIR A;  3V8U A;  1CBS A;  5FFH A;  2JU8 A;  1E5P A;  5D45 A;  1O8V A;  4ALO A;  1SXX A;  4YBU A;  1B0O A;  4ORX A;  3P6H A;  3N91 A;  4QQ1 A;  2MM3 A;  5HCC C;  5BVQ A;  4GK9 A;  4IAX A;  4XMG A;  2Q4N A;  4MVI A;  1EQD A;  2G78 A;  3HK1 A;  5KHP A;  2WQ9 A;  2FWV A;  4GE1 A;  4ML7 B;  1T8V A;  4FBR A;  2GJ5 A;  3HWE A;  2E4J A;  3FA8 A;  4ODD A;  1HN2 A;  3WJE A;  4CV7 A;  5DPQ A;  2RA6 A;  4I6S A;  3I0A A;  1IFB A;  1I06 A;  2WUT A;  2QO4 A;  4YMY A;  3EYC A;  2ASN X;  4Y0P A;  1OBP A;  3APW A;  1AVG I;  3P6D A;  4YKM A;  1SA8 A;  3VE1 A;  1BRP A;  3GE2 A;  3JQO A;  1G5W A;  3BS2 A;  1KQX A;  3B2L A;  2AH7 X;  4QGV A;  3C76 X;  2AKQ A;  1KT4 A;  3D95 A;  2OVD A;  1BSQ A;  2Q9S A;  1LIE A;  3AKM A;  4O49 A;  2K62 A;  5HZ8 A;  4ORS A;  2Q2P A;  4A1Y A;  5DG4 A;  3H3I A;  5H9A A;  4A1H A;  3UEW A;  2WQA E;  1CRB A;  2FR3 A;  2QOS C;  1SXW A;  2XKL A;  5HZ6 A;  1LKE A;  2OVS A;  4GET A;  1YIV A;  2W2F A;  3LHN A;  3C77 X;  5HTD A;  4LKT A;  4O4U A;  2WEX A;  1MUP A;  4N7D A;  2X45 A;  4TKB A;  5FQ8 E;  2JMB A;  3HWF A;  4M6S A;  1B56 A;  3OBL A;  3F9D A;  1URE A;  5LJB A;  1GM6 A;  2GTF X;  3NQK A;  1QFT A;  1ZNG A;  1G7N A;  3B2J A;  3MX7 A;  3WOV A;  1I04 A;  4PJ2 A;  1P6P A;  1VYG A;  1YWB A;  1HMT A;  1FEL A;  2FS6 A;  4ZHD A;  1SY2 A;  5B29 A;  3O22 A;  1X71 A;  2RCT A;  2MWH A;  1YWD A;  2WWP A;  4LQZ A;  3WXQ A;  4IB8 A;  1VPR A;  5BVS A;  4ARH A;  3NAD A;  3P6E A;  3S5X A;  3O19 A;  4UU2 A;  2MJI A;  4AZQ A;  4YFR A;  1E00 A;  1MX7 A;  3FR2 A;  4INN A;  1A3Y A;  1NP4 A;  4GKC A;  1JYD A;  2AT3 X;  4O4O A;  3BSZ E;  4HFO A;  4YGH A;  3ZZV A;  1QY2 A;  3I17 A;  5BVT A;  4FBO A;  1DZK A;  1QWD A;  2Z4I A;  3EM0 A;  5D47 A;  4ZGF A;  4YDB A;  3BU9 A;  2NP1 A;  4HWM A;  2Q39 A;  2JW1 A;  3O2Y A;  5HCD C;  3BDR A;  4I3C A;  5L8O A;  3FEP A;  2IFB A;  2AMM X;  2CZT A;  4KCA A;  3MBT A;  4YDA A;  2F09 A;  1X8Q A;  3PQU A;  3FA7 A;  2FT9 A;  4M7M A;  3ZW1 A;  1U18 A;  3FIQ A;  1ZND A;  1A18 A;  4O3X B;  3S26 A;  3FW4 A;  4IB7 A;  1HMS A;  4A60 A;  3Q6L A;  4UU3 A;  4Y0R A;  1YP7 A;  3FEN A;  5H9N A;  2ANS A;  3U0D A;  1KOI A;  1H91 A;  4I95 A;  1S2P A;  4YKO A;  5FEN A;  1LIB A;  4QZU A;  2ACP X;  4U8U M;  1IW2 A;  1EI5 A;  2HMB A;  2LB6 A;  5FAZ A;  4DQ4 A;  1OPA A;  1JV4 A;  2ALL X;  1YUP A;  3STN A;  2CZU A;  4O9S A;  3VG2 A;  2Q2M A;  3VG5 A;  5AEO A;  4YFP A;  5CYB A;  3WVM A;  3GAQ A;  3UEV A;  4O4S A;  2KT4 B;  1ALB A;  1JIW I;  1LIF A;  5B27 A;  1LIC A;  1YP6 A;  2FS7 A;  2A2G A;  3ZUI A;  2GTL M;  4ALB A;  3FR5 A;  5LJK A;  1ZNE A;  5H8T A;  1EXS A;  5IO5 A;  1DZJ A;  3NX1 A;  1TW4 A;  3QKG A;  4U8U O;  4U3Q A;  5LJC A;  1BWY A;  2JOZ A;  1AB0 A;  4ON1 A;  1EW3 A;  4I3D A;  4OMX A;  3UEX A;  4QRL A;  4CSB A;  4NYR A;  3SOT A;  3EMM A;  4FGI B;  3IA8 A;  3ELZ A;  4ES7 A;  1BM5 A;  1B8E A;  2LA7 A;  5IO7 A;  4MVK A;  2AL0 X;  2BS5 A;  2GTL O;  2YMS A;  3PPT A;  3KFF A;  1U17 A;  3BLG A;  1SY0 A;  1Z24 A;  5F7G A;  2W2A A;  2Z4H A;  3G7X A;  1GT3 A;  1HBQ A;  3RSW A;  3RKG A;  3BRN A;  1JZU A;  3ZW0 A;  4TNN A;  5H9K A;  3OD9 A;  1ADL A;  1ERB A;  1EII A;  2ZAG A;  1OBU A;  1BSY A;  3FMZ A;  3FYF A;  3JS1 A;  4HPD A;  3P6G A;  4IMO A;  1TOW A;  4IAB A;  1MX8 A;  1HQP A;  4EEJ A;  1KT5 A;  3E3C A;  2X46 A;  4WBK A;  5HBS A;  2A13 A;  4BVM A;  4YCE A;  3DTQ A;  5BYP A;  1DZP A;  1EPA A;  4AZM A;  1ERX A;  5IO6 A;  5EEE A;  1DC9 A;  4MIS A;  5KIC A;  3APV A;  3NQ3 A;  4PSQ A;  4TKH A;  3OJY C;  4EFG A;  5H9L A;  3NPO A;  4NNS A;  1OEJ A;  4NNT A;  1KT6 A;  4ORU A;  3D4R A;  1IFC A;  4LZU A;  5F58 A;  4TJZ A;  3CWK A;  1QQS A;  1G85 A;  3D96 A;  2BT9 A;  2ZAI A;  4OS3 A;  1SMP I;  1PEE A;  3WJC A;  3KQ0 A;  4TLJ A;  4FQB B;  4NLJ A;  1IKJ A;  1CBI A;  4Y0S A;  5HZQ A;  3ZI8 A;  4ZHG A;  5KID A;  5HA0 A;  4ORY A;  3P24 A;  1GX9 A;  2LBV A;  1NP1 A;  3TGC A;  3U9P C;  1RLB E;  3WJB A;  1DFV A;  2RN4 A;  4D6B A;  1JJJ A;  2HNX A;  1JJX A;  4XMF A;  4ZR2 A;  4ZH9 A;  2W2B A;  1EPB A;  2BHV A;  1ZNH A;  4GDZ A;  5EZ2 A;  3SAO A;  4ORW A;  1I05 A;  1B4M A;  3CBC A;  5HCE C;  2OVA A;  4KC7 A;  5AJC A;  3PH6 A;  3L4R A;  4HPC A;  1IKE A;  1KQW A;  2NNQ A;  2RQ0 A;  4LZV A;  3BY0 A;  4GU8 A;  1T68 X;  4ZH6 A;  1BBP A;  2FLJ A;  1OEK A;  3FEL A;  3CMP A;  4I3B A;  5F6B A;  1SXY A;  3LV4 A;  3RWX A;  2WEW A;  2ACO A;  1XKI A;  2LKK A;  4TQ2 A;  4N7C A;  2L5P A;  2QMI A;  3PP6 A;  3VPJ E;  3NQ9 A;  3ZW0 B;  5AJB A;  2QM9 A;  3VG7 A;  2OVE A;  4MVL A;  2NND A;  4YGZ A;  1UZ2 X;  1DF3 A;  2GC9 A;  2HZQ A;  3DSZ A;  4YCH A;  1BLR A;  3RZY A;  4D6A A;  3WJF A;  2JU3 A;  1AEL A;  5HAE A;  2MO5 A;  1T0V A;  1OPB A;  4ORR A;  2R73 A;  1D2U A;  1LPJ A;  3JSQ A;  4ZCB A;  5FQ7 E;  1HMR A;  2AT6 X;  5HZ5 A;  3KFG A;  4WFU A;  3STK A;  3BX7 A;  4KT5 A;  2X8F A;  4KH8 A;  4TKJ A;  3ZW2 A;  5HWZ A;  1BSO A;  3PQS A;  3P6F A;  4XMC A;  3HOL A;  3ELX A;  3B2I A;  4L3R A;  2JN3 A;  4MVE A;  4YBP A;  1AQB A;  1MVG A;  1YWC A;  3FW5 A;  3NR3 A;  4U8U N;  3OE3 A;  4RUN A;  4IB6 A;  1EAL A;  3VG4 A;  1N0S A;  2KTD A;  2R74 A;  1PBO A;  4EXZ A;  1CBQ A;  3ZQ3 A;  2HLV A;  2GTL N;  3CBS A;  1GT5 A;  3TZS A;  3APU A;  5LKF A;  5C0N A;  5LKE A;  1KT7 A;  1KZX A;  3ZWE A;  1GKA A;  1QY0 A;  4NW4 A;  4WFV A;  5D4A A;  3CQR A;  4YH0 A;  4GNW A;  4QZT A;  1FTP A;  3HOE A;  2N93 A;  3EBK A;  4IAW A;  3CR6 A;  1GGL A;  1GT1 A;  1LNM A;  2AT5 X;  3VG6 A;  4I9S A;  5F1E A;  4ZFX A;  1X8N A;  2JU7 A;  3NP1 A;  4QNI A;  4DQ3 A;  3UAQ A;  1BJ7 A;  4IMN A;  3PED A;  3B2H A;  3HWD A;  4GNY A;  1ACD A;  1Y9L A;  1PM1 X;  3S5V A;  4QGX A;  2KD2 A;  1TXL A;  1PMP A;  1QG5 A;  4O4X A;  2BS6 A;  2L67 A;  5CE4 A;  2KTS A;  3S60 A;  1LID A;  2BLG A;  1FDQ A;  4XMH A;  2HZR A;  1ZRY A;  1X8U A;  2M4L A;  3APX A;  4LKP A;  3CQN A;  3U03 A;  1OEE A;  1QAB E;  1ZNL A;  4GH7 A;  1FEN A;  1D3S A;  1O1U A;  3P02 A;  2WR6 A;  1ICN A;  1TOU A;  5F6Z A;  3WBG A;  1QY1 A;  1CJ5 A;  2HYS A;  4YGG A;  3ZW1 B;  3F8A A;  3NX2 A;  2G79 A;  1LFO A;  1HBP A;  4NLI A;  1ZNK A;  3FEK A;  1Y9T A;  5D8J A;  2KW1 A;  4XMD A;  4IB9 A;  3NBX X;  3VU1 A;  4ZGU A;  4Y0Q A;  1RBP A;  4O3W A;  3MVF A;  2O62 A;  3RBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...