3P02A

Crystal structure of a protein of unknown function (bacova_00267) from bacteroides ovatus at 1.55 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
314
structure length
308
Chain Sequence
b'WTDEQFKQLISFKTQPGGWGVTDVHVRYANSAKYTYNLPVVSGTDDRLVSFSLRDDTLDILNFEKFGNRPELYFRELPQKYYSFPKELTIPAGQSHALLPIEFSLDGLDDSQKWALPLKVCEDNGTYAVNPRKYYRTAVLRPILFNEFSGRFSGSSLLGTMAGESDIKFSSTEIKLNVVTDSIVFFYAGQRTEDYEDRINYKVFLQFTGDKVDSKKDLYKMKIWAENEKLKFNSYSTPTYKVSSEMDATKTYLKHTYIVISDIDFDFVDYTSVPNYEIEYNMKGGLSVSRDLDTRKPDEDQGSDSKWW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a protein of unknown function (BACOVA_00267) from Bacteroides ovatus at 1.55 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Unknown function
total genus 78
structure length 308
sequence length 314
ec nomenclature
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14274 DUF4361 Domain of unknown function (DUF4361)
A PF16343 DUF4973 Domain of unknown function (DUF4973)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.440 Mainly Beta Beta Barrel Lipocalin Lipocalin 3p02A02
2.60.40.1740 Mainly Beta Sandwich Immunoglobulin-like hypothetical protein (bacova_03559) 3p02A01
3P02A 4QNIA 3N91A 3POHA 3NQKA 3SOTA 4DQAA
chains in the Genus database with same CATH superfamily
3S35H 3ZW0B 4MVEA 3ZMNA 3V0WL 1I1AB 1GGIL 2WTRA 4AYFB 1KBVA 4HDIA 3BZDA 4U2ZA 2VE6B 3UZEC 4AKPA 1RZKH 2BW4A 3A5VA 2VL4A 1BBDL 2H0JA 4IAXA 4ALOA 2XQBH 4QEGA 1PLGL 5E2VH 3T6WA 4F33B 4ALAH 1ADQA 5INDB 4PY7B 1KFGA 3HZ3A 5FYJU 3B1UA 4BINA 1M6OB 3BESR 4L8DB 4OFKA 4OLWH 3DX8B 1VCBC 2XZCL 2Z0BA 2P5EE 1IZKA 2GITA 3H42H 2LFOA 4H20H 1N10A 1E06A 3GSRA 1BREA 1U8JB 4IMLA 1UXSA 4EUPB 3EXLA 1S5IL 2WXKA 4NN6B 1BZDA 4R96A 2N59A 4XBEH 4XMUA 4K7PH 4O4UA 2X4PB 4N5EC 3UAJC 3Q2LA 1NEUA 4NWTH 3KGTA 1JPST 5MENB 2P5ED 1P2CB 1PCSA 5CGYD 4OCNC 2MQGA 1B0OA 2MEJB 3ABLB 4CPHB 3STLB 5LDUA 2QMJA 4AKQA 3GZKA 5CMAB 3GBMH 3FO2A 5EBWA 2CDGA 2XXMB 4Y9FA 1AR1D 1J05A 4KX9A 2FEEI 4OFPA 3UMNA 4MMYA 1H6TA 1JV2A 1AI1H 1Z3GH 2WYZA 4FL4C 5JDSA 2X4QB 2NY1D 4V33A 4JGJA 2GAZA 5DHEA 4Y5XB 1HYSD 1TYEB 1AS7A 1BLRA 1G1YA 1JXGA 5GGSY 3Q6LA 1HE7A 1DQQA 1P84K 2FJGA 4X4KA 4HIHB 4AV5A 3UTQB 4YO0B 1J8HA 1X6LA 3VHMA 5F71A 2CM6A 1X7QB 4JDVA 2B9AA 1BW8A 2WBKA 3NDYE 4DNLA 2HLFD 3CFEA 1BWWA 1Q0XH 3GXFA 3QCVH 2A77H 4MSWA 4HH9A 4FJZA 4H88L 4PGEA 3NCEB 1RZQA 3NRFA 3CX5J 4HCGA 4ZFQA 2XJKA 3MVFA 4LIQH 4DHLA 4H26A 2OTUB 1G6RB 3AWGA 3QIWA 2JB6A 2IV9A 3V5DB 3UJJL 4P49A 2VDOB 3EOBA 4U0RC 4Z7NB 3WFEH 1R3IH 2BC4A 3FCGA 3NSFA 4PJ7E 2GTZB 2VIRA 5F1NA 2OFMX 2GT9A 3J07A 4N22A 2KH2B 5EN2B 2EVHA 4P4KB 3UCRA 1MRCL 1JTOA 3KJ6H 4TNWK 4JFSA 3SO3B 5F7BA 1ASQA 4GMSL 1SWCA 1E3XA 3FQWB 3IDNA 4LNRA 3WFCH 1VERA 1U17A 3U9PC 1QD0A 4GMTH 1MY7A 1WZ1H 4JN1L 1TJIH 1MVYA 1I9RH 2FX7H 3U0PA 3WHE0 2IANB 3P30H 2CBOA 4HKXB 4GO6B 4I77H 5T3ZE 3HMXA 5F6HJ 5FM8A 4A7QA 4DAGH 2GBAA 5JHDA 3GSXB 2QADC 4Z5RA 4XPGL 2EIMB 3VSUA 5C9JB 3S37H 3U7WH 2HZHA 4I18B 4A68A 4C55A 2JJWA 1JPGB 2EE6A 4N20A 1KEGL 1PYWA 4YFPA 1JI2A 1PZ2A 3IE9A 5CR1A 3CFQA 5T3ZD 5EDBA 3TF7C 1U8CB 5EIIG 2IMNA 4I1RA 2HLAB 2OMBA 4U1SA 1HXZA 4JRYE 5CJBA 1NCWH 3QFJE 5FGRA 1KTDB 3FRPA 3Q5TA 3K4DA 5FHAH 5GS0C 4LPYA 5IUSA 3N41F 1RAVA 4LPCA 5FGBA 3JWNC 5B1KA 2JMRA 2Q2MA 3MV7A 4A60A 4JLRB 4I48B 4JKKA 4ZPVA 3P02A 5B8CB 2IALB 4O5LH 5C0CB 4Y0SA 4D7BA 1TTRA 3EM0A 3GJFA 4PB0L 2L7EA 3PLYA 3TGBA 3KVPA 3QFJD 4GQRA 4GQ9H 3PWPA 2JNZA 1V7ML 1ECZA 1LELA 1KB9J 3QEGH 5MI0B 2Y2WA 3LS5H 3NPOA 3FT1A 5I8EA 2VGLM 5J1TC 4QD2E 4AGLA 3S96A 2FGWL 5DUBA 1P6WA 4XBGB 3GNML 4QHNB 2C9QA 4LVEA 5AJCA 1VFUA 1CVRA 2OS7A 4A6YA 5D4AA 3B83A 3HPJB 1BEXA 2Y5QA 3JV4A 2DL2A 2A83A 3KLSA 1J8SA 4DERA 1GYUA 3D2UA 3HBGA 2CKNA 2E8ZA 4F20A 1EEZB 5D2LF 4AGNA 5KHPA 4MB1A 1ZGLM 3ARDC 1A14L 2C7UA 3BD4A 3E80A 1A6VH 5F58A 1HXMB 2DQJH 2XXGA 4M02A 5ICYB 4JY5H 1EPAA 4X80H 4MWFA 3TESA 4J2XA 4WRLA 2YA2A 3EJTA 4AYMC 5JPMA 2UZXA 2ZIDA 2NTFB 2Q8BL 3EFOB 3MKGA 3JSQA 4MFHA 4MDJA 1DVYA 3SDXA 4FZEL 2VO5A 1AACA 2R1WA 4L0PB 2DDQL 2XWCA 4LPTA 3BX7C 4QOKE 3WFHB 1SWAA 5BS0B 5D9SB 3RY4A 1RUML 3RDTC 4DWHA 1BQLL 1G9EA 4EKXA 5KIDA 5IB3B 2WLHA 3HHMA 3VFUA 4D8OA 5DMYA 1IX2A 1XF4A 3MBED 2LBAA 2C9XA 1CL7L 2NNAB 1IAII 3P54A 4KKBD 4U7MA 4YDAA 3B6SB 3DK2A 5C0AE 1IBBA 4I3DA 4QOKD 2FT6A 3HRPA 3IDUA 1GYAA 1B56A 3MCYA 1B4TA 2XRAH 3W38A 5D72H 1HDMA 4J3UA 3K1DA 1OARL 2NYYD 5LBSH 3VFRB 5L2KA 2EXYC 2YWZA 2BLGA 3FIDA 4DGYL 4MD5A 2NQDA 2JIXB 3QI9C 2ZXEB 4HEMA 4X6FB 4YFLI 4HUMB 4PJDA 5D7JD 3ZPDA 1CZ8L 4PGBA 2RAMA 2P8MA 2V7HB 1K6QH 3L9RB 4LCYA 3SB3A 4AEIH 1BX2A 4YSQA 1EPBA 3AU0A 3GS0A 4UZGA 5DO2C 4YPGB 5GSVB 1Z9OA 2XA8L 1LFOA 3D4GA 3IMTA 5AOKA 5EC1B 2YEVB 4MNQA 4JRLA 4ENED 5BQ7A 1E30A 1JYXA 3D30A 2K3TA 3I3DA 5GS0L 1TVHB 5LJKA 4K8RC 3SGKA 2RTHB 3LEYL 3ARXA 4P9ML 1WFTA 2FATH 5L0QB 3OJYC 2WEWA 4DVBB 1H91A 2X8FA 1RIVL 4DGIH 5DD3H 1X5FA 4PWIA 1A6UL 3QAZB 3IFOB 5EV7A 3O2YA 4ZHGA 1CT8B 1MFUA 1S9XA 4CSTA 3JWDH 2A38A 4LL9A 1A7QL 1E3ZA 1J5HA 1T0PB 3B43A 3ZGIA 4AEHL 3L81A 3CN0A 2VQTA 3BPOC 1LEKB 4R90L 3BKYL 3EKCA 2LLNA 3O0LA 4S2SB 3ZDYF 1NJ9A 2OP4L 4Q9RH 2MPAL 4LCCA 5CD3B 5JIHA 4BFGA 3TJEH 1J1PH 1NSNH 4W9JC 1ZHBB 1OTSC 2WUBH 3GM0A 4TQPA 3OB0H 2LKKA 3TGAA 4ORWA 2KS0A 1X8PA 1ZWIA 5A6LA 1BQ5A 4N8CL 2ICCA 1J86A 2D0GA 2X4TA 3FR5A 2FLBT 1OGAB 4JHBA 3RAJL 3ZE1F 4A2HA 3QQ2A 5JHLH 1MHCB 4FG4A 1ZNLA 1E4KA 2XCMC 2AVGA 2MOGA 3LKOA 2XICA 3LEVL 4PRBA 3MLUL 4Z1PA 3GMQB 3QDHA 4WK0B 3QDGE 4J28A 3A67H 3MZTA 4F58H 1CDJA 3KBHE 2CIKB 2FHCA 4RWHA 2NW3A 3W9EA 1XF2A 5FQ6E 4XN2A 1CS6A 4NQDB 4ODTH 2VH5H 2YEQA 4XCYB 3VYOA 2VISA 3N55A 5BVJB 1I7TB 2W9DH 1DVTA 3QQ9C 1RK1B 1A4JA 1YY9C 1NCNA 3QDGD 4EBQL 1D9KC 1N68A 4NRYB 1G74A 1TJGH 1R5IB 4NO3A 4O51B 2JXMA 2P45B 5ID1B 1P7QB 3L7EB 5ITFA 2FX9H 3CZGA 3FRPG 1LE5B 4O2EA 1FNGA 3RVWD 3PP3K 2VXUH 4APXA 5DVPA 5AYTA 1AGBB 1T21B 1QUNA 3QHZL 3ZO9A 5JPNC 3RURA 3B2IA 3IRPX 4LP8A 2BP8B 3K91A 3K1KC 4PJXF 4NCC2 4L18A 1HOEA 4EI5A 4LASH 4E5XB 4BX5B 4X6BA 4D7PA 4NZTH 1J0YA 2ZOLA 4HC1H 4ZUSB 4TNVF 2IH8A 4L4JA 2LVEA 1FYHB 2RTGB 1TKWA 2G4EA 5AQ0A 2ERJC 4J3OG 3K2IA 4GW4A 4L2YA 4QTHA 1MHHB 3WS3B 4APQD 3D39B 3LZOA 5FQ7E 4NYLA 4JDTH 3TN0D 4RFOH 4O02B 4XMKH 2YIHA 2EIEA 1QFVA 4KY2A 5LO7A 3VTMA 2O5ZL 1MIMH 5I75B 2YGOA 4IB8A 3WNJA 5D8JA 2FWOA 3E8UH 4QWWC 1MVUA 1UCBL 3HWEA 5EFIB 3T8VA 5I16B 3WOVA 1E6JH 4NNYA 1FHGA 2XFXA 4PJHA 4YHYC 4Z2OA 2YEZA 5ERWA 2BX5A 3CZEA 2X45A 3DV6B 2XN9E 2UV3A 2ZUVA 2WCPA 3T2NH 3ULVD 4ZX6A 1NDGB 2VC2L 3CFTA 1KIUA 3BWZA 1G85A 4WWKB 3VRJA 3EYVB 3FQTB 1AJ7H 3ECQA 3S5YA 3EJCA 4GS7C 4L9LC 3FKUS 1BEYH 4LEEA 1T04B 4WW2F 4YX2L 1GKEA 4ZTOH 2H32H 5CCJA 1PX8A 2NXZB 2XN9D 3VFNA 4P5RA 5IHUH 2VLKE 2X4UA 3R8QA 3MRPB 3NA9L 4JPIB 4GEJA 2X6VA 1F00I 1NBYA 5CU5A 4Z7WF 5ANME 1S6NA 5BRZB 1LNUB 3SKOA 3V4LA 4E9RA 3M1BB 1BMWA 3CSPA 1LL1A 4G9DB 4GUPA 4KXAA 4OD3L 5GGSB 5AVYB 1MFVA 1P9MA 3O2VL 1S9WA 1K2DA 3HS0B 2VLKD 3KDMA 2NZ1A 3ELQA 1GKAB 3LSOA 3UIZA 4PRHB 5FK9A 4ZW7A 1RERA 5I5IA 3VG9C 5I73B 3DMMA 1KIPA 2VUYA 3RKGA 4HPOL 2EJ1A 4IS6A 3TEXA 2X1WL 4ZXBB 4OZGA 2AK1L 5E8DH 1MI5A 1IBGL 2WN3A 5IO5A 2BMKA 3P0VL 1PKQA 2SEBB 3OJDB 4S11A 3SE4C 3RL2A 3MLPA 5EEZA 4G71B 4PJ8D 1T0VA 1X5MA 3WU1A 2EP6A 4Z7UF 3EBKA 5TF1L 2JJTA 3FH7A 5E4AA 1TU2A 3V95A 4NKDA 1E50A 4OBSA 1ZLWK 1S9VA 1X5IA 4TN9A 1C5BL 3AMKA 1JERA 4HKJA 2AH7X 4QCIA 3FSVA 1NFDF 3LVTA 2WXGA 1KPRB 4DQ4A 5TGBA 2NDFA 4B9CA 1CXLA 1F13A 1MH5A 2JB5H 3FN9A 4DN3H 3MGTA 2IAMD 5AKSA 2A1WH 1BOGB 5TE6H 3WO4B 4S1SL 4HUKB 1DO5A 5EZIH 3NCXA 2H9GB 2UY6A 2IFFL 3DBSA 3T0EB 2FT8A 4MA3A 4WV1B 1NAMH 2WIIB 5F6IB 1Q9WB 1UFUA 2QVTA 5I1IL 2UY7B 4WNQB 1IC1A 3FU7B 4LESA 1GZQA 2E5EA 3BAKA 4LSSL 4B0MM 4BGDA 2X4MA 4R7VA 2GC7C 3D3VA 5EUKB 4PRPA 3RX9A 3SBQA 4F2EA 4HG4K 3T6LA 2CCLA 1MW3A 4KX7A 2OZQA 2NNQA 5E1GA 2EE3A 1DVFC 5E2UH 2ODIA 5DC0A 5BUAA 4E41A 4PJAF 4DP2X 1CXFA 1MKFA 4NGHH 2APVA 1YPZF 3RTQB 1HN2A 1ZS8B 1UFGA 3OXRA 1DE4A 1ZJAA 5I17B 1VENA 4FTVA 4N0RA 5DGQA 4AZ8B 3QEHA 2A74A 1VWOB 4GFTB 2HAZA 3Q5YA 4N5ED 1QFWL 5GJSH 1YMME 1M3IA 4GBXA 4KKCC 3WKPA 2B1AH 5FO7B 3W81A 5JW3L 4FMKA 5IQ9B 5HYQB 1YLBB 3QWOB 2APBA 3TPUA 5FYKL 4DCQA 4F2ME 4CC4C 3HZMA 3MV9B 5TFSH 4M6NL 2NY5C 4GH7B 1CPUA 3D25A 5ACMA 3KMDA 4OB5L 1SY1A 5F0JB 1G7LB 1Y0LA 1YMMD 3POCA 4PB9H 1OBPA 1SY2A 2ZKXA 1TETH 2X05A 3MBWB 1DJYA 1KXQA 2WZAA 4MKMA 3SE6A 2WQXA 1CO1A 4ZSOB 3O2DL 5B38B 4LLVB 3VG0L 1MVGA 4NKOB 4CKQA 3US1A 2BWIA 3RIKA 1QSFE 3KYOB 4IOSD 2AJXH 4YDMA 3HNTH 3FTYA 4XMDA 2HT4C 3GBNH 3C09B 1J1OL 4JFDA 2BSZA 4U6XB 3B9EA 4DSYA 2FDBP 4MBOA 4FHKA 5DD5L 1TTBA 1DUZB 4F7PA 5E8PB 5C07B 1HI6B 1LK3H 2AEQH 2YAQA 3I85A 3UTTB 1QSFD 2RCSH 3ZE0B 4ODBD 3EH5B 4ON1A 4TNVK 3WTXA 2YD2A 1Q94B 1NGQL 1K85A 4X9FA 1KTRL 9PCYA 1YC7A 4RMUA 5EU4B 1JUFA 1KNOA 1FVEB 2XSTA 3CSGA 4TYUA 1RZJC 4HK3J 3S4SA 3CDYA 1MLCA 1TJHH 4OUUB 3F6IA 1SOXA 3AABA 3V0IA 3KCWA 1IIKA 5MHSE 4B9ZA 3I9IA 2I27N 1BQKA 2QHRH 3P0YH 1ICMA 3DX6A 3R4DA 5DZVA 4XCEB 1KUMA 5TDOB 2CZUA 3Q3GA 1Z9SA 1C16B 4GP5B 4N9OB 4NXSA 4TRPL 1QSVA 2QADD 1MQ8A 3G6JB 4DKFL 2NMSA 1EUUA 3BP6B 3B1TA 4XVTL 4C83A 3RE0A 1NCIA 4YMPA 3LKSB 4P2RE 2HB0A 4MCMA 5MHSD 4QHKJ 1HXYB 3SE3C 3ZKMC 2BHVA 3JWNE 1F4YL 3MRLA 3NACH 4JZJA 4PU2A 5EU6B 1G9MC 1VFBB 3SPHA 1IC4L 1JSYA 2E3VA 1CL7I 4IDJH 2IEPA 5EPQA 5C0BE 1D5MA 4LCWA 1UCTA 4JO3H 1SXUA 4M61B 4P2RD 4GKOA 4WHDA 3UP6A 4BQ8A 4ZOCA 5GS0D 1N5YH 3QJHA 3CXFA 3T65A 3VACA 4ELDA 2DYPB 2Y36L 2H2SC 2EIZA 1R3HB 2HKHL 3CV5A 3OKOA 3UJIH 1IIUA 2OYKA 3ZW1B 3IXAA 3I75B 3RJOA 3HR5B 5FHBH 5C0BD 1Z5LB 1J9RA 1AB0A 3OKMA 4LEXH 3CVHA 4XXWA 4KXCA 5JLZA 5IVXE 3B56A 2EU7X 3HZYA 4P46C 3ZTNH 4NERA 4PGCA 1WAAF 2Z31A 4RAHA 2ZUSA 4EKVA 3MV01 1SY0A 1Y9TA 3WJJC 1J5DA 1L6XA 4F7MA 2F1BA 2EVJA 5ACZB 1SNRA 1UEYA 2HT2C 3VXNB 1QFUL 1E9QB 3NIDB 1RJCA 4IHOA 1Y07A 1JJUA 1AZZC 2V2TB 3RHWF 3G6DL 2F61A 4I13B 4YHOH 1M1SA 5JXAH 2YOCA 3ARDD 4GIPD 4NQEB 2GCYB 1D7DA 1A6WH 4IKKA 3GI8L 3OKEA 3HR6A 2D03H 5EH1A 3DIFB 1AR2A 3EADA 1RZFL 1GT5A 2DBLH 2E7BA 4P5TA 2PPAA 1YNTB 2QKIB 2WSPA 4D6BA 4UTAH 5TK4A 3L3IA 4AUUA 3NCFB 2HZQA 3TPKA 4CMHC 1KOAA 4G9FE 2B77A 5F9JB 1LKEA 2CUHA 5B3SB 4WI7A 5D2LA 3NJGA 3VD7A 4ABUA 3GHBH 1INEL 4PJBA 4N90E 5DYOB 5IIEB 2RA1A 4AJVA 4MXVE 4RNRA 3H4FA 1PNCA 3BO8B 3RDTD 1ADLA 5D2NA 5I8CA 2VLRE 3C5ZC 2Y06L 4G9FD 3QQ4A 4L1DA 4C4KT 3K6FA 3ES6B 3L6FA 1D2PA 1Z6JT 3HKFA 3NQIA 1GCYA 2R27A 3MTRA 4N90D 1XGPB 5IRAA 1KGJA 4MBRA 1ML7A 2YQBA 3FH8A 3KPSA 4KU1A 3C6LA 3V7MA 2ED7A 4ZGUA 2VLRD 3GS4A 1B0RA 1NBCA 3CC5A 3NZ8B 4UT6H 3SPGA 1LCZA 3GSNA 5CU9A 2EXYD 3QEQA 4TJZA 2YPLB 4Z7VF 3QS3A 3PL6A 4KKLC 3Q1EA 3QI9D 4U1GB 1AHMA 1MFBH 4XZUB 5EC2B 4X0NA 4K15A 1WF5A 2CJUH 4M3KB 4TVPH 4ONGL 3C60B 1M71A 1MJ8L 4L1LA 1T1YA 2G79A 3U1PA 2OF8A 3FQUB 5T8IA 3FT2A 3PGFL 4HU2A 5DO2D 5BNXD 2WZPD 3WCYA 5T1LA 3LS4L 1HQRA 4JHZA 3QHTC 5E9NA 3U6XS 5IBTL 5BUGA 2CDEA 1I9IL 4K8RD 4GE1A 4PHXA 3U4BH 3WEAA 2OX5B 2QSCH 1DJXA 3POHA 3EBGA 2FHNX 3QWRD 4G72B 2F0CA 5C09B 4PH8A 3LH2H 5DMKB 1JXFA 2F9BT 2IQ9H 2X2YA 3F7VA 1TLKA 3ECBB 3MOAH 1BXVA 1BECA 2XX1A 1HZLA 1NGYA 2OVSA 4LDOB 5T5FL 2KLSA 1N6QH 1OTUD 1TMQA 2Y5TA 3WNPA 1TQBB 5D1XC 4ZD3L 2FHFA 3OD3A 4LDEB 4KGJA 2DKMA 5KBMA 1KGIA 4JMXA 3IFBA 1WIOA 3S5LA 4RAUB 1HY2A 4OAWB 3IN2A 3QUXB 2EKSA 3APNA 3B34A 2ZOKA 1M4KA 2Z3FA 4JBSA 1OTSD 5HWZA 2QO4A 2K6WA 1UJ3A 3HAEH 5BJTA 1KFAL 1BFOA 1N6VA 2G3XA 2I7OA 2VRAA 4FFWC 4CSZA 1RAMA 1OD9A 3QHFH 1SHXA 2BH0A 5B7FA 4E9TA 4KTEH 1XGQB 4HJSA 2EIDA 4PBVC 5D96B 3S4SG 1B2YA 1EMTL 2EC8A 5CXPA 2OSLA 3DI3B 2KPWA 2V4LA 2G30A 5DJXB 1NAMB 4M6ML 1G9NC 4KJWC 3DTXA 5AB1A 1ZY9A 1SXCA 4ELKB 2D3NA 3QUML 3PNWA 1FGNH 3IU3B 1KV3A 4U1LA 2NY3C 3LRSA 4X6EB 1WHPA 2DZEA 3DHMA 4F8QA 1QRNB 2HX9A 3U0WH 2CPUA 4K3JH 4MNHB 1H0DB 3QQ9D 1HS6A 1YY9D 4XGZB 5BZWA 4N8VB 1D9KD 3GSUB 3T1FB 1S7RA 2GUOA 4PLJC 4AM0B 1EZLA 4NENA 2CA3A 1DBKH 4PSPA 5E1AB 2YBGA 3WIHH 1KCBA 1RIUH 3B3BA 5F89B 3F7RA 2I9LB 1TZAA 2AV1A 2GJPA 1AD9A 1FZKA 3AXLA 1Z66A 1GGLA 5BVTA 1OEKA 3D85A 4ZMAT 3KYNA 4JHQA 2VN6A 2ADIB 3EYFB 5HVHC 4U6VH 3APUA 1RULL 1G0XA 5E8OA 4U3QA 3MREB 4TUOA 4P2QE 1YEJL 3EYCA 2A9AA 4YLBA 5AVQB 5K9QG 5E2TH 3MYJA 4JRXE 1A5FL 4R83A 4X6DF 2A8GA 2FECI 1PBYA 1BZEA 3ARTA 2G2RB 2K9FB 4PJXA 1T4WA 3L1OH 4UTBH 4JB9L 5GS2D 1JZ4A 1IGJB 5E5UB 4FXTA 4P2QD 3GEFA 3GSQA 1IBHA 5K59E 2GJ5A 4BGFA 1D6VH 4OY9A 4JRXD 4QWWD 3FTUA 1KCUH 5EPMA 3JT2A 3RHWK 3FFOA 5DUPL 4J3WA 3VFOA 3DI2B 3T3PE 3MKKA 3NZHH 3SQRA 2JKNA 4NWUL 1SXBA 2R29A 3NCBB 4TPRH 4YGVA 1OEEA 5CJ5A 4GSRA 1EO7A 2ANSA 1YNLL 3IWVA 1TJXA 5I26A 1WZAA 5F9WC 4DQAA 4JGNA 4U3CA 3LIZH 5CKGA 2XI9A 1QTSA 2WWOA 5MEQA 1XCQB 4HBCH 3M7OA 4Z7QF 3WN5A 3FB7B 3H55A 1MHPH 4AYSA 1EJ6A 5B5GA 5IFHL 4M43L 1HEHC 2L8AA 4XWOC 2AEPH 1XIWC 4CPEA 4S10A 1SRDA 4ZMWA 4XNMB 2EDHA 2YLKA 2XU9A 2JW1A 1CLCA 1N0LB 1GC1H 1XH0A 3CFMA 2D9CA 3P9LA 4EN2A 4OGXL 2IOOA 5IJVA 1DFBL 4TLTA 1L6MA 1XH3B 4WW2A 2I07B 4ORGA 3FUHA 4QI3A 5D6CB 3QP3A 4PR5A 4XNUH 5GPRA 2LGNA 1OBQA 3A0OA 3PEDA 4QGWA 1JDCA 2AEOA 2J73A 1DF3A 4KC7A 1J8KA 1JIBA 2QEJA 3UTSA 1FBIH 1E90A 4Z7WA 3PJNA 2AQ3A 1DBAH 2M83A 4N1CA 4MMZC 1KXHA 2AJ3A 3GLDA 4EOWL 5LWYL 3L54A 1QFWI 4YHMH 3CXHJ 1TG8A 4JFYA 1CRBA 5HHNB 4WBKA 8PAZA 2DM7A 3PWLB 2ICEB 3ULUH 2CQVA 1RUAL 3BW9B 4HS8L 4MZIA 4G7YH 3QR1A 2ZP9A 5JIKA 5AJBA 4GK9A 3I02B 1EDHA 4FBOA 1AQDA 1M7DB 3CZFB 1Z0MA 4JUTA 5EN3A 3SKJH 3TYGL 4GAGL 1SF5A 1K24A 4YFEA 3QZWB 3MUJA 5TDNA 3WGUB 1KGUA 2OJ1A 4R26H 4KDVA 1NTDA 3BH8B 3FO9B 2DMKA 4FFYA 1DQJA 3ZE2B 5HPOA 4LK4A 4OCMC 1WH0A 3LPGA 1I78A 1SWLA 4ZR2A 2ORBH 3CH8A 4Z7UA 2XOTA 4P9HL 3S5LG 1L3NA 4I4WB 5KSUB 3HHSB 3CHRA 3VH8B 4IU2B 4OLXH 5ISZB 4LAQH 5AEOA 3DVGA 1MFEH 3BAXA 2DMHA 1RZGA 3LEXA 2CE6A 2WM0A 4YBLB 3SDCA 5DSCA 4ZO8A 2CKBA 1PDKA 4G8IB 3Q1SH 4AK1A 4DO5A 5CEZH 4HIJB 4LGSB 4KDTA 4HIEA 1XCTB 2WBJC 3PPSA 5HPMA 4NYRA 1DVFD 1FJ1E 4FLHA 4B9JA 4XOAA 1SWSA 1U3HD 5GGTH 3QG6A 2I9TB 1MJJA 3HPLB 4BKLB 5JPMC 3MCLL 1SFHA 1JOIA 4NHUA 4YGZA 2IZKA 1D5RA 1DQTA 3BIBX 5L8NA 3LKQB 4ABVA 3TNMB 2B8OT 4KKCD 5DA4A 4U1IA 2WWKT 4QYNA 1K3IA 1KG0A 2C4XA 2WHVA 4WGWB 3ZSSA 4FAAB 1ULVA 3MLYL 4PW3A 4JO5A 3TO2B 3MR9B 1E4XL 4PJAA 2DQEL 2IZEB 2KL6A 1PMYA 3CX5K 1OM3L 5CCKL 2ZOUA 3GIZL 3RDQA 3MI6A 1MK5A 3EH2A 1OIOA 2BIQA 5HGAA 5F7KC 4S1RH 4K5OA 2R4SL 1B4JL 3H0TB 3DYOA 1DQDH 1OZTG 1IAIM 2VWEC 1OSPH 2R73A 3GPSA 4XP5H 5CF3A 4WGVB 3FEPA 3HMXL 2JLPA 1SWTA 4ZZKA 1KPUA 2CIIA 1YEGH 3LQAL 2HT4D 3QPKA 4JHUA 4AGMA 5IFAH 3O6LH 3OZ9H 5SWZB 3UZVB 4MRBA 4RGNB 2DD8L 1DBJH 1KLGB 3DJRA 2GIMA 4GG6F 3SY0B 2H6OA 1H3GA 1JVKA 5BV7H 2F5BL 3KR3L 4KO6A 4OW6A 5G5DB 4ZMTA 4XBPB 5DS8A 5C3LD 5EEVA 4JG0H 3G3LA 2UXVA 4MAYA 4O58L 1R4XA 6PAZA 3SGKC 3SYPA 4NZFA 1SLUA 2C4FU 3CMOH 5B7EA 3VPJE 1BBPA 2O62A 4OKDA 2LQRA 5LJBA 1BCIA 1EUOA 1TCRB 1IAKB 4W9CC 4KRNA 3TBSA 1XCAA 3PQUA 1NC2D 1JS4A 4P2CG 2WLIA 1PJWA 4PJ9B 4Q2ZB 5DZLA 5FM4A 4Z78A 3U30B 5A2BA 1SZNA 1CD8A 1NLBH 1OAXL 3U0TB 2WGXA 2QQNH 4HWZB 3IS0X 4O4XA 3UMTA 1NBVL 3EGSB 1QASA 3VM5A 5CIPA 1A7PL 1K4CA 2RN4A 3HE6D 5IT2L 3AWEA 4AM0Q 1RIHL 1GX9A 1WBZA 1QG3A 3OKNB 3BMVA 1AZRA 2Y2YA 3F85A 2AK4A 3O11B 3RGVB 4LVHC 4A6YL 4DPBX 1HIMH 3PAYA 3WTWA 2D0FA 2A3FX 3QRBA 1EO8L 3P77B 2WINB 1KB9K 3ZKMD 3GMRA 3BSZA 3EG9A 4WO4C 5E1QA 3UX9B 5ECJE 2BCKA 4PG2C 1DP0A 4K94C 4PG9B 4NP1A 4AT6B 5D45A 3PWJA 3UYRL 1JGVL 3O2WL 1RLBE 1ETZB 1VF5C 4ZW8A 4H1LB 2FNWA 2Q6WA 1S7QA 2H2SD 3S34L 3UXFA 1EH9A 1XH2A 4I2XA 4XPHH 1F3JA 3QPQC 4TLUA 3O3EA 3MRDA 3CN1A 2WP3T 1XGTA 4HS3A 3LH9A 1E8ZA 2RD0A 4QTIL 1MZZA 4XAKE 1BEBA 3MUGB 2EEAA 4K0OA 2A6JA 4YBPA 5EA0H 4KI1A 1UA7A 2JK5B 2Y69B 3G5XA 3ZQXA 1Z5YD 5JDJA 4P46D 3RI5F 4XP1L 3VRLE 3NJVA 5DTFA 4YK4B 3APCA 3WJBA 4JNJA 2JQZA 4H44C 4QRAA 3CBKB 4BFOA 3CSTA 2XPZA 2HT2D 1JNLL 1U9KA 1LO0L 2IH3B 4YVNA 1VIWA 1CDIA 2Y6TE 1ERXA 1OXYA 3ABKB 1U2HA 3KW7A 3OXSA 4AE0A 1FF5A 1HMTA 1U18A 3LV3A 3AT0A 4NNPH 4MMXA 2X4OB 1TQUA 2XXCB 1JK8A 2HUHA 1MCRA 2VABA 4W70A 3CU1A 3DXAB 4JZOA 5E9DA 2A9DA 2QQKH 2OMWB 1VDGA 2C1PA 3I3EA 1VPOL 1A8JH 1RSUB 3LX9A 3MGOA 4JG5A 3UPAA 2BZCA 5AD0A 5DHVA 3MRGA 4B3VA 5J5EA 2DM5A 1AXTH 4UM8A 3LNFA 3TZVD 3P73B 3JS1A 1MRDH 2QFRA 2XIBA 2VFBA 1IO4C 2FL5A 3V0JA 2QELA 2ZCZA 3BT0A 2NSMA 3CZLA 3INOA 3F58H 5DMIL 4KVNL 3U36B 4CAGA 3C5ZD 4ZX4A 5J06A 2AJYH 2JCCB 5GISL 4KX8A 3OKLA 3ZDZF 2A5UA 4ODWB 5D47A 5IM7B 4JHWL 4JANB 2X1QA 4IEFB 3VVWA 4XMGA 1IGML 3WL9A 5I6NA 2EC9T 3Q13A 4GNYA 1DJIA 1XR9B 2AXGB 5EUOF 1S9YB 4UT7L 3IF1B 3DWTA 4G6AD 2FUQA 2AL0X 1YEIH 1TPXC 4GSXA 4MX7B 1PKOA 2YXVA 2V7NA 3KPQB 1EBAA 5ETUB 3PHQA 2WWMC 4XOCA 1UGNA 5JO5A 1OPGH 4JO4H 3MLTA 2XN2A 1YECL 2HNXA 4HIQA 3UBXI 3EDDA 3G5ZB 5F1IB 35C8H 3UZQB 4HHWA 4J7RA 1AYRA 1X8NA 5FEBA 2XQYK 3EYUL 5C0IB 1VGEL 1AY1L 2HPOA 2NT1A 2W2AA 2NY6B 4N1HB 3VI3F 2TRYA 3ZT5A 3FOLB 4KPHL 4TULH 1Z7JA 4Z7VA 4EXPX 2OMXB 1G5WA 5IBUG 3IFNL 2NXYC 4U1HA 5C6WH 2M2DA 3SIKA 1FFPA 1GW0A 4LLAA 4MCZB 4N4YB 1P9MC 2WXOA 3V4PA 7TAAA 2W94A 1Z2KA 5B39A 1SLVA 3PV7A 1EQDA 5IHLB 2C26A 1LP9B 1PSKL 4R2GB 3SDAC 3F7YA 3Q8AA 4GSDH 3X11A 2F19L 2QHLA 4G8FA 4UB0L 4G8EA 1OB0A 1HT6A 4DETA 4GKZA 1U8MA 3H9SE 1OBUA 4DNEA 2OCJA 4LLDB 3ZX1A 1TT6A 3QE5A 3EOAB 4U46A 1MWAA 5H37A 4B50A 1Q72L 4FQHA 2XV3A 4RA3A 4FFWD 1AKJB 3MCKB 4NS0A 3I0AA 5EORH 3S3DB 2ISDA 2RTBB 2JJTC 2XUWA 3EGDA 5JYMA 4IOIA 3DRTB 2Z4QB 3H9SD 1Q1JH 2XWJA 1MPAH 2O6CA 1PEWA 4JY4A 4QRTB 2UWEB 5AW7B 1SLGB 1UT1A 4FQXD 1ZSDB 4JFTA 4KJWD 1C1EL 2Q20A 4MVBC 4AQZA 1CF8H 1J18A 4WTXA 4YL9A 2YPVH 2DEWX 1F6AA 1EK3A 3IGFA 4KVPA 4M4RB 4HIXH 1KJVB 1XSIA 3HC4L 3MJWA 2Z4HA 3Q6FB 4WO0A 5D7SL 2Q86A 2O61A 1B2WL 2ETWA 1UT2A 4I3RL 5CNHA 5K68A 1I8KB 1LE9A 3W9DB 1PTZA 1C7SA 2L4OA 3B2HA 2CDFB 4JCWA 1LF7A 2APXA 3M17B 1FZJA 4YSDA 4PLJD 4LP4A 3EZJB 3LV4A 1T4KB 3BN9C 3IDGA 4A1HA 4MA1B 5ENWB 3UABA 1OGSA 5DQJA 3CFCH 3GRWL 3HUJB 3QO0A 5F7HA 4W9GC 5T3ZH 2X89D 4RGMB 3MODL 1UWGL 3KBPA 4ZG1A 4RRPA 1BPLB 4M62H 4N0CC 2YQGA 4XPAL 2APTA 2WZ0A 1BLNB 2LU3A 2FIKA 1FPTH 5IW6B 3LTWA 2VQ1B 2H4EA 3LDBC 1UB5B 1TR7A 2FBRA 4OS3A 3P3SA 2JKIS 2DF3A 3WEOA 2OMTA 3IDMB 2FTBA 1RFDH 3BS2A 3MG5A 4GJVA 4MZRA 2UX7A 1ETA1 3QCTL 2W91A 4PD4J 4DEUA 5L2JA 4NLIA 1VADA 5K9KB 4AW4A 1P6AB 3DA0A 3QZMA 3RI5K 2HUEA 2XIDA 1F4WH 4QLWA 2IPUK 1SEQH 5DPQA 4H25B 4LO9A 2QDVA 4MYWB 1NA8A 3EW2A 2N3JA 4I1PA 2WNGA 3EFFB 3QQ3B 1IAIH 3U46A 2BP0B 2R69A 1IILE 3MHZA 4Z7NF 2JFCA 2UZYA 3LXUX 4GRLB 5BV7B 4Y1SA 4YZWA 3MX0A 3P24A 2DJFA 2VDFA 5DD0L 2BNUB 1V7NL 3WSQH 4CNIA 5HHQB 5AG9A 4MAUH 4A7GF 1NC4A 1NQMA 5B10O 1P5UA 5C7XL 4L4TE 5IMOB 2R0WL 5LJGA 1ZTXH 3FU9A 2W92A 2KMWA 1T20A 3MLSL 2C8NA 3QJFA 1W5RA 1CDHA 3I2CH 4RZCB 5EOQH 1T5WB 3HBPA 3L5JA 1D5BB 3KPLB 4ELMA 4LQFL 1HHJB 5DRWB 4XWOD 2F7PA 4PJEE 4L4TD 1JPTL 2YUZA 4F2FA 4KVCH 1C5DB 1CE6A 4G7VL 3EJYD 3SPCA 3O8XB 1O9WA 1GPOH 4Y4HB 2ADFL 3D69B 1W15A 4MD4A 1COBA 3L5WA 5JHDE 5FPIA 4X4XB 3FHQA 1MREH 3WD5L 3KZ8A 3E3CA 2R74A 2NY7L 4NN5C 1OCWH 4RDBA 4FC3E 3T4YA 4HFWB 2H41A 2O4EA 5B27A 2V33A 2FUTA 4OFQA 4JGLA 4KXZI 3M1CA 3NR3A 3FQNB 2A6IA 5AYQA 5JHDD 2IWFA 4JAMA 2PNDA 5J11B 2ZG1A 2OMVA 3AU1B 2XBZA 2DMCA 3I9PA 3JWOL 4D0DA 2Q39A 5EDXA 4DW2H 2JKRM 3LXAA 1T5XB 3LMJL 2A9NL 3GUFA 4ZOEA 1SOQA 3TO4C 1ZHNA 3KLKA 3O45A 1EO5A 4MEEA 2VSDA 3OKDA 1OP3K 1LVEA 5KSAA 3QORA 5SWSE 5F7DB 1LM8V 2HJFB 3C75A 5DJYA 2Y7NA 3F12B 5B7MA 3PWPE 4NM4H 1NLDL 1KCWA 3AROA 5FUZL 5I1LB 4DKAA 4AQEA 5B39G 1GOFA 5IRUA 1DZ0A 1KJ2H 3L4YA 5CLXA 1TEYA 3NSXA 4M7KH 5SWSD 2CR0A 1N0XH 5TPWH 4UMGA 2EXWC 1I1YA 3HRZC 3IDXH 5E70A 5KOVC 3TGCA 5AVWB 4E42B 1EZSA 2CK0H 3PWPD 1KGWA 1A7BA 1LWRA 1MIEH 5FCUH 2DQFA 2OR7A 1KIQB 3AVEA 5DFTA 3VA6A 3MBXL 3RVTC 5IW6A 2ADJB 2Z31C 3S2AA 2LTQB 1F86A 1NCDH 2IH9A 5ALBL 3FFCA 4OF6A 4X4MA 3MRRB 5H37G 3AG4B 4YBQC 4KTGA 3N91A 2DLGA 4BXVA 3I74A 1QLFB 2GI0A 3MLXL 4O4YH 3EH1A 3D2UD 4M48H 1BIHA 1MFCH 4W9DC 1V3MA 5TH2B 2QO5A 1QHQA 1Y6MR 4X6CB 1M7IA 3CDGB 4URKA 2GY5A 4MQSB 1DTUA 2DIEA 2PYEA 3PDGA 4JFZH 2BOCA 2LV4A 3KCPA 3V9FA 3PGCB 3K4ZA 3JVGA 4HWBA 3BOVA 5E4EC 1JZIA 3VB8A 1PG7H 3CFBB 5JXEA 1UWEL 3O3UN 1FP5A 2GTQA 3RFZB 3U03A 3ASOB 2H1PL 3Q8FA 2P8GA 2FB4H 4OUOA 2Z93A 3ZJAA 2WJ5A 2R2CA 3IS1X 4ICXA 2J55A 4L37B 4ACTA 2IDCA 1E9PB 2ZCKL 3RWJB 1SLEB 4NT6B 3WLWC 4YEEA 2VWEE 1RXJA 3ML8A 4AZOA 5GS1A 2XXFA 4MA8L 5L2KE 5EZOL 3NN8B 5BO0D 3IKCB 2YS4A 1QLEL 2ZF9A 1EX0A 2MWHA 2XHNA 3BD5A 3CPUA 3MOBL 4NP9A 1DUYB 5D7LB 1YWAA 2PW1A 2Q76A 1A9BB 2XQYA 1M3JA 1YNKH 4HEME 4NQCD 2EUWA 1ZV9A 4PJDE 2HFGH 1A0QL 2BS8A 4GDAA 2Y1ZA 3QA3A 5FO2A 2G75A 1IKJA 3GBDA 2NY2C 1OW0C 2P5EB 1P7HL 1YUKB 2GTWB 3BMWA 1FFNB 4E0RA 2NQ3A 3DSFL 1NP1A 1GYWA 2VLJB 1TEGA 1UB6A 4WEUD 4MNQE 4YR6A 2J6EH 2XWTB 4BKSC 3VE1A 4FP8H 1AR1B 4ZJ0A 3I50L 3BPLC 5DRXA 4ZHCA 1OAYH 1LJMA 1B4MA 4NQUA 4R7LA 1GRWA 4JPWL 4POUB 5DQ9B 1MAML 4MNQD 1KSRA 1QPKA 4ERSH 1CYXA 1GZPA 2YPKA 3AS1A 3V0WH 3FZUC 1GGIH 5E7BA 5C70A 4UT9L 3D9WA 4HHAB 4MS6A 3BDYH 1E7UA 3CGTA 3N5AA 5ITBH 4O4SA 1BBDH 3KPNA 5KZCD 4U9CA 1A1MA 4CDFA 1U41A 4UV4H 5FYKU 4H0HB 2OY1O 2MWCA 3ABGA 1ZLUK 3ULSA 4AQOA 4GG6A 2YJLA 3BHBB 4WJKB 3UOAB 1A6AB 3GI9L 4FD0A 4YSTA 4PIRF 1BFTA 1U36A 4A38A 4AMKL 1BSYA 1WISA 2NNDA 3L16A 3T2PA 5F9OH 1ZNEA 4PS4L 3CVHL 3QIBA 3N43F 1BAGA 1G7IB 3NJHA 2A9ML 3UAAA 1Q9LA 2VUOA 2XZCH 3APDA 3G5YB 5C0NA 3C6EA 3HI1B 1EVTC 1V3LA 3A21A 4MB4A 2WO3B 1P5VA 3ULVH 2CO2A 1AIFB 5I18L 3CLFL 4B60A 3PU7A 3L1EA 2YRBA 1FV1A 4N2FA 1BXAA 1XBDA 1DN2A 2OMUA 3QULA 4MCYA 4MQ7A 4WO4D 4B9PA 2WXLA 4CVXB 5BVSA 3UEUA 3JYCA 4BZYA 1DQLL 1YEHL 1ZHKB 2ZUQB 4IU3A 3JZ7A 1PQZA 2F1AA 1EZVX 2W0PA 4KJYA 1FWXA 1IKOP 4XB7A 4U6TA 1R5VA 1UJTA 1I7ZB 2AQQA 4BRJA 1LUQA 2WXIA 1BVKB 2FJFA 1OE3A 2B14A 3QPQD 3G5VB 4POZC 4ZUTA 3HE7C 1MN4A 2ENJA 4LCIL 3BT2L 5TE4H 2VZTA 1AG6A 1DBMH 1XQ4A 3B2VL 3TEZA 3PDOB 3RWEA 3L5XL 1L4IA 1R3LB 4OZIA 2Z91B 4JDZB 4R7NA 3FW4A 4BQ9A 4AV4A 4S1DC 1R34A 2GFBB 5D93B 3WJCA 2RTAA 3T2XA 1LDSA 2FS6A 1HN1A 4ZUVB 5GGVL 1VSCA 4XN5A 4JGMA 1D5XA 4KNQA 2DI9A 5DWUL 2AV7B 4G43A 4OJYA 4MQTB 5E0FA 4UANA 4IBTA 3GUTB 1N8ZA 3EDKA 2BRRL 3GSNL 1BZQK 1YJDC 3KHOA 5I1EH 2LU5A 1B0IA 3VMNA 5K33A 3L3DA 2CO6A 2RTCB 4U1JA 3FEKA 2OW7A 3ENEA 2JKWA 3DX7A 2J88L 2D3LA 3P1VA 2XT1B 4QXGL 5GGRA 1NH6A 2WK2A 4LPWA 4X4YB 2HMIC 4KQ3L 4ZK8A 1FSKC 2Y3NA 3HG2A 1EIIA 3FTZA 3RWXA 4NO2B 4GB9A 4P2OC 2HPTA 3WIFB 3ZW3A 5I1KH 1CICB 3QJSB 1VWPB 1YAIA 1HHKA 4R0LA 4FGMA 4UAHA 3IAQA 2AC0A 1O7SA 4ZPTB 1JFQH 3MXWL 2I5ZO 1MCPH 2Z7YA 4XPGH 3VX1A 4F93B 1QQDB 2EE0A 3VJ6A 4QKXB 5CJ8A 5KYYB 4D94A 3ISYA 3LHPL 5DC4B 4FI6A 2P8LA 4FULA 1KEGH 5HHVL 4Y4KB 1JZDC 2DIJA 1C9SA 3L4VA 4XPTL 1ZEAH 4QHUB 2Y3EA 4NLJA 2VDQB 3LN4B 3HN5A 4DIXA 1L5GB 5B3JE 3CLWA 4AL8L 2ATAA 2BVPA 2J20A 3RZCB 4XBMA 2WBWB 2WWMD 5FB8B 4IBUA 4HMDA 3GTTA 3NGBB 5EB9A 3O3BA 2Q7AA 4ANVA 4TNEA 2NP1A 4YSRA 3WN5C 4QOKB 5EUOA 5DJ6A 4PB0H 3VXMA 3W11C 4X5QA 3H7BB 3F00A 1V7MH 4U31A 4OCLC 1G4MA 2JU3A 2NLJB 4JHAH 2XQYG 4LLQA 5I66B 4XXDB 2NXYD 1L9PA 1KGYE 4DGVL 4OZGE 5IB5B 4BCYA 4WW2C 4PGDB 5D7JB 1MI5E 1SHSA 4M8QB 3G5WA 3STKA 5B2AO 4YGHA 1MHEA 1PKQE 4PJ5A 3WUWB 4PTUB 2JKLA 1CBVH 2DQGL 3VI3A 1A14H 2K8MA 3AG1B 1DZKA 5ID0B 2VAAB 4XPBH 4YDKL 3ZQ9A 1KTJA 1NCAH 1AHWA 4N8UA 3B37A 1VHPA 4PIBA 1J5IA 4JS7A 3S60A 1F41A 1MI5D 2KZ1B 5TTRA 5IG7B 3HK1A 4XNXL 2Q7YB 1KY6A 5LJYH 2X4SB 4DZBA 3LZRA 2Q3ZA 5IMMB 3RZYA 3QDMA 4LHUB 1SM3H 5LGHL 2L3BA 5AVZB 4R8WL 4FZEH 4XMPH 2EE2A 2YWYA 4ZAKA 3SSGA 1A64A 4FQPA 2CD0A 3NP4A 1QFWM 4WF7A 3D48R 1J8RA 5C08A 1BZOA 2ESVA 2GSMB 1MW2A 4ZX5A 2PO6C 4X2UA 1KB5H 4XHJC 3KPPB 5IHZB 2RTLA 3PQYA 3AY4C 1CL7H 4ABWA 1T2XA 4NRXB 3QRFM 2ATPB 3EH4B 1Y52X 3OC8A 1BM3L 4LZVA 4IRSA 5ANHA 4U0QB 2VXSL 3A6CL 3ZOAA 3UEZA 3FIQA 4Z27A 1A1OB 4ARHA 4IMKC 5D6DA 2FWVA 3ZW0A 3SZIA 3ZBMA 1I1AA 4FZ8L 4J2QA 1ADWA 2F58L 4LSPH 2VE6A 4X8XA 2FCBA 4PRPE 4YHZL 2LLGA 2AQNA 1KJMB 1NCCL 3AW5A 4ZMQA 2O6PA 2CR6A 4F33A 4DGYH 2ZXWB 3NDZE 4PY7A 3ARFA 3RNKA 1FC2D 1T1WB 4E41E 1G0YR 1PD0A 4YXHH 3BGFC 1M6OA 3BN9D 4L8DA 3I6LE 5T3XL 1I1RA 2PUQT 1R24B 3DX8A 4PRPD 3OAYH 1GZHA 1L9TA 1LD9B 4FS0A 1TVQA 1IKFL 1LHZA 4KDTC 3RVUC 3WXVH 3B7RL 1MCEA 3Q0HA 1OP5H 4UWQB 3ZZLA 5HGBB 2XA8H 1CDUA 1INQB 1KYUA 3CFJB 4E41D 2R29L 1VWLB 1XR8B 4MJ5B 4W4OA 3TTYA 3NAAH 2XTJC 3T6QC 5E24E 4YDBA 1L9OA 5GS0H 3I6LD 4H13C 1QBLH 7FABL 1NANI 5IB1B 4P9MH 3JWNH 1S5HB 3FT0A 1OCCB 2WQAA 2P42B 3J2PA 2EH8H 3KLDA 1OPBA 3QDGB 2MNJB 4PYHA 2FJHB 3LKRA 3UYPB 3ZTJG 4Y4FC 2HT3C 4K23H 1FHNA 2EDDA 3V2AR 1RY7B 4CPHA 4R4FL 3STLA 2F74B 5CMAA 1KXQE 4HETA 4UQ2B 4AYDC 4WI0A 4AUJA 4PV9B 4UDTB 4GG8B 1SBBA 1PY4A 2E7MA 1VWNB 4UDUB 2X3AA 2DWSA 5MP6H 4Y5XA 5TQ0H 5CKAA 1MCIA 2Z8SA 4RQQB 4UNVA 3S3CB 4JFDE 5DD1L 5LGYA 5IGXL 3QQNA 4HIHA 3O41A 1QY1A 3UTQA 3VUAA 3UL4A 3P40A 4YO0A 2WZ5A 1ACYL 4HJGB 5B4MC 4WCYL 2D7PA 3GHPA 2IPUG 4OGYH 3J7HA 3HFMH 1QEXA 1WCQA 2HVKB 5D4IA 4OZHF 3CUPB 5C0JB 5F88B 2I85A 3AT8A 2ZCLL 4JFPB 1FVDA 1LGVA 1M6UA 4N8CH 2Z4IA 4JFDD 1DL7L 2X7LB 2OTUA 3AQDA 1G6RA 1T66C 4APQB 4Z77B 1DJGA 4M7LL 3QJUB 3T6ZA 3V5DA 3LEVH 3STZB 1E02A 4HFUL 4LEOB 1RVFL 4MA7L 2OZ4H 5EMYA 4CN1A 1NBZB 1X5XA 4Z7IA 1SXYA 4PCYA 5HDWA 4HQQH 2APFA 5EN2A 3CXHK 1EIBA 3G6JF 4OJAA 5KJ4A 2ZZUT 3FQWA 4PJCF 2J44A 4NM8L 5F7EL 1B88A 4E68A 3E9TA 4GIOA 4I60A 4QY8B 2IANA 4LKPA 4HKXA 3WFDH 5EDSA 1ET7A 4FFYL 1G7HB 4NX0A 4MYPA 3CSYB 2GTLN 4QRBA 3GSXA 1KXOA 5EO1A 4BZ1A 2WNWA 2XN9B 3ISWA 1N59B 5C9JA 4A7TA 1ZRUA 4YQXL 2WQVA 2P8PB 3BUYA 3DX1A 1JPGA 2IWKA 1ZA6A 4LCWE 2F6AA 3WVMA 4MQXC 4KZ0A 2J5LB 5FUCC 1PZDA 3W37A 2HFEA 2WQSA 1U8CA 2HA1A 15C8L 1NFIB 2OJEB 2IZAA 3NEXA 2YHGA 3TO4D 2CKBL 2HLAA 3GK8H 3BAEL 1R0AL 4FFZH 4NQXA 1WIUA 1FFRA 1T03L 1KTDA 5DFVC 5A2LH 2VLKB 1SWNA 4ZUWB 1FA4A 1F58H 5ANMB 4FLRA 5FA3A 3PGDB 4JLRA 5FYLL 3KYMB 4I48A 4OFDA 1H6UA 4K8RH 5A2CA 5B8CA 2IALA 1KQWA 4AQ8A 3MNWB 3NIDF 5TE7H 2EABA 2FQDA 2E75C 4HJJL 1INDL 1MUPA 4JQIA 5F96L 4HIIA 1E5ZA 2O5ZH 3D87B 2EXWD 3M8OL 4GAYA 5CINL 1F42A 3TV3L 3K8MA 3VRIB 3B2LA 1CU4L 4PJ8B 3ATFA 4JN2B 3TXAA 1N7YA 4XBGA 1NWPA 4QHNA 3RVTD 3VGAB 4N2KA 5SWQB 2YXMA 1RZ7H 4ZDHA 2Z31D 3HPJA 4IIQC 1UG9A 5I74C 3TBTB 2X3BA 3FCBA 4YBQD 4EQ2A 5A16A 2VZOA 1EEZA 2K6YA 4OJCA 3CBJB 1FN4B 1JYWA 2OK0H 1W6LA 4QF1A 1HXMA 2G60L 3CVIL 3X1NA 5ICYA 4XO4A 4FLOA 2CJSA 1W2KT 4MMXC 2HH0L 5D2LE 5DRNB 2QJDA 2IAMB 4B6ZA 2HVJA 1A8ZA 2NTFA 5GGQL 5F3BB 1JZUA 1WCBB 2VLLB 1DANU 1Q9OA 4DGWC 3S9DB 3C6SB 4UOJA 2RA6A 4P57B 1FE8L 3N0PB 2JI3A 2ZUTA 2IADA 3OG4B 5F2FA 2EZ0C 1PVHA 1HHIA 4OD3H 4ZMZA 3WFHA 2CCVA 5BS0A 4UQAA 1L9RA 1QBML 1LQSR 2XZZA 3BQUA 5CFAA 1OHZA 2BERA 3DTUB 5IB3A 5AW3B 3CU7A 2R56A 2NNAA 3FCSB 4J1UA 5E6IB 4G3YL 4XZ4A 3WLWD 3KNBB 2D2OA 1QWUA 4HPOH 1NEPA 4JPKH 2X2JA 3B6SA 5DJ2B 3OHXC 2Z1KA 3QEQE 5KVDL 5JR1H 1RPUA 2AK1H 2E0PA 5IXGA 4F9PC 4P06A 1N67A 1RHHB 3DOSA 3BVNB 2Q8AH 3VFRA 1SXNA 3C6LD 3F6LA 4PREA 5FXCH 1RP8A 3WAKA 4EUPG 2NY2D 2CRZA 3RWCB 1UYOX 4AZMA 3QEQD 3TV8A 2JIXA 4LQZA 5TF1H 3GSOB 3IPFA 3PL6D 5FO9B 5HZQA 4M7LT 2Q0ZX 3NTCL 3EJUA 2V7HA 3L9RA 2Z4TA 1CFTA 1Y0GA 1U8QB 3BSZL 4YPGA 3RKPA 2F5AH 5GSVA 3LXCA 5G2NA 4JKPH 1TW4A 1RV6X 1I4FB 1CFQB 1PGRB 2V17L 3BFQG 4F2MB 4QRRA 3Q8CA 4A39A 1G1CA 1TVHA 1B6DA 1JCKA 4GI6A 3MRIB 4NDMB 1GS8A 4ZO7A 5AZUA 3FZUD 3MJ9A 1MNNA 4IBLT 5E0QA 3GIVB 3N42F 3JUYA 1YCSA 3QEUB 5GS2H 3EXJA 2E76C 2RTTA 1TZIA 3IFOA 3FMGL 4LSSH 1CT8A 1D6EA 3DX0A 1DF8A 3LPFA 4LSUL 4YDIH 3U9UB 3RVXC 1OEJA 4OCYH 5E5LA 1CR9H 1QSFB 2X42A 1QR1B 2BOBA 1EHLH 5AVVB 4U0RB 4XE0A 3F05A 1WTGT 4JY6B 1SN2A 2DQIL 3T1DA 1PL3A 2QVFB 3BAWA 1KB5B 3H4HA 4S2SA 4Y8AA 1QRKA 4KZDH 5CD3A 5JD2A 5I30L 1SY6H 1ZHBA 1HHGB 5HCCC 2R4RH 2YRZA 4POYA 3ZDYE 1SPDA 5D5MB 1QFWH 5JW3H 1F4AA 3AS0A 4GRJA 4WVRA 3OB0K 1BAFL 5D1QC 3S8GB 2TRHA 3DO7B 2GJJA 3AKMA 1OGAA 3AS2A 1BPVA 3MNZB 4TTGA 1DQIA 3PIQB 3PS6A 4M6NH 4XVJL 3FQ1A 1P7KB 4DT2A 2W60B 3SDYL 2QZ5A 2QADB 5T1KD 3GMQA 3N04A 4OB5H 5H9LA 1KBKA 1CLOL 5JOPE 4NO0B 3ZE1E 5DR5L 1KV7A 4GO8A 4MAZA 3C5SB 4L1SA 4POZD 2CIKA 2Y6SC 3ATBA 2WUTA 2RHEA 4NQDA 3KH3A 2OCFD 4KDWA 1F2QA 1PZCA 2J1WA 4OZFA 5BVJA 1BJ1J 2R15A 1BQHB 1I7TA 1E6OL 3FTGB 3N2JA 4LARH 2ZXGA 1RK1A 3ESVF 5JOPD 4S1DD 4EIUA 2FH8A 4YHIB 1ROWA 4P2RB 5ELIA 2FQGA 5DQDH 2CJ3A 3T8MA 1FLRL 2KQMA 3L7EA 3RA7L 5LKFA 5F7WC 3C2AH 2IGFH 1KDIA 2VDKL 4I85A 3TH4T 4GRWF 2G5BB 3B9AA 5CILL 1MY5A 1T21A 2WXHA 5C0BB 2R0LL 1QBAA 1OCOB 4Y5DA 2LLLA 2RACA 3X17A 2NUPB 1WE5A 3NSYA 5FWQA 4E9SA 5DGRA 5A7EA 4E5XA 4JJOA 4M93B 4GW1B 4GRMB 4HJIA 2KERA 4PJXE 3PF2A 1GMEA 1ZAGA 2R2HB 3L3JB 4TKBA 1W0WA 1SN0A 2HLEB 2OMNA 2CBSA 4M1DH 1FL5A 1D2UA 2Q2PA 3GMOB 5JIDA 4U6YB 1MHHA 3PRZA 3WS3A 3WJLC 3C8DA 3D39A 4QXTB 5ICXB 4P59L 2M1KA 4O02A 3D18B 3GKWL 1EFQA 1CBSA 2MQ3A 1E5YA 3FAXA 1LICA 2OVEA 1VYGA 1X8UA 3B2KA 5EFIA 5I16A 5DF0A 2J5WA 5J1SC 4CJ1A 2LAAA 3V4PL 4MJJA 4WWPA 2BHFA 1C8PA 5IVNA 3VG6A 2FEDC 4PLKC 3C5JB 2GIYA 3ZRSA 1T0OA 5I71C 2WUCH 4AC4A 1PG7W 1R3JB 3RBYA 1NDGA 3BYYA 3ULVE 3RDTB 4NLAA 4WWKA 5CZVL 5K39B 2IG2H 3EYVA 3FQTA 4NHCL 4BFIB 1FVCA 1T04A 4LFHG 1L7TL 2OM5A 1MWAL 5BMFL 2HKHH 2H6UA 4URTB 3UEQA 4OZ4B 2FLJA 3MRPA 4JPIA 4P3CL 2VLRB 3K3QA 5BRZA 1EUTA 3L1FA 4DFIA 4LRNH 3G6AB 4PRDB 2NY5H 2W88A 4XVOA 5GGSA 4GLRH 3VSQA 5LUMA 2EEBA 4XNDA 3EDEA 2EUVA 4Z7WE 3L4ZA 3QI9B 1NGXB 4YXLL 1JQPA 2ZT9C 3HS0A 2A2GA 5CUSH 4PRHA 3NSJA 2VDNB 5CJXA 4KGLA 3N1PC 5LBGA 3T77B 4B55A 3BWSA 2FWUA 2PWHA 1D5IL 3EOTH 4FERA 1NCHA 3FSWA 1KCVH 1RZ8B 4HGWB 2B2XL 4X7TB 4X9IA 3K6NA 4WHYH 4ZXBA 4KK9C 3GI8H 3UCQA 3BSHA 4U4IA 1NOLA 2ZE0A 4WKZB 4LHJB 3OJDA 3PHOB 4MXWL 4YKMA 1KJ3L 3OPUA 4UINH 3FU5A 4JVUA 5DURB 3ZE2F 3HLAB 5C2UB 1H6FA 2YJQA 3FN3A 1INEH 5KSAC 4C8XA 3QORC 4PFEA 1S8DB 2DWDA 2KI6A 3OMAB 2PO6D 4Z7UE 4AC2A 1JV5A 4XHJD 1KPRA 3FRUB 1N9YA 5LXVA 3HA0A 4RSYA 4KRPD 3D07A 4K3EL 1G1KA 5EF3A 2VM9A 2OLDA 5FYJL 4KY1H 1A2YA 5HHXH 5MEOA 3ELZA 1NFDE 1GT3A 3V0FA 1BOGA 1U92B 1MFDL 1YY8B 2AGJL 1GTNA 3D06A 2H9GA 4OI8A 1A7RL 2ILLA 1NQNA 4HPYL 2E9BA 3H9YA 3QJXA 1AVDA 2WIIA 4L29B 4KMTL 1V10A 4HKBB 1Q9WA 3VXUE 4WNQA 1IU1A 2DB8A 2BIPA 3FU7A 1QPPA 4QGXA 2MMXA 5D7IF 5EUKA 5E2WH 5FYLE 3AB0B 4AIOA 3SE9L 1ZJBA 1M7XA 4M03A 4UV7L 1E28B 2VW4A 3RFRA 5DJ8A 3EYOB 4PJFF 3SZKC 1MJ8H 5T1DL 2R69L 2W59A 3CFIC 4GAJH 3BUPA 3LQMA 4NPYA 4FQ1L 1G9MH 4GKNB 3RVUD 3NP1A 1DQMH 1F45A 3VXUD 3DX3A 2R51A 2IZLB 3QXVA 3PABB 3PREA 3RTQA 1ZS8A 5FYLD 5IBTH 4AZ8A 4PJAE 4BKTC 1UKSA 3OWEA 1YPZE 1AVGI 2YUXA 1DZJA 3D9AL 4YSAA 1H3PL 1D9KB 5IQ9A 4OZFG 5HYQA 3QWOA 2HT3D 2LVCA 3QVAA 2X5PA 1G0DA 1I31A 1IEAB 3MV9A 5AKVA 2QTVA 5T5FH 4GI8A 2HG0A 3MACL 1G7LA 4BSWB 1WWCA 5GS1C 3WY2A 1QATA 5IFJB 2CO3A 1VRSA 5JPNB 1BVLB 5ESVA 3MBWA 1YN6A 1J0JA 3Q2NA 4RMBA 3BKJL 4ZSOA 5B38A 2C9SA 3IJ8A 4LLVA 4BUGA 4NKOA 1JNHB 3ILPB 4NZRL 1SBSL 4IRWA 5B4MD 4NIYE 2CPCA 1QTYT 3SOBL 2A9BA 2AJZA 3VFSB 4E5XG 3CNKA 3THMH 5KANG 4ZGFA 5E1HB 1JE6A 3SQOL 4Z28A 4W1TA 1F8TL 1HTYA 1EMTH 2ERJB 2OL7A 5E8PA 5C07A 1HI6A 3R18A 1T66D 2YZ1A 4PYGA 3UTTA 2NNEA 3DHPA 3PY9A 2H0EA 4P2QB 1DLHB 1WS7A 3CQFA 3SGJC 5KVDE 4GKSA 3NFSH 3D34A 2P4AB 3QUMH 1OALA 3VNZA 4JRXB 3UTZB 3FQRB 3JV0A 4JL2A 4MAYD 4JEGB 4RDQG 5EU4A 5H94A 4YHYB 1E8YA 5CBAB 1G7PB 1WWBX 2P48B 3ZR6A 2DIBA 4OUUA 4LLMA 1P1VA 5L4FA 4A7SA 1CQKA 2JQMA 3BYTA 2OYMA 4YVUA 3WE6B 5HI4C 2G4GA 5HYJB 2AK4E 2VN5A 2R2EB 4H7VA 1MDCA 4XCEA 5FUCE 5TDOA 4GS7B 1FG2B 3ZKQD 1C16A 3T3PB 4BH8A 3PAUA 3BQVA 3K2UL 3LB6C 3QIBC 3TIDA 4FG0A 5LGJA 2VMCA 3G6JA 1B0WA 4WTZA 3T08A 5C0NC 3B7SA 4PJCA 3LKSA 4BQBA 2AK4D 4EVNB 2UX6A 2R8SL 3REWB 1HXYA 4OLEA 4MQXD 3NVQA 2FYYA 3QNFA 3AREC 5EU6A 1VFBA 2A7BA 4X9BA 2NR6A 4N2HA 4CUCA 3KM2A 4GXUN 1E2WA 5C0GA 4I2XE 1USQA 1NP4A 5AKTA 5FF6B 4M61A 4HKZA 5DFVD 4BE5A 3KWXA 4Z3IA 3PWNB 5DHXB 4HWBL 4EKJA 4YHPB 4L1NA 5L8KB 4FG6C 2DYPA 2CGRL 2R0KL 4XC3H 5KSVB 1OKEA 3FDWA 5AQ6A 2X70B 3V6OA 4A2MA 3I75A 3O22A 4BUHA 3HR5A 1Z5LA 4ORRA 1OD7A 2EDJA 4K2UH 1E27B 4ORSA 5GRZA 2KTDA 5IEKA 2YXWA 3RU8H 1J0IA 5E6UB 5DUPH 3BI9X 4BBWA 1A02N 4G6FB 3LRGA 3KPMA 5KTEL 3PFQA 2X40A 2DJGA 3HTYA 2DN7A 2DKSA 4L8SC 1E9QA 4LSTL 5E8NB 3VXNA 3CXDH 1WAAE 1YNLH 3PH6A 4HC1A 1EJOL 4NQEA 4LPXA 3WV0A 2QR0B 3FC8A 5C71A 2GCYA 1HINL 4PRAB 4MJ6B 3ZZ1A 4FADA 1SQ2N 1W0VB 3L2NA 4OT1L 3DIFA 4PEEA 1UM5L 1W6FA 1ZK5A 4AMXA 3NUKA 2ACOA 1HQ4A 3VG7A 1J0HA 5IFHH 2AITA 2JCCF 1BVNT 3FUIA 5GRUL 5BRQA 3X13B 3T2OA 5F9JA 3NIGF 3KL3A 3CHSA 4UOZA 1QABA 5IBLC 2N93A 3NIFB 4MB5A 4LVNC 1G9NH 4NNSA 2EZ0D 5IIEA 1FNHA 2WVUA 4Y16C 1NINA 3W0WA 2WSDA 1KTBA 1QO3B 2YK1L 3BO8A 1ONQB 2X6UA 4O2FB 3HC2A 2D7NA 5KYXB 1G7JB 3ES6A 4G8GB 1XO8A 3ZL4L 1CTNA 5HDBF 2D31B 3TS8A 4R0LC 1TSRA 3GXPA 5I6KA 4DUXA 3DDGA 1B0GA 4XI5D 5E00B 1GKOA 2W0KA 2AZAA 3VI4B 4U3SA 1ADQH 5A40E 5CCHE 3NZ8A 2Z8WC 1HSBA 2BJML 2JQAA 3FENA 4HS8H 2YPLA 3T0XA 1A18A 5F8QC 1FJ1B 1TCMA 5BW7C 2YKLH 2XVBA 3UC0L 4PY8J 5EC2A 4PUBH 3NQ9A 4ANXA 4LLYB 2WXNA 4Y2OB 4Z7VE 4AZPA 2N0MA 5CWSB 4XO5A 5F7GA 2AMUA 3FQUA 4CDCA 4RLDA 3MV8D 3TC9A 3MQIA 3OHMB 4UNTA 4AEEA 3KGRA 1LP9F 1T22B 1WK0A 4R7DB 2K9UA 3SPVB 3O0RH 2ICWA 4NRZB 2EDYA 1NEZB 2OX5A 4CVWA 2RFXB 1CFSB 3K46A 4ZHDA 1GJUA 4GW5A 3KLLA 4P9HH 5DDHA 5SX5H 5H4ZA 4V1DA 1IFGA 2W65B 2B5IC 4NQTA 5C09A 1J7VR 5B38G 4X7EC 2F08A 1QZNA 3CSBA 3NPSB 2QQLL 4GKLA 5HHME 3WY4A 2D0HA 1MFMA 2LOEA 3OQ3B 4JREC 3TJPA 5BOZG 5KBPA 3S88H 3SYCA 3RVXD 3FB8B 1J1XH 1DJSA 2F7QA 3U7YL 3MROB 4XVSH 4JFHE 1JGUH 3JV6B 5HHMD 3WMPA 3APXA 2BSTB 1AHWC 4LBEA 5I0ZA 4RAUA 2UWEF 5KYWB 4OAWA 4UOQA 3VQ2C 5EZ2A 3ZW2A 4KXZH 1EFXA 1CFBA 3QUXA 1MCHA 1LNMA 1KZWA 5CP7B 2A4EA 3E7JA 5IESL 3GJEB 3T9WA 1EI5A 1PLBA 4OCSL 1MCOL 4OLZL 1AC6A 1EEUA 3PXJA 3GFUA 4JFHD 4BUQA 1NC2B 4ODSL 4JM2F 2OSWA 3QAQA 4E9VA 4KTDH 4JVPA 5DJXA 4ZBJA 2J8UF 5AZ2L 4QJ3B 1VA9A 3MNDA 5ADOL 5CCKH 4ELKA 3MNVB 1MUJB 3ZSTA 3QUYC 4RWYL 4IRSC 3HUJF 2HRLA 1S7TB 2JU7A 4MHHG 1N7MH 4WTZG 4X6EA 2R4SH 4EO5A 3HZVB 1I1AC 1U0XA 1QRNA 4NFCA 4TSAH 3L2LA 3QK0A 1ECYA 3L17A 4MNHA 1XGZA 2F8XC 1ZKAA 4N0YH 5T1MB 3LHNA 3T1FA 5JW4R 5DFAA 4J4PC 3R0NA 5C6TH 1KEML 3ARFC 3ARQA 1ZLSL 1BZ9B 1TVBB 2PETA 5E1AA 5GRXG 4C56A 1GXEA 1I8IB 4LHQB 3OSVA 4K5MA 4LEBA 4HK0A 4XX1G 4FQJL 3S35X 1JF1B 4U6HB 5FYJE 3TBWB 1XZ0B 2I9LA 4JR9H 4TQEH 4FLSA 2F5BH 2VJ0A 3F04A 1Y1DA 4BFEA 2AXHA 1Y53X 2EDOA 3MOQA 1CLZH 1ZS2A 3EYFA 2WN2A 3AFLA 4P46B 3L3GA 3GGWB 3MREA 5FYJD 4NJAL 1VFAB 4WY7H 1EDYA 2E4TA 5DI8B 4JW3A 3SY6A 1NDTA 3ZYZA 1U8KA 3GJFH 1SXSA 1L9NA 1IBZA 3WKMH 4BCXA 5CLWA 2G2RA 1NBVH 2E47A 2EVGA 1B9ZA 1XGRB 1RIHH 3L4TA 4K7PX 4BGLA 2G9KA 1H6EA 4ES9A 4KMLB 1CC3A 3BKCL 4B95C 1HZKA 4IB7A 2FLMA 4A66A 4ZJ9A 2PXYB 4FFTA 4CMHB 2YUWA 3KVDD 5DRZB 2BVYA 3CC1A 5LGKA 4GDZA 1FORH 2FEDD 4EN3B 1HVXA 2DIAA 5DHDA 3UBXB 5IOKA 1Q38A 4ONHB 3COOA 5DMGC 1I1FB 2QTEA 2QOMA 2ZUUA 2PP7A 1NC4D 3C5ZB 1CLYH 4BDVB 3MM0A 1O1VA 4ZFGH 4KK8C 1KBBA 3X2QB 1TZHB 1W8EA 3FB7A 3S34H 5KUKA 5IROC 1SWBA 4UU3A 2DI8A 3IAPA 4D8PB 1JN6A 3K5RA 3EW1A 1CD9B 1ZT4B 1VJSA 1IMHC 4QTIH 4ZTPL 3ALWA 4FA8A 4Z7QE 3CCHB 4FYQA 1N0LA 5HTEA 2NQCA 5A6MA 4PJIB 4F9LA 1KLFB 5F6HI 5LXGH 3R1GL 2GK0B 1XH3A 1MCBA 2XKUA 1C08B 1JHKH 3ZHDA 1WRFA 4XT1C 3X00A 3LZFL 1HOCB 5D6CA 4OELA 4Z8FL 2HYMA 1CI3M 1G94A 3FU8A 2YC1B 1X5YA 4FEIA 2PCPA 4ODHL 5C8JB 4GY4A 2R23A 5HSFA 3BRDA 3TA4D 3GHEL 3UGUA 1HH9B 2GSIB 1FGVH 3N9GL 3ARGC 3JQOB 5CLZA 3F62A 3MLVL 1M57B 1QKZL 2FGZA 3QQDB 4LKXB 2PY1A 3PWLA 2ICEA 2AS5M 3PE9A 2AKRB 4BCSA 3VAEA 2N7AA 2GBVA 1HWWA 3ZHLA 3I02A 1W6WA 3CZFA 1JGIA 1M7DA 3QDAA 1RHFA 4HW6A 4IRJC 2BY1A 5KUMA 3VSVA 5K9OB 5KSAD 1VGKB 3QORD 4J6RH 3R19A 2VXTL 4WTWA 2W95A 1X5JA 1QYGL 3KFIA 2CK2A 3QZWA 3S37X 3T4AB 3L95A 3VMOA 3HNSL 1U8LB 5L88L 2IPTL 5D1XB 5GISH 5DG4A 3BH8A 2XWBB 2CSPA 2AT8X 3FO9A 3RIAF 2RALA 3FFCE 4O00A 4YVBA 4JHWH 4JZNB 5HZ6A 1I06A 2H7WA 1CUOA 1IGMH 1XXFC 1S78C 1RH8A 4I4WA 5KSUA 5L4IA 2ASNX 5J13C 4IBZA 4IU2A 2AQ2A 5ISZA 3S98A 4QUOA 1GOHA 1IC7L 2DJSA 5D55A 4UTAA 4JCLA 2PYEE 5KN5B 4ZW5A 3H9SB 3FFCD 3MUY1 4FHBD 3FA7A 1SLDB 1X4XA 3BXNB 3GINA 3IMWA 1GHFH 4G8IA 3H56A 1U8HB 3P6DA 1XFPA 4HLJA 3K8KA 3O3AB 4FA7B 4M1CD 2X46A 3FQYA 1DDHB 2C1OB 2B59A 2PYED 1HKLL 3EYUH 2KZWA 3HPLA 4F92B 1A6TB 1H3UA 2NY3B 4KPHH 5C6PB 3QPXL 3VHHA 2WANA 2WTRB 4IW4C 1S3KL 3LKQA 3TNMA 12E8H 3FS9A 1G6RL 2K8QA 1SRGA 4ABQA 4PJFA 2QOSC 2VDOL 1JPFA 3TO2A 1V3JA 3ETSA 3MR9A 4UILH 1NMAL 5J57B 1AMXA 3BQUC 1EWHA 4MLIA 2OI9C 4ZQKA 4XCFH 2A3TA 1OCRB 3WIIH 2F19H 2GITB 4BWWA 3BP7A 4HULB 4DJMA 3CLEH 1UKTA 4LSRL 1TUPA 5IQ7H 4ID2A 3PHAA 4XMLL 4R96B 5BO1H 4XC1H 4OM0L 3UTOA 5HVHB 5H2BA 1XVSA 1M7UA 3GPEA 3KEHA 4FI8A 1Q72H 2WVSA 4X8CA 4NPJA 4BZ1L 1IAMA 1IGCL 1WEJH 3X3FL 3X1GA 1T83C 5CGYC 4ES7A 3B9DA 5SWZA 3UZVA 4I0PC 2MTAA 1KLGA 2OZNA 4C4BA 2V6HA 3FO2B 3LD8C 4X7SL 3GC3A 5EBWB 3SY0A 3FT3B 2M26A 1I82A 4TTDC 1J05B 1KT5A 5JW5B 3GAQA 4LSVL 4Y0QA 4L05A 5BRPA 5G5DA 2WB7A 2A73B 4MMYB 5JDSB 4ILDA 3FUKA 4XBPA 5GJTH 1MAKA 2QPUA 2GAZB 2ZAGA 4GG6E 3N0AA 4CVUA 2NY1C 3ZZSA 2NW2B 2E46A 2Z7UA 1HYSC 3HC4H 3MLWL 4OLYH 2F53D 3II1A 1I04A 5D7SH 4KBPA 5FO8B 2AF5A 1B2WH 3QC5X 4OD1H 4MVLA 4DQ3A 1FUNA 4I3RH 4IRZH 3ZIMA 1IAKA 3QIUB 4I5BB 1LMIA 4PJ9A 3G9VA 2DWEB 1U3ZA 1E8XA 1ORSB 1QPXA 3QW9A 4HWZA 1OAUL 4JQIL 5F9WB 5TQ2H 4M7MA 2OR9H 3U0TA 2H47C 2Z34A 2FAUA 3EGSA 5D8JH 2RR3A 3ATEA 4NFBA 3QIBD 3LB6D 3O4LA 3OKNA 2DTML 2JB6B 4PMFA 2O26U 4H8QA 2BDNH 3VD4A 3MODH 1PS3A 2K45A 1UWGH 3RGVA 3WS6A 5C0ND 2HFTA 3Q34A 1XIWB 5GQBA 2VIRB 4L4TB 4AYEC 3P77A 2N01B 4FFVC 2WINA 4XPAH 3IRZA 4L3EE 4JRFA 4DKTA 3MRBA 1A22B 2ARJB 1E4WL 5E99L 1B3JA 4X5LA 4FXKC 4PG9A 4AT6A 1CI5A 5L4MA 1FRGH 3U4AA 5DJ0B 5FFGA 4PJEB 4ECNA 3US9A 2LABA 3GE2A 1URLA 1SJMA 4QHPA 2ODHA 3KJ4C 3D33A 4H1LA 4L3ED 5I28A 1GS7A 1HL5A 3ARUA 1AELA 3GBEA 4JM4L 3SCMA 1BBJB 3T8XB 5JHDB 2W8CA 4OZIE 4Z5RB 1IGFL 1G9HA 2ZYHA 4FOMA 4TUJB 4MMZB 2A4CA 2QV4A 3H9ZA 4LRIA 3S36H 1YUHB 3B2JA 3NEEA 4F7KA 3EYQC 3MUGA 1I53A 1RLWA 2DW5A 4Q7DA 2JK5A 1PYWB 1RUKL 1HAWA 4LSDA 3F7QA 5I6LA 4XHQA 3U2SB 2OY8A 4Z3GA 1UREA 2YAHA 1DJWA 2BIIA 2Y07L 5DD0H 2MJIA 1TOWA 1V7NH 4KO5A 4LLWB 2H3NA 4R97C 2IH3A 5EZJB 5C7XH 1MOYA 3O6ML 1NUGA 2R0WH 1P4LA 3CIQA 4JRWA 1KELL 2X4OA 3MLSH 2I60L 3FU3A 1AQKL 3UC2A 3DXAA 3APWA 3QZWG 5SWSB 4J3OF 4NBYB 4JQVA 3GJFB 5L9DL 1A9VA 2OMWA 2FWSA 2VRKA 3PWPB 3KWUA 4KH2A 3VSTA 5INCA 1H5BC 2YA1A 4UTBA 3MV11 4ONFH 3PJSB 3S96B 5DUBB 3II2A 5IBLD 2WYTA 1SRFA 2YMXH 3RGHA 3RWFB 3RIAK 1ZLDA 3JV4B 4WHTB 2A83B 4Y16D 3U36A 1UWXK 2WWPA 1NANH 3D2UB 2PCYA 4M4PA 4N3UA 2A0LC 4QRPA 4AJWA 4BCZA 3SDXF 3LPPA 2XKNB 4XNYL 1MCWW 1S7XA 4IKIA 4G5AA 4HJTA 2JCCA 5DEFB 5DMJB 5F9AC 4C4UA 3IDIA 3KS0H 2WBJB 5E08L 3SZ6A 5M94B 3RPIB 1KCRL 1M42A 4ODWA 4W68A 4NQSB 2ZKHH 4A67A 5IM7A 4MWFB 5ACLA 2RGSA 1GH7A 4JANA 1VWEB 4IEFA 5EEXA 3HJEA 4B5ZA 4AG4H 5JPMB 3V8UA 3ZDZE 2K0RA 3W82A 2YSTA 2X34A 4ANWA 4DUVA 3LMJH 2A9NH 1S9YA 4MDJB 2H45A 3F7LA 3IF1A 4PVNA 2UVFA 5AW2B 3VDCA 3SE8L 4JL1A 4NI6A 4OBRA 5T33L 3N40F 4MX7A 1TTUA 4ODVL 3LQZB 3KPQA 5GRVK 3P6CA 2KQNA 5ETUA 3IKKA 3ARSA 3CQQA 5EUOE 1AFVL 4D3CH 1F2XK 3VXME 4NFDA 1GAFL 4OLUL 1UYWL 5F1IA 2H6PA 1NLDH 3G5ZA 4KFMA 3AM8A 4CSPA 1O75A 1B8EA 1SJHB 2J72A 2IPKB 4WTQA 1UA6H 3GT6A 2BY0A 1YEKL 1CCZA 3SJVA 1WLHA 3S35L 4NV7A 1G7MB 4NQCB 5E56A 3FOLA 4NOFA 3VXMD 1A7NL 3UDWC 2OMXA 2IDUA 3OG6B 4K3DH 4PJ5E 5AW0B 1RZKL 4OSUH 4Q14A 5E2VL 3VI3E 1E2TA 2BHZA 4BFJA 2O5NA 4UQ3B 1IM9B 4XB3A 3HOGA 1KWKA 2E7HA 4YAQB 5ALBH 2ALWA 1K4DB 2WV3A 3RE5A 4QJ4B 1R3KB 5CJXC 5J8OA 5B1JC 4PJ5D 1NM4A 1LP9A 2FQEA 2Z9TA 2IBGA 2FR4B 2VR8A 3QDME 2V5SA 3BP5B 1AGFA 3QJVB 1G84A 3CPLB 3H42L 1P7BA 4ZXBC 4H20L 3L9YA 2BS6A 2QMIA 5FDWB 1SWEA 4MNQB 1STRB 2R2BB 4RMRA 5BQ7B 1MQKH 3PXLA 3HOLA 5C08E 1IUZA 4K7PL 5DEJA 3EOAA 1ED3B 1WV7T 2VDRB 2DLEA 4NWTL 1WC7B 3QRGL 3QDMD 1HL4A 2BSEA 2CBMA 3PQYE 3MCKA 4LL1A 3DRQA 5FV2A 1VB9A 4U8UN 5DZNA 3FNKA 3DRTA 2DQUH 2Z4QA 5JNYB 5FW8A 1W16A 1JCVA 3GBML 1AXSB 5C08D 5L8IA 2UWEA 3D0VB 2EDXA 3D09A 4ZFFB 4NZUH 1ZSDA 1JMZA 3PQYD 1Z3GL 4MA8H 4WEBL 3O19A 5EZOH 3OBAA 5KBLA 3QUYD 2FS7A 3ZO0A 1U21A 4IRSD 4LVHB 2YMSA 4XTRC 1WG3A 4M4RA 2Y3AA 1J87A 1KJVA 4ZOBA 3NCJL 3Q6FA 3DX4A 3FLLA 1A0QH 1I1AD 4WO4B 4ZMYA 4ZTEA 2AT6X 1I8KA 4Q6KA 4EIGB 1SA8A 1UUNA 3W9DA 2ZXDA 5F6IC 1Q0XL 2CDFA 3DSFH 1ZWIB 2E8YA 3GTVA 4Q6YA 3M17A 4O02L 1O7VA 2A77L 3ARFD 5ENWA 2F8VA 1T4KA 2AT0X 4EEEA 1SHWA 4G6JH 2MIZA 1THCA 5K67A 4LKTA 2Z0UA 3HUJA 4Y7MA 1PFOA 2V2WB 3I50H 2CNZA 3LKOB 2HKAA 3V52L 3WFEL 2WQAE 1R3IL 4H1LG 4ATWA 4BFNA 4DZ8B 1OAZL 3VWKB 1OHQA 1S7UB 5JR8A 2NW3B 1XB6A 5AZEH 1BLNA 3DVFA 4K7FA 1U95A 4WSGA 5CGTA 2VQ1A 3I17A 5HGGS 3WFCL 2EQDA 1UB5A 2ATKB 1WFJA 2VISB 1TJIL 1OF2B 3D51A 2BIOA 1I9RL 2CBTA 3N44F 4Y5YC 4DFHA 4OCWL 3IDMA 1OP4A 1DO6A 1QTPA 1AP2B 3P30L 4KO7A 4NO3B 4I77L 4AMKH 4UZSA 1U58A 1GTFA 5K9KA 4DAGL 3CVHH 3GXNA 3CQNA 2X0UA 2A9MH 1ZNKA 2HRPL 1W8NA 3P4MA 4H25A 1SRHA 2K23A 2KW1A 3JVFC 2DJ4A 1K5NB 3EFFA 3VXPA 3EC5A 4OV5B 2ZXQA 2APSA 4FF9A 5EIVA 5DFWH 3QNZB 5LHDA 4L4VE 4Q97A 4MISA 3V4VH 5JW4N 1QWNA 4TF4A 1NIDA 3N40P 1AVAA 2YRPA 1C8QA 1F5WA 3MC0A 2MM3A 4CU7A 4RMTA 5AAWC 1AGCB 4KJPC 2BNUA 2DLFH 5HHQA 4N5UA 1DQLH 4Z7NE 1PY0A 1YEHH 5DMGD 3PPEA 4IGBC 5IMOA 3FB6B 1PZBA 4MRCA 5E4OA 1JJJA 1TKWB 4PJHF 4HOMA 4L4VD 3CBSA 2YR3A 4PWFA 4KK8D 4O5LL 4QTHB 5J6SA 3MX7A 1U93B 1BMGA 3DROB 4RZCA 1MFAH 1T5WA 2WLLB 4NYLB 2RMNA 5IROD 3WKNA 4OCXL 1D5BA 3KPLA 2FRGP 1HHJA 3QEGL 2IANE 2P9RA 2C3HA 4JG1L 4LCIH 2JTYA 3W39B 4NNYB 3O8XA 2XFXB 5CJQL 2YA0A 5AVSB 3VE0A 3NT0A 3C2SA 2WPGA 3P4NB 4X4XA 3QARA 5B3JF 1LEIB 1UADC 3ULAB 1T2JA 1KN4H 3RY2A 3S26A 1PZSA 1NCUA 5EU3B 1JYJA 2CRMA 1CIDA 2IAND 3VRJB 2HVBA 1NDJA 3IETB 1A6VL 2DQJL 3AY2A 3FQNA 4JY5L 4X80L 4OQTA 2IZHB 2BRRH 3AU1A 3Q5OA 3LNEA 3VFNB 5CAYB 4MDRA 3QFGA 3ARGD 4N2IA 2OXGA 4AE1A 3LKNB 4DP4X 4OCRH 1T5XA 2BVQB 3L13A 1NBXA 1VYOA 1N5AA 3A4DA 2NXYB 4OZGF 4QXGH 3H3BC 4YSOA 1OANA 2NR6C 5AG8A 3GXDA 2N7SA 4IRJD 5DA0B 5F7DA 5IKCB 2HJFA 4FNLL 4TLKA 4CA4A 3BZ4B 4X50A 2WZ6A 3RDOA 2F15A 5I1LA 3H3PH 5FOJA 1G43A 1HKFA 1KIPB 3KE0A 5FX3A 3SDAB 1ZE3C 4NUJB 5I1CH 5HD8C 5FWRA 3NCMA 4INNA 3MXWH 1U8IB 4GQZA 4YSPA 1MI5B 4HP5A 4FXGB 2Z7ZA 3OLGA 2POAA 2RTNB 1NL0H 1GY1A 2H3KA 2QT6A 5F7MC 1KIQA 3KYAA