3P02A

Crystal structure of a protein of unknown function (bacova_00267) from bacteroides ovatus at 1.55 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
314
structure length
308
Chain Sequence
WTDEQFKQLISFKTQPGGWGVTDVHVRYANSAKYTYNLPVVSGTDDRLVSFSLRDDTLDILNFEKFGNRPELYFRELPQKYYSFPKELTIPAGQSHALLPIEFSLDGLDDSQKWALPLKVCEDNGTYAVNPRKYYRTAVLRPILFNEFSGRFSGSSLLGTMAGESDIKFSSTEIKLNVVTDSIVFFYAGQRTEDYEDRINYKVFLQFTGDKVDSKKDLYKMKIWAENEKLKFNSYSTPTYKVSSEMDATKTYLKHTYIVISDIDFDFVDYTSVPNYEIEYNMKGGLSVSRDLDTRKPDEDQGSDSKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a protein of unknown function (BACOVA_00267) from Bacteroides ovatus at 1.55 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Unknown function
total genus 78
structure length 308
sequence length 314
ec nomenclature
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14274 DUF4361 Domain of unknown function (DUF4361)
A PF16343 DUF4973 Domain of unknown function (DUF4973)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.440 Mainly Beta Beta Barrel Lipocalin Lipocalin 3p02A02
2.60.40.1740 Mainly Beta Sandwich Immunoglobulin-like hypothetical protein (bacova_03559) 3p02A01
3N91A 3NQKA 3P02A 4DQAA 3SOTA 3POHA 4QNIA
chains in the Genus database with same CATH superfamily
4J39A 1AJ7L 3IDUA 1HHJA 2VGLM 1OSPH 1X6LA 3OKKB 3FQXA 3H3BC 3JWDL 5C07E 1UM6H 1B0GA 2GY7B 4QXGL 3K8KA 1MCOH 3AT8A 1SRDA 4IMNA 3JWNE 2A74B 2KZKA 1QG3A 2M4LA 3ILPB 2DLFH 3QZOA 4TMPA 4YO0B 3SOBH 7CGTA 1YMMB 2CM6A 3HBZA 3M7FB 1HEZB 1LICA 2YOAA 3AZUA 1EDHA 2YSSB 4GAJL 4HJGB 1FNGB 4U6HA 5JIIA 1FYTD 1FFPB 4HV8B 3WBGA 2CHZA 4GUPA 5E4OA 3FYFA 2BVYA 5ETUA 3BCFA 4LLQA 3TN0B 5DEFB 3A4FA 3GE2A 1PKQA 4H1LH 3I75B 4XCEB 3B1UA 1CO1A 1E2ZA 4KQ4L 4Y2OA 2H6OA 1J5CA 5HZQA 4YIQB 3BH8A 2FJFB 1B6DA 4O5LH 5EBLA 5J06A 3VWKA 4GG6E 1JGEB 5DJ6B 1LGVA 1TTBA 1RZ8A 4ODXA 4QJ3B 4PJIA 2VZOA 2R23B 4PJ5B 5C1MB 1IEHA 1AP2A 3LIZH 3P54A 4K3DH 2H1XA 4CKQA 5TPWL 3QULA 3WYRA 1BIIB 3DO7B 3PGDB 5JD2A 4QRUB 3N9GL 2WJ7A 5FYLH 1A7OH 1QLFA 2F09A 1QAWA 3DX7B 2G5BA 3FH5A 3PHQA 5E2VL 5GRWA 5AAMA 4AITA 3SYCA 3FU6A 1V7NH 3QG6B 4PVLA 1TJGH 2AK4E 2ZX9A 3LPPA 1SHMA 2OI9B 1BBJB 1EZUA 2AKRA 3BGFB 4Z0XB 2OMVA 3SHSA 4HWEH 4YLQT 3TF6A 4OS8A 4HJ0D 2JJTA 2EYRA 2CKBB 3SZKC 4JZOB 4OFQA 2BZ7A 5AUMB 4AMKH 4RA3A 4F33A 1RIUL 1F58H 3MSPA 1NIEA 4X5QA 4HUUA 3CHRA 3RNQB 1E67A 1G7JB 4LHUD 1VWJB 2VM3A 1B90A 4IS6B 3RWJA 4BCXA 4KKZA 4JRYD 5A7BA 2DI8A 1KEGH 3KYNA 1RQ5A 3Q5YA 2VIRA 3Q2VA 4M5TA 1UWYA 1KYFA 3V4PA 1FNSH 4HDIB 4S2SA 2MWHA 2AITA 2DLIA 1WITA 2CJUH 4HWZB 4JR9L 5LGHL 1M53A 3PP6A 3AKMA 3ISWA 2Z65C 3IWVA 1B9ZA 4BBWA 5CIPH 2JF1A 1P4LA 2VLME 2APBA 5AW7B 4GMSL 3VXTB 1P5VB 5I1CH 3VQ1C 4MAYD 4MVEA 3MUHL 4G1MA 3UTPE 1S9KC 2ZWKA 3Q3GB 4MA3B 4Z7QB 5C0CA 5E08H 3WZNA 4Z7IA 3M46A 4AV0A 15C8L 2I07A 4NXSA 3ZDXE 3J8F7 1HC1A 3MTXA 1BYOA 1CGSL 2FRGP 3E6FA 1OGAA 1UEYA 4KQ3L 3LOWA 2DMCA 4KHXL 1R3JA 2IMMA 1W5RA 1PLGH 5EF0A 3W57A 4QOKA 1OTSC 1JJXA 1ILUA 4JAMA 5KS9A 4OMWA 4GBXA 3Q8AA 4IOSD 4MRCA 3ELZA 1DR9A 3RKGA 2Z8RA 2VDRB 4ZO9A 3TT1H 2D9QB 2DIEA 4IDJH 3L4CA 2YPKB 3NGBB 4N2KA 5I1HL 5H35A 3QR0A 3W5MA 4G9DA 4OF3A 1CDBA 1EJOH 2WUBL 3BFWA 2JELL 4TSBL 3RFZA 3EO0A 1BQ5A 5E5RB 4UYPA 4PAZA 2E46A 3T0EE 2FDBP 2X2YA 3BZEB 2NW3B 5K9KB 5DMKA 2HFEA 5MERB 2ZPKH 4OJCA 1ZWIB 1DSFH 1TXKA 1F0LA 1SYSB 1IGFH 1MVFA 3IN0A 4KY1H 1ZV5A 4PV8B 4UT7H 3IFPB 4X8XA 3WDJA 2NNFA 3PGDA 2FBOJ 2ZX7A 1SUJA 4FQ1L 4AQOA 4HUVB 1P5UB 4AQ8A 3M17B 3NYKA 2FBRA 4I77H 2FHFA 4G3YL 5L2KD 3VFRA 1ZIAA 3T1WA 2ZUSA 1Y0GA 3FUNA 4PJXE 3D12B 3MOBH 3ULUL 3FFCE 3QQ9D 4KK5D 1NC4B 1F6AB 1YY9D 4JZOA 4KH9A 4KQ0A 1FORL 1EZVX 7FABL 2W60B 1TLKA 1VEMA 4WHDA 1OY3B 3E6HB 3BSZL 5AVYB 2P43B 4FYTA 3JQOA 2FJGA 1PSKH 1GMEA 1WG3A 5DS8B 1O7SA 4NQEB 2PWDA 4B3EA 3T71A 2XRAL 1S7XB 4RAUA 1V55B 3GMNA 4QAEA 5IO5A 3F84A 4X5PA 1RUAH 3EGXA 3G5WA 3HS0B 3TNNA 4F8QA 4ZMAT 1RSFA 3KGUA 4YDLC 3WEXA 2XFXA 2CRIA 1DJHA 1M7UA 5JDJA 2F58H 2EDYA 3FB7B 5DYFA 2Q8AH 5BOJA 1Z9OA 4B97A 3BEWB 4XVUC 4PWIA 4XE5B 4HC1A 1YEFL 3B3BA 1QLEB 1YUPA 4JPKH 4X9IA 1GKAA 2OJ1A 3ZHFA 1CRBA 5CD3A 1UXSA 1BM7A 3IXTA 3QAZC 4FKKA 3MGTB 2GG1A 3TBTA 3W39B 4QY8B 1TZGH 4CJ0A 4ENEC 1MCQA 4MHHG 3TH4T 2IG2H 1KL3A 4M9OA 4RISL 2BSTB 4HIXH 4N2AA 3NABL 3FO2B 4DWHA 3F7RA 2WN2A 3WO4C 2XV3A 1YMHB 4RZCB 4YE4H 4ONGH 3EYUL 4QEGA 4JY6A 1XCXA 3FL7A 4KKLC 4N25A 4YGVA 3L3KB 3LB6D 2X6MA 1S7UB 4XCYB 5KSBF 3CFKB 3MRQA 5HGDB 3KH3A 3WI9A 5CMAB 5CJOL 4HS8H 3VRJB 2JKIS 4P4RA 3D39E 5CSZB 2ZCZA 4O3XB 1R4XA 2F6AA 1SXNA 3TPUB 4GY4A 3RDUA 4A6YH 1SRFA 1W72B 1MQKL 2G2PA 3EGSB 3HG5A 1AD0B 3L3OA 4PCYA 3S36H 4ZMLA 4B27A 3HPEA 4BSVB 4NRYB 3M17A 1Q8MA 1CR9L 1KCUL 2J5LB 2YKLL 4LMQE 1B8EA 1I8MA 3BUYB 3UP6A 4BD4A 3EH4B 5E00B 3O9WB 6FABL 2YEZB 5DQJB 1KT6A 4EE2A 1IKNC 4JFEE 2VAAA 1OF2B 2IDQA 1ETB1 1F00I 3I3BA 5JO5B 1Z3GH 4Z77B 3BAJA 1RZFL 4RQQA 5CLWA 1DUYB 4BCSA 3D4YA 4TJZA 3RTQD 4AT6B 1JGVL 2KLTA 4W9IC 4XNQB 3KXFA 3VFPA 2FYVA 1JYJA 5JW5A 3BFQG 4GSQA 5AB9A 2CM5A 4L3FA 5T33L 2NZ9C 4B41A 5KANG 1E5ZA 2WXPA 3LD8B 1YHPA 4DKEH 1N0LB 1QHPA 3VTAA 4ZMPA 1RH8A 4PJ8B 5K9OB 3EH5B 3WNLA 5GS2D 1P7BA 1X8PA 1NCCL 2C1SA 1U0QA 1JZHA 3UTTB 2GTWB 1Y6MR 3MRPB 5KW9H 1OGPA 1IKEA 3MN8A 4FXGA 1ZT4B 3Q6FA 3II1A 5EO1B 4OZGF 4DGWC 1F1DA 3BAXA 5HZ8A 3I0AA 5T1DH 4ZO6A 1OVZA 1SY6A 2WXLA 3D07A 5E4IA 3FB6A 3ZYOA 3GAQA 2QQKL 5C0CD 4O2FB 5FUZL 5IESL 1RXLA 4XO9A 5I0VA 2HLVA 1IE5A 1FH2A 5JOEA 4JPIB 1QSFB 2NYZA 35C8H 1AE6H 1OGAD 4XVTH 4K0OA 3EFDL 4LQFL 2BVOA 1M1XA 3BPNB 4LASL 1T5XA 2CXGA 3SBPA 1ZT1B 2BSSB 2W07A 3MRFB 4PJ9C 3ZTCC 4JQIA 3GJFB 4DQOL 4M5YH 1PDKA 2OMBA 3KPSD 2W0FB 2XWJB 2GEEA 3AREA 4JL2A 1FG9C 3S2CA 4LOFA 2WIMA 2A0LD 2QTEA 3N42B 4L4JA 2YOCA 1MCCA 1M71A 4HK0B 4JRXE 1SWUA 4HSQA 3TT3H 4KPHL 1EI5A 4GAFB 1H6FA 3C2AL 2L3BA 3BD5A 5EBMA 3T77A 3ECVA 4OZFH 5IESH 3CMOH 4CPFA 1ASPA 3BIBX 4DW2L 2YMTA 3SGEI 1T66C 4JMXA 5A2FA 4QYOB 3GSNB 4JZNA 5E70A 5T1KA 1ID5I 5JQHC 2VR4A 4P48A 2WQ8A 1QSEA 3STLB 1BMGA 4OS0A 1GT3A 2AEPL 2CPCA 4NKMB 2PUQT 5LAXB 4KTYA 1CG9B 4XI5D 4HPHA 3GNML 2WTPA 4YDJB 2AK1L 5G2NA 2X4TB 1R3HA 1AXSB 4LSSH 4Y88A 3SGJC 3UZVA 1HMTA 2PYED 3VFNB 3PNRB 3SD2A 2P1YA 1WAAA 1JWUA 2DBLL 3C60C 1D5IH 1GRWA 4ORZC 4YR6B 2DKUA 4ZBJA 2EH8L 2ZSVB 5EZPA 5GJTL 4Z9KB 1AQBA 3D4ZA 1YUHA 1FNEA 3MU3A 5CILL 1Y6NR 3OZKA 4XMPH 1NAKH 5DK2A 5B22A 1LO2L 4ANUA 3D4RA 1NGZB 2NY7H 1P6AB 3HMWL 3EBKA 3QI9B 3ZYJA 3GK8L 3RWEA 3EJUA 3QNYA 2GTWA 4PR5A 5GGUA 1EPAA 1JZDC 3INUH 3NEXA 2H3NA 5L4JA 3SKJL 1ZA3B 4LLWB 1YEKL 2V5YA 3MA7A 2AJZA 3I6SA 2ED9A 1CB4A 4HOZA 1U3HC 2MM3A 5GGVL 5EEDA 4M6AA 3B9VA 5JHDA 2WVSA 5TTRA 1T68X 1PEZA 1OE3A 5LNEA 4N0YH 1T5WA 2WQRA 2FIRT 2MIZA 12E8L 5EEVA 1AHWA 3BP6A 3WAKA 2WMPA 5EWIH 1PLAA 1MHHB 4FDWA 4WUKH 5I0YA 5GISL 2PWFA 5AW4B 5JR8A 4NQUA 1PY9A 2AAVA 3KVPA 4LOUC 3RX8A 3W38A 1DVFC 4PJAB 1IILE 3LEVL 4L37A 4IBZA 1SRHA 1I06A 1C5CH 2Z91B 2X6CA 5KVMC 4XN9A 2P5WE 4WK2B 1JK9A 1N0XL 1A4KB 5SWSB 4NENA 4DVBA 1LPJA 1I1AA 4HLZH 4HK0A 4YDIL 1XMEB 3RJOA 3WEMA 4OI9A 5DQDH 4NC1E 4OCWL 3WTUA 1F3RB 4W9FC 3KPOB 3PAYA 1B0IA 4U3HA 3IRCA 1OLZA 2QPFA 3ZT5A 5KHPA 1E8XA 2Y7NA 4XMVA 5H37H 4JO4L 2BIHA 3VWJB 4XOEA 1N4XL 3LS5H 3AQXA 3OBAA 3L4VA 4FQIH 5DJ2A 2BNQA 3MLXL 2IDUA 3PFQA 1T20B 2JTYA 1OBUA 3CKFA 4GE1A 1S8DB 4P07A 2E9IA 2YWZA 4JFYA 4O2EA 3N85L 4HH9B 1N3NA 2LQRA 3JBG7 1TQVA 1JNNL 4FI7A 3P6FA 1BXXA 2VERN 3IS0X 2A5CA 2EDHA 2ZUYA 4NP4L 4OFPA 3JT2A 4M62H 4P3CH 2PCFA 4F7MB 4F3FA 4XVJL 4DK6A 2ICES 2P24A 3TWYA 4L8SC 4S1SH 1ICNA 4QF1B 5ACZB 4I88A 1UACL 3POCA 3PWNB 1W8EA 3UJTH 1S5IH 3BP7B 4HGKC 3PIQA 2JNZA 4Y9FA 2HFTA 1A1OA 1X4YA 5HVHC 3ULAB 2DQFB 2IZCB 1ET8A 2VO8A 4E0RA 2OX5A 1H0DA 1KLGA 2ZXDA 1AYOA 5IB4B 2OSLA 3RWDA 3S36X 1XZWA 4B0MM 2FX7H 1HXMB 2BDNH 2MHAB 2EUWA 3BGAA 3WAJA 5CBAA 3KBHE 4JFDE 4BZYA 4OTXH 4QRQB 1KZYA 5MEOB 1RZGB 4OBRA 4XXDA 1R33A 3G6AA 4F1SA 1OCWL 2EC9U 2VZTA 3F2LA 1CE1L 3QFJE 4WO4B 5IB3B 2FBJL 3KPRA 2XQ0A 4ZG1A 3L3IA 1DQLH 2GJ6D 4FXTA 3ZQXA 2AJYH 1D3SA 4LLVB 2HX8A 2UZ2A 2WXIA 1R0UA 5H9LA 1WWCA 3BU9A 3VM7A 1KIRB 4TNVK 3F83A 5IO7A 3P24A 5GIRA 3RY2A 4Y1TA 2XX1A 1HJCA 5I17A 2Z35B 4QZTA 3KVNA 1A64A 1OAXL 4K8RC 3U7YL 4KKQA 1TOXA 3X1BA 3AY4A 4XXWA 4ODBD 4NJ9L 5GGSY 5I66A 3IVKB 1MRFH 3MV11 3BEVA 4WU7A 4EDEA 1D6EA 3S7GA 3BUBA 1FRGL 1K3ZA 1NOLA 2JKLA 3CZNA 2F7OA 3HG1A 4ODHL 1GYVA 4MNQE 2PYFB 2YMXL 3NACL 4QYAA 3OZLA 2XJLA 1WA2X 4NO2A 5BPPA 1F4YL 1MW2A 3S35X 2HT2C 4PCTA 2FEEI 1ZLUH 5B2AO 4WEMB 4LAJH 3WO3B 4PGCA 4UQ2A 4ADIA 4R9HA 1TZHA 2AABH 4WVRA 2Y1YA 3X12B 5JQ6H 4LCCB 1Q9KA 4KIIA 3JV4A 3OTTA 3R06A 5J11B 4IU3B 4M7JL 1W16A 1BYPA 2QBWA 2P5ED 3ARSA 4NN7C 5T1KD 4WWOA 4AZRA 2GSGB 5F3BB 2ATKA 1EVTC 2XXCB 3JSSA 5EF2A 2WK2A 2WQVA 5GGTA 1J0ZA 5HJ3A 3CWKA 1DUZB 4Z3JA 5BQ7A 5FK9B 1O7DC 1FZJA 4G8IB 4YS4A 5GRUL 3ZHNA 5IJCC 5CWSB 2RAMA 1QKZL 4BH8A 4FP8L 2A6KA 2R73A 3CQRA 2L68A 4FX5A 1T0NB 4JVUA 1NBYB 4ZMWA 4DQ4A 4G6JL 1E2VA 4UAOB 4ES7A 1Q4NX 4F7CB 5E1AA 3JWOC 2BS71 4QJ5B 2BS5A 2Z31A 3N1MC 4K5LA 1RUQL 2FTAA 4Z7QF 1RJLB 3JVGC 4Z7NB 3LH8A 5IB3A 3G08A 5IJVA 5IOKA 2F54E 3MRJA 2PCYA 3TBCA 3D0VB 3S5ZA 4JHAH 4UT6H 3PWVA 3OWRA 3FB5B 2J57A 3L4YA 1I8KA 2ZOWA 3REWB 1G1OA 1LE5A 2CAMA 3OF6A 4JQXA 4LEOB 3U0WH 2BS6A 3D9AL 5JHDD 2DYPB 5FO9A 2F7QA 5SWQB 2PLTA 3VXSE 1GS7A 1ZLWK 4KUZH 3NFSH 2N56A 2EZ0D 1V05A 2F08A 1CD9B 3AC0A 1KXOA 3LKNA 1VLXA 3QUXA 5FYJD 3MBWB 3VFTA 4LLMB 5I1DA 4NZFA 3ZDZE 4M1DL 4MVKA 4IMKA 4R2GB 5BZWA 1RKRA 3VTMA 5IEHA 4PB9H 4QPEA 1B4TA 5J9PB 4UTBH 2LTQC 4V2CB 1FZMB 2QKIB 3MV9B 4FFZA 2EIKB 1LO3L 1K5NA 5CEXA 1NDJA 3EC5A 4AVIA 2VDMH 5FA3A 2OBGA 4K8RH 2DM2A 4BZ1H 1EEQA 2FWOB 4I0PB 5E8OB 3E3QC 2D4DA 4ANKA 4YQXH 3RWGA 3UZEA 3B1TA 5DURB 4PS7A 1ZE3C 4G6AC 1F18A 3CVHL 3RIKA 3HEIB 2FLRT 5E8DH 4E9SA 3VCLB 4A7VA 4PGBB 4FG6C 1JXGA 2NOYA 1ZA6B 4HIPA 1EO8H 1YEDB 5GS0L 1NZRA 1ZNGA 1SJHA 1GW6A 1A3YA 5JZ7D 1BVZA 3K1KC 1JUFA 5HPMB 2G9HA 1MNUL 1QMUA 1SBSL 5EORH 3SE3A 4KXZH 3FENA 5IVNA 2AXWA 4JY4B 2BP5M 3EJQA 1HH9B 2WIIA 4R3SA 2K9UA 2XWCA 1RSUB 1ICMA 4FQJL 4JG5A 5DDHB 5FAZA 1IBGL 2D7NA 2FQGA 4M5ZL 5KVEL 2VLKA 1VWLB 1H15A 2YBRB 4EI6B 4GAGL 3S34H 5KVDE 3IPBA 4L4VB 3REVA 1OSYA 5L6YL 2VXTL 1BQHA 3LKPA 2WZ0A 3AFLA 2Q76A 1JCVA 5K39A 1V27A 1KBWA 4TUOB 1OAYL 3QJTB 4Q9RL 4GRWE 5HDRA 2XBZA 3QUGA 2EQDA 2WXRA 3HFFA 3D33A 4XVSH 4HCRH 3S5YA 1JJUA 5B5FA 4L2LA 4BOEA 4QGXA 3FT2A 3HPLA 1BRPA 3W9EA 1LDPH 4WHIA 3JWOH 4KJQD 2ZXBA 5DJXA 4EMZA 1J8HE 2XG5B 3G5YB 2XCMC 1I3VA 2QDWA 5DC4B 3MBEB 3O4OC 1EQWA 4Y19D 4YSDA 2FR4A 3C08H 2J8OA 3BX8A 3VG7A 3IDXH 1BP3B 4LPYA 1LEKA 4FQHB 2E7DA 2RMNA 2FX9L 1ZTMA 2CH8A 2E4TA 4HJ0C 4AYBA 4NEHB 3OAYH 1E90A 3VI3E 2QV2A 2OYKA 1PBYA 3CN3A 1N6QL 3MVSA 3PREA 4LSTH 4WUUB 4ZNCD 1GY1A 2JMBA 2YK1H 4X5XB 4OFKA 1DANT 4MQXC 3SDCB 4UNIA 1GHFH 4F2MA 3IMTA 3ILEA 4JPWL 2OR8A 2HNXA 4KMQA 4C4KT 3GDBA 4WENB 3K6IA 2O4EA 4ZK8A 3ZQ9A 1A1MB 1E3ZA 2W9EL 2OR9H 4HXBH 5L3YA 3WSQL 5TDPA 4HQQL 2WWOA 2I5YL 1FPTH 1Q9WA 1BQKA 4FFYA 4LDOB 4NERA 3TJEH 3N5AA 5TE7L 5K59F 2XTJE 4GG8B 2ROYA 3BZ4B 3Q5OA 3GGWB 4UV7L 5E6ID 3EGDB 4K5OA 4BX5A 2OYMA 1R47A 3ARFB 3FT3A 5MEPB 1N26A 3RDSA 4HX1B 2ZF9A 5F9AC 4Y9BA 1X8QA 4ZQTA 5LNDA 1OTUD 1ZE3H 1YN7A 5FYKD 1OQXA 1SBBA 2AAAA 4OELA 5MP6L 4BINA 2ZOKB 1UXWB 4FQXD 4JNJA 1QQSA 2OMYB 1SWKA 4BX6B 2G30A 5JA9A 1IVTA 2QOMA 2P49B 5E9DA 4OLZH 4ONFL 5FECA 4XPTH 2DJGA 1BIHA 5E6ZA 1F11A 1K8DA 3V6OE 3B9AA 1CZ8H 4F92B 3BPCA 4ZS7L 1KLFB 2OMXA 3LZRA 2C3HA 5ICZB 2WXHA 1HWHB 4DO4A 3FULA 3S5LG 1CTMA 4APXA 3P9LA 2DQUH 3BX7A 1T2JA 2Y6SD 1C7TA 1SGKA 2WEXA 1HXYB 1WFOA 2Y7LA 4B60A 1WYJA 1KTLB 2IDTA 3KNBA 4XP9L 1F2XK 1N5AA 4PJGB 5MENA 2O6PA 3M45A 1KYUA 3V6FA 2VLRA 3CSTA 3QXWA 4U33A 1SFDA 5L88L 1UHVA 4ANVA 4OV5A 4DKAA 1E6JL 1BX2A 2WWPA 3HG3A 3QQ9C 1YEJH 4KK5C 4WDIA 4LSPL 4KH8A 4NKIH 3ATBA 2IWEA 5INCA 2JKSA 5GGSA 3GSVA 1KJVB 2QFRA 3K2MC 5DQ9A 1D7FA 2BERA 4J3SA 1PAZA 4BQ6A 2Z4HA 1N5YL 4QYPA 1CGTA 3QUXD 5CCHE 4KZEH 3N42F 2CM9A 3GSXA 1YEEH 4TN9A 4BX7A 3FQUB 2APXA 1F45A 4MB5A 4MDIA 5DG4A 2VXQH 2XFGB 3AB0C 1R3LA 4AYMC 1EBPA 3ORJA 2J55A 4Y1SA 1MCWW 2AK4D 4AG4H 4B5ZA 5A16A 2AT3X 4IMLB 4OD3H 5D1QA 3MNWA 1SWRA 1V3KA 1SXXA 1INQA 3KWWA 3QXDB 2ICWI 3GMRB 4TPRL 2PW2A 3T0XA 3HOEA 4XZUB 1LO0L 4L2YA 1KG0B 1LK2B 3O6FA 1XR8A 4IKLA 4K5NA 1RLBE 4P5TC 5BRZA 1GZHC 1TEGA 1GGBL 4GQPH 4NZRH 3B7RL 4BFIA 4IRSA 3HE6B 5DWUL 5AOZA 5KN5B 3NRPA 1CT8A 1DQJA 5EFIA 1AS8A 1PY4A 2DLEA 1HBQA 2VOTA 5IT2H 4BHUA 4A2MA 1VPOL 5JORA 4AL8L 1L0QA 1UCBH 1RERA 3EOAA 1ES0B 1UD5A 2ZYRA 3BKYH 4XNMA 4JM0A 4Z28A 2Y2WA 2WVUA 2VXSL 3NJVA 2KDYA 1HJBC 4A7UA 3S88H 5CCGE 1D5BA 3WNOA 2VLKD 1U8JA 1UFUA 3S4SA 1LEIB 1A7QL 2RD7C 3DVNB 3KPPB 4WTZG 5DMGC 3WN5B 4AOFA 2HZQA 1HEJC 2YD0A 1QG5A 5GJSH 1FVDB 2IANE 2XA3A 2OXGB 4E9VA 5JPNA 2VN7A 4C4BA 4RMTA 3VWKC 3WFHB 3C6EA 3D1MC 2BSRB 5CJQL 5CZVL 2OTUA 2Y72A 1XTLA 5T3XL 3T3PB 4U3SA 2CLRB 5EPMB 1S7RB 4PJAF 5AAMC 4HHAA 1MRCL 2YPVH 3TGXA 3UAAA 1QO3A 2C3VB 1EH9A 3KPTA 3X3GH 1PIGA 3BKJH 1QABA 5T3ZE 3OC5A 3FT4A 1TETL 3L54A 2A6JB 1G6RA 2XYCA 2JJTC 2D3LA 1EHNA 3P4OB 1FELA 1U93B 4FBRA 2ALLX 1B0RA 3E3CA 1EGJH 3O3AA 4ZNEE 4FQCL 2PO6D 3MKGA 1BYNA 4G6ML 3U6RA 2IH1B 1WIPA 4FCHA 2VO5A 4LFHD 1FGNL 1XMWA 1FYTB 5E6YA 2BW4A 2MPVA 3APVA 2BP8A 4OM0H 1H9DA 4ZX3A 2QR0A 3IJSB 4TLUA 3DRTA 5CCJA 3KCWA 3W9DB 5F7DA 3LYRA 3Q13A 1E5UI 1OAQL 3F8UB 3NJXA 3TO4D 1T6BX 1CD1A 2MPAH 5HI3D 3BDRA 4KXCA 2IBZY 2CA3A 4YXHL 4DZBA 2DQGL 1KIPA 5I74C 5JOPE 3QYNA 1OGSA 1JF6A 1O1UA 5FKAB 1FG2B 3L2MA 2XQBH 3QHTC 4E68A 1MWAH 3C6LD 5KVFH 3ASOB 2ZKWA 3BUQA 1FI8C 1ZGLA 6PCYA 1RLWA 4GBXC 2J8UE 2UXTA 3WN5A 5B10O 3P0VH 1Y0LA 5E9DD 2RTFB 3OKDB 4NZTH 4NQVB 5CJ5A 1VWGB 4HD5A 4P3WA 2XX0A 4FZEL 3RFZC 3S8FB 2C9AA 5I8CB 4Q97A 1C5BL 4YX2L 1NCDH 3RLSA 3H85A 5I1KH 1A8JH 2FZ3A 4JRYB 4TYUA 3SKMB 3PQYA 5BJTA 4HJTA 2AJSH 1YDPA 1Y9TA 4XMLL 4KJPD 4ECNA 2A9NL 5MEND 1CFSA 4PV1C 3SE8L 3LN9A 4EN3B 3FRUB 2VLRD 4XNYL 1QI3A 1OCOB 1QPKA 2V2TA 3HNTH 2VDQL 1I3UA 2ESVE 3WMQA 4PGDB 2BINA 4MAYB 1PZ3A 4HUXB 3WN6A 4OZHE 1YECH 1MFCH 4L3EA 1LQBC 2Y5TA 3CBJB 1FFNB 1MCNA 4JKWA 3SDYL 4HIHA 2DTML 5ALBH 5JUEL 2HVKB 2JKWA 4RA0C 4U7SA 1XF4B 4JFUA 1JJJA 2DQMA 3VSQA 1S7SA 4X50A 1NPJA 3DYMA 4WFEE 5E9AA 2GUOB 4NP9A 5HDWA 1IJ8A 5AVQB 3TZVA 3NOIA 4LPTA 1K2DB 2J2ZB 4Z23A 3L3GA 2DTSA 4NN6B 4UTAA 1TOWA 2WVTA 4K7PL 1KT2A 3EG9B 1RAMA 1CFNB 3CN0A 3TBSA 1KCRH 1P84J 1SJEB 1LDQA 1WBYB 1DVTA 2ZCKL 5FOBB 2HG5B 4JK0D 4JHBA 2K6WA 3DBXB 4M1CD 5E51A 2NRDA 1CUOA 3A4AA 3V4PH 3LDBB 3WKQA 4TL4A 4BJLA 5GS2H 2WO4A 4BA0A 4YH0A 5EUOB 3G7XA 1MUJA 1RK0A 3GRGA 3FCSA 5BRZD 2J73A 3QRGH 4WFHD 1XGPB 3BAYA 2VRKA 1ZS8B 1WZLA 1N9YA 2RACA 5FFLA 1KL5A 2GITB 5L2KB 1CURA 1VWIB 4KDTA 3MRIA 4NNPL 4I1NB 2J4WH 1JV2A 3ABKB 4OLEA 3MJ8A 3I6KA 5ANME 4ZS6D 3CBRA 4CRPA 2FQEA 2ADFL 5FQ6E 3GBNH 5T5FL 3CSYA 1TQCC 3F12A 4HUNB 1HMRA 3FPYA 1NCTA 3OKEA 3LN4B 3WKMH 4G70B 3PWLA 2QKSA 4Z7NF 4DCQA 4WHTA 2O5ZL 2OFBA 5TQ0L 4PP2A 4RFNB 1BXUA 2A6IA 4RGNB 1NL0L 1A7PH 1K72A 3DK0A 3N6YA 1PIFA 1CBSA 3B2LA 3CU7A 3WUWA 3L3OC 1UQSB 5FUOL 2WOBA 3BQUB 5TGBB 1J5DA 5EO9B 4O2CA 1TZAA 1VFMA 2HSIA 5F7HA 5EU7C 3I02B 4O4OA 1MWOA 2TSAA 1EDQA 4PGDA 4PUBH 2WAQA 4WGKA 5E94B 4G8FA 2UWEA 1O6SA 4DP0X 4UQ9A 3NPOA 1DEEB 5IQ9A 1T21A 4XP1H 4M7LT 2MF6A 3FU7A 1YPZB 3ABLB 3TXAA 1HQQA 4HETA 4JRXD 3QH3B 1BLNB 3RE0A 3CH8A 2YG2A 2CCVA 3H53A 3F7PC 5B38A 3SODB 1VWKB 4XCCH 4WW2B 4L8CB 4WV1B 3TBBA 3EFFA 5L4FA 3EOTL 5IMMB 5BUAA 4AYDC 5JOFA 5I6LA 4FNLH 2FJHB 1BW8A 1OW0A 5BVSA 3DUUA 2EDDA 4Q6YA 2XG4B 2WTRB 2R1YB 2Z92B 1Z32X 2HG5A 2QM9A 4MVIA 2UUDK 4GSUA 4AIZA 1CD0A 4RNRB 1EDYA 1IAII 4OGXL 3SBQA 2VSMB 4HKXB 4FTVD 3EJYD 2F0CA 2WLMA 5F0JB 4YNYB 3NTCL 1U92A 5C0EA 2H32A 3FXIC 3SZJA 1NLBH 2MO5A 1FZOB 3GZKA 1WTLA 4EVNB 5AVRB 2QO6A 1ZHBB 4FXGC 2KPNA 1AD9B 4WU5B 4JHZA 1URLA 5E5LA 3QORA 2XWEA 1AHMA 3G5XA 4OKDA 5FDWB 1NPUA 3C8DA 1A21A 3QIBA 4AMXA 1F97A 1T6VN 4X8CA 4ORGB 2L9CA 3NJNA 4FI6A 5E8NB 3UEXA 1K8IA 4B9GA 4KX8A 3KPLB 4EUPG 4QYNA 4HC1H 4AENA 3L5XH 4LEXH 1ROCA 1HQRB 2BVTA 1VWCB 1FDLL 3GEWB 3UTSA 5EEYA 1RZ7L 1KGJA 1KXQA 4DAGH 3D18A 2J1WA 1B4JH 1WUNT 1CBVL 1A9EB 4OGYH 2VN4A 5IG7A 4FCAA 2R2BB 4ZFOL 1P2CB 3UBXI 3D0LA 3ULUF 3CVHB 3ZN6A 2NNXA 3I50H 1YSOA 3RTQB 1R17A 5C0ND 2EDFA 1OSZB 1JIBA 3AREC 3CDCA 3DX8A 5TDNB 2X4QB 4POUB 1MOYA 1I7TB 1UQSA 3FSZA 4ZTOH 3D8MA 2XHNA 5I0ZA 2O5YL 4TQEL 4OF8A 1J87A 4XHJD 4MD0A 4AYEC 5GRVK 2IQAB 5KYWB 1IBHA 5IB2B 3PQUA 4YCEA 4I8DA 4OLVH 3ISYA 4OGAD 5J6SA 2W88A 4Z0BL 3CLFH 1IC1A 4X0KB 5LBVA 3UO1H 1CDGA 4OZGE 3PQYD 3C12A 3HVNA 5GSRB 2X9XA 3PABB 4FL4C 5HI4C 3TBWA 1LO5A 3X3FL 5JTWA 3SYAA 1Z5LA 4NX0A 4XNXH 3MAWA 5FV2A 1T1YA 5HGAB 4JFFE 4GNWA 4XX5A 4BRJA 1VSCA 3JUZA 4BFOA 3T4AA 1WZ1H 4L3ED 4RUNA 4NZUL 2OY8A 3IGAB 1F8TH 4AGMA 4GO8A 1SRGA 2E7BA 5F89A 3SQOH 3GC3A 3D0AA 2WHVA 4G71B 4GW5B 1QY0A 3LTWA 3K74B 2FR2A 3L7EA 1TITA 3U1QA 4QCIA 4DKTA 3D05A 4I2XA 2IADA 4MJIE 5ESQB 4XAKE 3UROR 4YNYA 3TZVD 2VM4A 5DFTA 1MHPL 5IHLB 1HHIB 3I2CL 2DICA 4AH2B 2JLLA 1KBBA 1CYXA 1F4AA 1NCHA 2VNCA 2LVCA 2WTOA 4GKNB 1G7IB 3KPSB 3CSPA 4N2LA 3ZPDA 5IBLD 4X98B 3VHIA 4GS7C 4AC2A 1VYFA 2VL5B 3GUFA 1G74A 3U7WL 2Y7SA 2HCZX 1LNUA 2ZXEB 4LPWA 4B5EA 5HZ6A 1A9BB 3UAFA 3OX8A 3SPGA 4Q0XH 1SWBA 1KTBA 1IEAB 3BGMB 2EZ0C 2KS0A 4NRZA 4PJ6A 4YE0A 3HFMH 1QFWM 1CLZH 3NIDE 3PHAA 3MQIA 4JBSA 1NP4A 2ZAGA 4X5RA 1LE9B 5CP7A 5E56A 2UZIH 1VZHA 5EG6C 2ZT9C 3SJVB 4Z8FL 1WIUA 3IMUA 1SY6H 4FERA 2NTSP 2AQ3A 3TWCH 4FQLH 1U2CA 2E3VA 4UDTB 3V7MA 3OBLA 2UVEA 4QKXB 3SZ6A 5DO2D 1RZJC 3B37A 4WNQA 5J13C 3HIZA 2WXFA 1IM9A 5AKSA 4KY2A 5IR1A 2H9GB 2YN5A 4PJGF 1I1AC 1XT5A 3VB9A 1XIWD 2PYEB 3GXFA 5EOTA 1E8WA 2OZ4A 5F0MB 1FAIH 3IA8A 4HBCL 4F8TA 5IB2A 4IIQB 2DH3A 1IC7H 1KJ2L 2RTEB 1AGBA 4NV8A 4ZJ0A 1P9MC 4BWWA 1WCQA 3EIFA 1WC7B 4HFUH 1G87A 2DJUA 4JQIH 3QJFB 4OJFH 1JGUL 4P9ML 1TYJA 1QY1A 5EU4A 5K1JA 2WZPA 2R4SL 1T7WA 4KUCD 5IBTH 4XPHL 2VDPH 2WBJB 1JV4A 1G5WA 5DK0A 1XQ4A 3B9EA 3HR5B 3OKMB 3RRQA 1LF7A 1DVYA 5DMIH 1DQML 2JWYA 3LH9A 4IBVA 3O2WH 4GDZA 1X7QA 1VFOA 3QEHB 4MBRA 5T1LA 4XBPA 4CC0A 3U30C 4EDWH 5JZ7C 2MNWA 3GPEA 3IU4L 4K3JL 1DZKA 4CVZA 2G5UA 2MFNA 1KBGH 3B2VL 5IIEB 1PCXA 3TEXA 2WLJA 1QX1A 3KDMA 3WNNA 2H1PL 2BNRE 4PRAA 4KI5F 2GCYB 3SQBA 1U3ZA 2BWDA 3SBWA 1A7RH 2GH7A 3G5VB 1GPOH 2VLJA 2X34A 4NYLB 1I3GH 4M5SA 1N2RB 1SYVB 2HKHL 4UU9B 2JU7A 4Z7VE 3PJSB 4CSZA 4YVNA 3OSKA 4L1DA 3RDQA 4ZW5A 1CBJA 3LQAL 4FGIB 3GXDA 3A23A 3IDYB 4UAHA 3X17A 5LXGH 1S78C 4G8GB 2RCSH 3B7YA 2VL5A 3K72A 1ZSDA 4R97C 2ADJB 4KJQC 3M86A 5J7CC 2MQCA 3RB7A 1HYSD 5D1XD 2BLGA 2BT9A 1IKFH 1P1ZA 3RVUD 5EU6D 3VYOA 1NLDH 2EXTA 2IWKA 3L4UA 5ICXA 2VDNL 4H0GA 4NRXA 5E2UL 3SDXE 4AEHH 4NUGL 4DP1X 4XRCA 1LO4H 1PYWA 5SX5H 3V7AE 1LP9A 4BUQA 5CJXA 1Q0XH 5AALA 4WSJA 1TTAA 1T2XA 1TQWA 3QIBD 2O5XL 4HMDA 3QJHA 5LKFA 2NXZC 3GMLB 3A4DA 3D2UD 2HT3C 5E95B 1JNLL 4JFVA 4UTCA 4PVBA 2IJ0C 3TV3H 1BGXL 4KX9A 2AQTA 3Q7JA 3VRLE 3H4FA 2Y06L 4XN7A 3WJJA 3UEUA 1ZHKA 1SWAA 2K62A 2X2UA 4YFLI 1CBRA 2G4EA 5EDCA 1U8MB 4N2GA 5FYJH 1AKJB 3AY4C 2HUHA 3O2VL 2BZDA 4GW1A 4MRBA 4J3OF 2GJZB 1EHLL 1AOHA 2D03H 1TDQA 2JK5B 3LKRB 2WUTA 1YG9A 3C5ZA 3ECBA 2RTDB 4NBZB 2MOQA 2N7SA 1I1YB 4PJDA 3T3PF 1RZJH 2MOGA 2OS7A 4JG1H 1RBPA 4W9KC 5D7SL 1ZGLP 3CMPA 1BG1A 2VTFA 3O4LB 5JR1L 1RUMH 1INDL 2P4AB 5F96H 4BH7B 1ZV2A 3F7KA 4DGVH 3U2JA 4E42A 1A6VL 4ZX4A 2IV8A 2GTQA 2Y2TA 4X4YA 4WTXA 3D51A 1RULL 5LWYL 1F3DH 1NSNH 4I3SH 4URTB 4WJ5B 2GSMB 4PRHA 1KPUB 3W5NA 4UOZA 3U79A 1X9RA 1XF1A 1AI1L 2EDXA 3U0TB 3T8XA 3QIWA 1VGEH 3O3BB 3GTNA 3DGDA 5IEKA 2GJ6B 1XSKA 3GZQA 5CEYA 1ZT7A 3V5DB 1MI5A 4KXDA 4XZ4A 4QNPF 1IGMH 4IQHA 4WAFA 2HWZL 3RAJH 4UU9A 3G9AB 2UY6B 3QQDB 3PDDA 4A2GA 3MVFA 1NGLA 4LP5A 1BD2A 3FKUS 5DR5H 3DPBB 3DSFL 3C2SA 3OPUA 4DOHE 3GZPA 2GK2A 3M88A 1FTPA 1Y18A 3IJEB 4LGSB 2BOBA 4U1KB 3MLRH 4OLUH 1PS3A 1JPFA 1PNDA 2Z31C 1WFMA 3OLGA 4KZCA 4PJ5E 4HJSA 5FCUL 1NMBH 4QLWA 2NLJA 5LNGA 5CINH 2DWDB 5J57B 4JM2A 2V6HA 4PG9B 4WWKA 4XMZA 2HLFD 4RBPK 1VWFB 4UQIM 3OXSA 3CSFA 3S3JA 1SY2A 5LG1A 2B1OA 4MMZB 4ZOBA 1VWHB 1SDDA 4FKEA 3HVDA 3V0HA 5F8RC 2DKSA 3HE7D 4GKZA 4NJAH 1A4JB 2DQCL 3FYEB 4FXKB 2A0AA 4JQXC 3GMLA 3LKOB 3ZL2A 2GJPA 1AVAA 1JGLH 3FT1A 2X4NB 1JOIA 2WYZA 1QRND 5GRJL 4P5KA 5IK3A 2DWYA 3EJZD 3FQ4A 5LG6A 1JHKL 1SFHA 2CSPA 2V2WB 4AE1A 3HUJE 2NNDA 3PPTA 2FWVA 3QUXC 4X4ME 3CPLB 1K6QL 3GMMB 4OCSL 1ET5A 1IQDA 2QJDA 4D3CL 1FL5B 2P5EB 1EANA 3B5HA 3TCXA 4GSRA 2VDKL 4GYBA 4IMKC 3GPSA 5AEAA 3OJDA 1VKXB 2XN9B 2FL5A 1D3CA 1XD0A 2VSKB 5D8JL 3GSQB 1BA9A 4XVOA 3UERA 1HCZA 5F7NC 4N4YB 5FO8B 1GVIA 4DGYH 5ID1A 2N7BA 2KMWA 2O30A 2CPUA 5DRXB 3MTRA 3S5LA 4HLEA 1FQ9C 1J1PH 4YC2B 4P46A 5HHOA 2GTZB 1A2DA 1FL3B 2WQWA 3BD3A 4MXQD 5AZUA 5I2IA 1ZAGA 5L7XL 4KZDH 1AY1L 3UZEC 4G82A 1E5AA 2CAKA 5IOPB 1QWDA 5TH2B 1SXBA 1KT4A 1XZ0B 2XXFA 5EC2A 3C78X 1HE8A 1OE1A 3SO3B 1KGXA 5EO0B 4D9LL 5D70H 5F8QC 1XGRA 3ES6A 2Z7UA 4HPAA 5ENWB 4PGEA 1T0MA 1GGYA 4M4RA 3AACA 4U6TA 2Q2MA 4N2EA 3ARDD 2EVFA 1AS6A 4OT1L 1T22B 2XSTA 4Q2ZA 1EIBA 3IMRA 3TVMD 2WQAA 1AO7A 1FL6A 2BWQA 1TQSA 2G60L 4IEFB 3CK0L 5FYKH 2ARJQ 3O6ML 4GP5B 5ECJE 3B6SA 4PJ7E 2BHFA 2X10A 3QQ2A 5HBBA 3MRKB 2HB0A 4M8RA 4W9LC 5FKPB 4IB9A 5I82A 5GGTH 1LIEA 4PBWD 5JXEA 1HIML 1PZ2A 3QDMA 4OLWH 1EALA 5D7LA 3TYGH 1NBZA 2K1MA 3IRPX 4G43B 4OFYA 2PPCA 2VDQB 2R0ZL 4N87A 5IJBC 3PH6A 2NW2A 5IB1A 1DVXA 1PZ5B 4QDGA 5EUOF 1K5WA 2WINA 5L2JB 2GJRA 5LGKA 4PRDB 1E28A 4WJG3 1IBBA 3ARGA 4MDJB 1CGYA 3T5WA 2ATPA 4Y0SA 1WJ3A 4KVNL 3T6VA 1Y07A 1IL1A 1UM4L 2RHEA 4IABA 3W0WA 4D0CB 4JFZH 1KN2H 4XGZB 4FFWC 2A73A 4LVHC 1ACZA 1QLRB 1QZ1A 4HWBL 3SSGA 3L1OL 4F7PA 3CPLA 2P9RA 4H8PA 5D2NB 3KL3A 4P2CG 1SXWA 1KGLA 4JVPA 4X6DA 5C2BH 2WKOF 3GSUB 3LCYA 3MRLA 1OO2A 2CG9X 2CBOA 5A3IC 3MJ7A 3WJMA 1J10A 4YHKL 4D8OA 3AXLA 4I3DA 1CL7H 4FXLA 2AXFB 3RL1A 3LRGA 1OAUL 3CG8A 1AQDB 3KYMA 3L95B 4C47A 4P0DA 4XB3A 4U1SB 2OPCA 3HWDA 4ETYA 2AJXL 4OF7A 4J23A 1P4IH 2RA6A 4S11A 2OMTB 1GS6X 5J1AA 5IFAH 4WTZA 4I95A 1UA7A 3NZUA 4NFCA 4U8UO 3DXAA 3C5ZD 2XV2A 2F8IA 4N2CA 4LGRB 2ZAIA 1KCKA 5I19L 2PMZA 3O3UN 1YPZF 4FFZH 2H0FA 1J5IA 1XBRA 5KUKA 4XODA 4LP4A 5HI3C 2YPLE 3EYVA 3MBXL 4IU2B 3WHXA 1WO2A 4ZSOA 4EXZA 2JOZA 1OAJA 1QVOA 4WW2F 1DFXA 3WG7B 2QELA 4Z95H 3MO1B 1F90L 4PY7A 1FHGA 1I85A 1N4JA 1JG9A 3JV5A 4MLIA 4OJYA 4PRHD 4QWWD 4AEIL 3TIEB 3K8LA 1JZFA 4P5RA 3DV4B 3MJGX 5F6ZA 1RURL 4GW4B 2XA8H 4Y19B 3QIWD 1A8ZA 1MI5D 2YGNA 3KLAB 3EW1A 3QP3A 4KO5A 1WFIA 1XL4A 2IH8A 3MRDB 1VF5C 2E74C 5FFGA 2WGNB 5D7JD 4G8EB 3OJYC 2YD6A 5FX3A 1JD9A 2FKGA 5LDSA 2CGZA 1NQBA 1IZKA 4TVUA 3BX7C 1ID2A 3FTGA 1E9QB 2FECI 4F7TA 1DLHA 4ZI8A 1MJJA 2BX5A 5LDUA 3RVVD 3C8KB 5K59E 4M7LH 3VW3H 2AVGA 4WWKD 4XMKH 1QLRA 2NY5L 4QRSA 4M56A 2IFBA 5IMLB 1ZHNB 2HMIC 5EIIA 2KDGA 2Z7ZA 2BSZA 3ULVD 5IQ7H 3L4WA 5J89A 2J6EL 3SCMA 3VFOB 1M42A 1FJ1B 4NFBA 3NJIA 3QUMA 2IGTA 2V7HA 1ECYA 5E6IB 1LLAA 4J7RA 3WUZA 1DDHB 3FFDA 3GXIA 1VB9A 2YRLA 3WELA 1X4XA 1ANUA 5GS1A 1KTRL 2X1PA 1JZ7A 3EBWA 1HSAA 4NO0A 1IGCL 4W81A 4LSUL 3T1FB 3TA3A 3Q9PA 4BUGA 4JGJA 4WI6A 4YK4C 5L0QC 4G9FA 5D7KD 4TNNA 3ZRFC 4J6RH 4XAWH 4HZAA 3U6XA 1RIVL 4NCC1 2YO3A 3SY0A 4FQXB 5HTSA 4TQHA 1FP5A 1GC1C 5L4IA 2VDLL 4PJHA 1T1WA 1AANA 5AVSB 4TSAL 1TG8A 1SEQH 5KTEH 4FN0A 3QUZA 2IXQA 2X1QA 2XY2A 3DX9A 1AZBA 1EXUB 3CN4A 4M1CC 4WLCA 5D1QC 2MCPL 4W6XB 3MCKB 4M6ML 4P46D 4RFOH 4QKTA 1HKLL 1XF2B 1C8QA 4N0UA 2XZCH 5B39G 3O6FC 1B4LA 4HPYL 2QCBA 4YWGH 3VMOA 4ADGA 3LVTA 4IRSC 3VXUE 3CXDL 4CW1A 5A2BA 4U3CA 4ZFOB 4GINA 2GHWB 4FFYH 1U8IA 4AWJC 2R7EB 5DD3L 3ROLB 3HI1B 3KPMA 1VACA 5E5MA 3PAZA 1BMZA 4O51A 3O8XA 5D7HA 5EZJB 4KRLB 5IGXH 1A6ZA 4LLUB 3ESUF 4PS4L 2WVVB 1C5DB 5TE6L 3UG3A 1I8IB 3MGOA 1AO7D 5F7BA 2ZONA 4XC3H 2FD6L 4OQ1A 5LBSL 2ED6A 4IM8A 4RSVA 5CE4A 3NH7H 2X8TA 2KT4B 1K3BA 5HA0A 2EILB 4JS7A 4GG6B 5DI8B 4Y5XB 3ZIYA 3OL2A 2X4SA 3IAGC 3EM0A 1IARB 1D5XA 3FCUB 4UM9A 4AZQA 4HG4K 4GO6B 4I18B 5DLMH 5JXED 2AJUL 5D7LD 3ILQC 3L1FA 1ETZB 2O61B 2DD8H 2ICWA 2J43A 4EZLA 1SN2A 1WGVA 1R6VA 3DOIA 4D0BB 1WFUA 2AK4B 2ZX6A 5JPNC 3AWFA 1JBJA 5K93A 4HISA 3NADA 2APTA 4E41A 2Y1VA 3MUGB 2Y36H 2WCPA 1WA1X 2IOOA 1I7UB 2D73A 5C3IA 3VXQB 4GO9A 2ID5A 1SWCA 1U6AH 5L8NA 1EO5A 2YXMA 2ZWZA 2PXYB 4IIZA 3D69B 3BT2H 1RZPA 3Q2WA 2ZJSL 3NFNB 3QRBA 3QHZH 4EUPB 1FDQA 2OULB 5IFJA 4NUPA 4DP9X 3MV8A 1AR2A 2R74A 2H7WA 3ZHDA 3EUUA 2APFA 2Y7QA 4G80B 3LNDA 3GRWA 2RJMA 3U46B 1NM4A 3MRRB 5E8EA 2AF5A 4ODWA 2WLHA 1X8OA 5BVPL 5CFAA 1ZTXH 4ZRGA 5EEZA 5DVMA 4L4TE 4ELKB 4YBQC 3EADA 3EJYC 3MRHB 4G7VH 1XF2A 1E42A 1D6VH 2PP8A 3SLTA 4P8QA 4QXTA 5C07A 4ZMVA 3UPRB 1KLUA 3QXUA 1XB6A 3ZDXB 1GC1H 4EKVA 4YUEH 2C4XA 4XXCA 3WY1A 1DN0B 1T4KA 1LMKA 4X4XB 4PJCB 1J8SA 1JMXA 2WBWB 5ISZA 1ULVA 5IW6A 2VISB 4AC4A 4JPVH 4IKIA 2Q2LA 2NY3D 3KLQA 4FE9A 4PJAE 5F7MC 3RL2B 2LE9A 2OSYA 3I6LE 1P7KB 4N2OA 4PJEA 1GCYA 4YHLH 1HZHL 3QEUB 2XY1A 4G7YL 4MJHA 4N6RA 4XO8A 3L5WA 3RPIB 1XR9B 3VNYA 3VD5A 4LLUA 1A0QL 5AW1B 2G75A 4HOWA 1RPUA 5BVPH 2MEJB 2QQNL 1KJ2B 3BZFB 4R96A 4Y16D 5LJGA 3JYCA 3T0EB 3MRCB 4JFQA 4U4BA 2R0WL 2EDLA 2VZ3A 1YYLL 2XC8A 1KZWA 2VKXA 3KJ6H 3BIKB 3K2KA 3FT9A 4I18A 3SPCA 3UDWA 3VFSB 1SUHA 3LNHA 4S1RL 5T1MA 1I7RA 3OHXA 4YHYC 4AGQA 1DFBH 2WZ6A 4XHJC 1VWPB 2Z4QA 4UUJB 4NKDB 5D9SA 2PO6B 1PZCA 3DRQB 1AXTL 5AL8A 4PJXB 4X8JA 4Y8DC 2DMBA 5AB0A 4BFKA 4MWFA 4NHUA 1BF2A 4YPGB 4LXFA 4LZKA 5F2FA 1WBIA 5KYYB 5IF0B 2YD5A 4M7ZC 1SXAA 3FO1A 4I9WE 4JCMA 4DP2X 5SWZA 4ZYKA 1PU0A 3LY6A 1R46A 4HOXA 1AR1C 2XOTA 3ZL1A 2B08A 4QUOA 3TO4B 4J3XA 3MNVB 4LSRH 3NEOA 3ZWEA 1JPEA 1GZPB 1XXFC 4NO0D 2B2XH 2NUTB 1F3JA 4PRIA 4XCNB 1RHHA 3AU0A 3BUTA 2B1AH 4KXZI 1N8ZA 4HJJL 4UZSA 1X7SA 4ZD3L 4XMFA 1KJ3H 3P2BA 3B5GA 3TZVC 2VDNB 4CC4A 2CLVB 3C6LB 4EI5A 1HAWA 5C0BA 3VD9A 4CL7A 4ZAKA 1MJ8H 1TQTA 1G6RH 5ESVB 4P2OA 2QSTA 4OIAA 3O6LL 5IBLC 4DFIA 3AW5A 1ITCA 3BISA 3MXWH 3QUZD 3UX9B 3H9HB 2DF3A 3TM6A 4NC2B 3CAFA 3FCGA 5ADOH 3V4VH 2N0KA 4LVNB 3KGRA 3QYMA 1DBBH 5CGBA 1DC9A 1I9JL 3QZPA 1PG7L 4ZPVB 1TSHA 3GSRA 3P11H 2IZLB 1VWBB 2JB5H 1E06A 4PLKD 4M3HA 2Q8BL 4MCZA 4W68A 3MXVH 5AD0A 2C1OA 2R2HB 1JWSA 3MRMA 5DHYA 4ZTPL 4F58H 4K55A 4R4FH 2BPBA 4U1HA 2EDTA 4KDTC 4J1UA 1VWNB 1TJMA 3QWRD 4LBEB 4IOIB 2YAQA 3PWPE 2Z34A 4JPQA 5EC1B 3RGHA 3WNJA 3ZKMC 1PPIA 4JMNA 4O9HH 3RWCA 2JQZA 4KFMA 2C1PA 4M7KH 2I9LB 2FE0A 2YKKA 3LKSB 4N9GB 4O4UA 3Q34A 4BZ2L 3LMJL 2GC9A 3DRQA 1A4AA 3NUKA 3FTWA 1M4KA 3FFCA 4WJKB 1J9SA 1R9FA 2D31A 3FN3A 5C09A 2CCLA 3BWAA 3ELQA 5JLZB 2YXFA 2IPTL 5D7EA 3CIAA 4JFEB 1KOAA 1W6FA 2E7HA 4CN4A 4JN1L 5I6KA 3VX1A 5LKEA 3RDJA 1WWBX 4BXSV 1BG9A 4NLJA 4X42A 4TVSa 4PTTB 3FUKA 4LU5H 3CBKB 2IGFH 3LIUA 1THAA 4FFVD 5E99L 5LQBH 1AMXA 3TFKD 1J5HA 1BMWA 3NQ9A 3SGDH 3UADA 4RWYL 5JW3H 2OCJA 3STZB 3K5SA 1OM9A 1E4XL 2P45B 4WFUA 1EX0A 3VXNB 4M6NL 3TNMA 1MHCA 1JPTH 2XIBA 3S8WA 4DN4L 5IRAA 4OIIL 5AKVA 3GIZH 5IMKA 1JCKA 1KC5L 1ZPUA 2CKNA 2ZG1A 1LK3L 4Z7NE 2X09A 2Z9TA 1OW0C 2FH6A 1HI6B 1OAZL 5C0DA 1AKPA 3PP3H 3LV4A 4Z2PA 3QXAB 1MFBH 1U33A 3MX0B 4LPXA 4HS6B 4KTDH 1KCBA 1AZCA 2E5EA 3L17A 2AGJL 4NKOA 4PHXA 1HYSC 1KYAA 2P8MA 4M1GL 3RI5F 3RVUC 3VXRE 4QGVA 2BO0A 3WL9A 4HT1H 5F1EA 1TNNA 4I60A 1S7WA 3HG2A 1BFVL 4UTAH 2VDKB 3QORC 3NAAL 5AL0A 3DROA 3HC0B 5TD4A 3QIBC 4MJID 5D4IA 3RIFF 2RTOB 1CE6A 1DBAL 1MVGA 2QMJA 3D39A 4D94A 8PAZA 1JRHH 1ACDA 3VH8A 4A7SA 4QLRA 4XPGH 2NYKA 1BWWA 3RVXD 1JPST 4ZW3A 5I18H 1S9VA 5H94A 1EXSA 2Z8SA 3CZGA 5I8EA 1F4XH 5E6SB 3QUYD 1ZDSA 4JRXB 4URKA 1FV1A 2J88H 2FEDD 1DSYA 1E6OL 4Y2LA 2FEEL 1HZKA 5C6TL 5CFHA 1SF5A 3CTTA 3MOQA 1KZXA 3APFA 4DGIL 2EP6A 4LEEA 1OZTG 2I32A 4HUMB 4IRJA 3RILA 1IBFA 1RZKL 1FH5L 3FYIB 3TL5A 4F15B 3ETBJ 1ZLWH 3V0VB 4H8HA 4XCFL 2ZE0A 1QHOA 2DQHL 3DARA 4QRPA 2R2EA 1D5ZB 1Q9OB 4HH8A 4LL9A 3H7BB 5DUPL 2B77A 2E6PA 3B2KA 5J3HC 3J07A 3V4VB 4XN5A 1E4HA 1M6OA 1R5IB 1JTOA 3ECWA 3QDGE 3IAQA 4FTVB 3QGVA 4Y1AE 5GGRB 2AS5M 3NJGA 2PTVA 2DQIL 3DOHA 3VD1A 3VXNA 1PBOA 3HOLA 4B9KC 1S7VA 4TULL 5KUMA 1G0DA 1KCVL 4JO3L 5I1GH 5PAZA 1GYCA 4F7EB 1ZKAA 3PPEA 4L4VE 3OAUL 3IGLA 4XWOD 2LU4A 3T4AC 1NGPL 1NMCC 3FQWB 4TRPH 2EDJA 3Q8EA 4FF9A 3PHOB 3MLUH 4QD2E 5DJDA 5T3ZL 3ZT6A 4HJEA 1GIGL 4GRLA 3K4AA 5E2TL 1TMQA 2QDVA 3BP4A 3GBLA 4EZJA 2F53D 3ATAA 3ZKXB 1V3JA 5ADPL 1UZGA 2JCCA 3DJSA 4Y9EA 5EA0L 5IROD 5T5NF 5GQBA 1NCUA 1AQKH 2R1WB 2CHXA 4ORXA 5HTDA 1AZUA 3TJPA 1PX4A 2X38A 2E59A 3BSZE 3LXUX 4EI5D 2WNXA 3B3IB 5C0BD 3IDNA 3LZLA 2XWXA 4P2OD 3BMVA 5HYQB 1QQDB 4NQCD 1NTDA 1MCPL 3VXUB 4APQA 4YSEA 1G7QA 3NZ8B 4IYKA 1QA9A 4K19A 4Q9QH 1IEBA 3EJRA 5IY5B 4P59H 2BS9A 1J05B 1OM3H 3V6ZA 5INDB 5JNYB 1L3NA 4ZFZB 1C12B 5AG9A 3CFEB 4FQQA 1Q94A 5I71B 5IVZA 3KZ8A 3UEVA 2IMNA 3P02A 3MX7A 1UTDA 2H32H 3AQZA 3WVMA 4ZOAA 4JFPA 3D95A 1OSEA 2P5WB 5F9DC 5ID0A 1YYMH 4UDUA 4KJYA 2ZG2A 4WUUE 4X6CE 5BVTA 4RFEA 5ALCL 2KHAA 4GGRA 1S7QA 3GIVA 5GZOD 5K9JH 3SPVA 1MREL 3AXHA 5EZIH 3VFUB 4XBEL 4IGBA 2H26A 2CIIA 5K67A 1FSKB 1S7TA 2Z0BA 1Z9MA 1T1XB 4PJFA 3AMKA 2A2QT 3ARBD 1U4FA 3CC1A 4MX7B 4U9CA 4DNEA 3D4CA 4ABVA 2DPKA 4FHJA 1QBLH 1YIVA 3BY0A 4P2QE 4TLSA 3Q2NA 1X3DA 4MJ6A 1BVKB 1NFDA 5I8OL 1LQSR 1MFMA 2OV0A 1XL6A 2R69A 3FTYA 4R7XA 5DJCA 1CLVA 3RIAF 2CE6A 3FONA 4LNRA 4O4SA 5HDOA 1O5DT 3V9FA 3BKML 2I60H 1NUDA 5ICUA 2BIMA 4ZXBD 5I73C 4LCWA 1NCOA 1ZNLA 2HRLA 2RTHB 2N1TE 3OXRA 5C09D 2NY6C 1WWAX 1XCQA 4Y4HA 4BFEA 1X5ZA 1S5HA 2DQTH 3D3VE 4HGWB 5TF1L 3PP4H 2NY1D 4H8UA 5B1JA 3V2AR 4ZDHA 1HU8A 4NQSA 2Q3AA 4XO3A 2LFGA 2NTFB 3MA9H 1QSVA 2RIKA 1KN4L 3HZYA 1BQRA 3PV6B 2B20A 5AFAA 1J11A 3PHOA 3U9WA 2Z93B 3GMQB 2A6DB 2OM5A 1IAOA 3PHSA 5HHNA 5A2KH 1EAPA 4KK6C 3C6SB 3SBWC 1HT6A 3F5WA 1O6TA 3K4DA 4JFDB 4IMOA 1V3LA 3QBTB 5FGBA 3CZFB 4PJGE 3IDIB 2E76C 1YVLA 4GB9A 2A77H 4X8GA 2FKJA 4ODVL 5AOKA 4AIXA 4X6BA 1BOYA 5GSVB 1J5OL 1WDAA 3Q9QA 2IH3A 4XOCA 2F74A 5F7LB 4A66A 1J1XL 5BMFH 1XIWB 1CGVA 4BWTA 4LCYB 3LN5B 2HTKC 1FVEB 5F88A 3LV3A 2W94A 3DGCR 5DZOA 4OB5H 3FB8A 4YHPA 5C8JB 4AJWA 3HC3H 1H3GA 4H5SB 2WNWA 3I6GB 5CJXC 2HXAA 1L9OA 3V5HB 1CDCA 4DUVA 3R18A 4MVLA 3HI5L 2VE6A 5AJCA 2IAMB 2VDLB 1F5WA 3QO0B 4OD1L 2V8MA 2CRYA 1N64H 2MJWA 1UJ3B 2LVEA 3TH2T 5GXBB 1FAKT 2NY2D 4GD9A 5FV1L 1HFUA 4HKJB 5I30H 4GG6F 3FOMB 1MEPA 3GMPB 1KT3A 2OFMX 4MNQB 3WJJC 4E5XG 5KYXA 1O7DE 5M95B 2CALA 3VXMD 4TKHA 3CD4A 1DF8A 4ZHGA 3H42L 1SOSA 3MLTA 1A14H 2A8GA 4GMTH 4M43L 2R29L 5HHQB 3C5ZC 1BM3L 1DANU 3MACL 2PETA 3BWUF 4AQEB 1FE8L 2RALA 4MMXB 1MAMH 2YQ3A 2K78A 1WFJA 3HWFA 4KVCH 5CP3A 3WDHA 4GXVL 4P2YA 3N2JA 1YNTA 3M07A 3VSVA 1OARL 5C0AA 1UD3A 1ZRUA 3CFCL 5GRVL 2OZ4H 3H9SD 4QRPD 2VFBA 4WFGD 4NM8H 3HWEA 2CQVA 4EJ1C 4ELMA 5CCKL 5I16B 3OKOA 5FUCC 2WD0A 3DX6B 4M4PA 4YEFA 3CCHA 5DYOB 1CF8H 1D5MB 3ZTNL 2WCGA 1EMTH 4HIEA 5D1XB 5EU6B 4LIQL 1CDUA 2YA1A 4K94L 3QIWC 4JO1H 3QFDA 3M7OA 4FZ8L 5D4AA 3DV6B 5I8KL 3O3EB 3F7YA 1A3RH 1MFDH 2C3XA 3TURA 3BVNB 2VDOL 4U6VL 4MXWL 3RA7H 25C8L 3QUHA 2WQ9A 1MFAL 1JZGA 3D2UB 1GZQB 4A8ZA 4TOYH 4PJBE 3QFJA 1AIFB 4JJ5A 3C9NB 1KNOB 4HWMA 3ZDXF 1G5GA 4GRLD 4LVOB 1J8RA 1GOHA 4ZPTA 1UYWL 3GSOB 1RIHH 3ABZA 3PFUA 4PJCF 4FFTA 3B7UX 3OLIA 3AG3B 1XGYL 1E9PB 3BN9C 3RVVC 4ERSL 4FNTA 1Q0YL 2WW8A 4A60A 1UM5H 3MV7D 2IOMA 4U1JB 4JM2C 3VXSB 3FW5A 3E3QE 2WPGA 4WWKC 3ZMRA 1JFQL 3VPJE 5DJ8B 3CUPA 3A6CH 2L5PA 1ONQB 3Q43A 4X6FB 4PLJD 3ULVC 1YQVH 3GTTA 3B2XA 3I6GA 1OGTA 4A2LA 4APQD 5IMOB 3AGVA 3DOSB 1CPUA 3AS1A 3QS2A 4XP6L 4U1LB 3NCFB 1E2TA 4X7CC 4KTEL 5HYSB 1IGYB 3CQQA 4Y4FA 5EULV 2QHLA 2V7NA 2VR3A 3U83A 5HDQL 2NQ3A 1JXFA 2WSKA 1UB5A 3GMPA 2GT9B 3U2SA 2D7TH 5H9AA 3VGHA 2ZIDA 4KC3B 4YXLL 4NV7A 2C9UA 3KJ4B 4UQ3A 2W9DL 1JE6A 4HUWB 4YN3A 2WEWA 4WRLA 3L9RA 1J12A 1FYTE 4J3VA 4N0RA 1BQSA 4XWGL 4IGBD 3I84A 4ONHB 1AZNA 4WEUD 4X9HA 3UYRH 1KELH 3MLVL 3PGFH 4CMMA 5FW6A 1PD6A 3D09A 1AB0A 3NX2A 4PJXF 4ARHA 4Q9BA 3TIDB 5AZEH 5KOVC 3O0RH 1QATA 2XWZA 1JWMA 3P4MB 5E7BA 2A1WH 4NIKB 5JPMB 2ZYIA 3GBML 4MIRA 1KB5L 3K91A 4NWUL 4P46C 5FYJU 5B1CA 3AGWA 1NAML 4PN6A 3TP4A 2KL6A 2OQJB 1LD9B 2PTUA 3D30A 3QKGA 3AJ7A 3LZPA 4YOKA 2EYTB 2R4RL 3AMLA 4DK3A 2EDKA 1BHGA 3LHAA 1TVBA 4LCWD 1KPRB 4UIMA 3UTQB 4DUXA 1IGJA 1M7DA 2C9SA 3U4EB 2ERJC 3L4ZA 1NC2A 3Q1SL 4JO2H 4RIRB 4KK9D 4Z7UE 6PAZA 3WGVB 4EIBA 5BZDB 5HHPA 1CDYA 2JQAA 2H1LM 3DTQA 3OAYK 3WIHH 1B2WL 2EEAA 3FQRA 1A02N 3V55A 1RJZA 2Y5QA 3CLEH 3P4NB 4YDKH 3HE7B 3WNKA 1CU4H 1UOWA 2AEOA 3QO1A 1GJIA 2XQYK 2B4CL 2Q86A 4CMHC 3QIUD 2IO5A 3AQDA 4LP8A 4OQTA 5FYLD 3GHEL 1YN6A 1QRNB 1RU9L 1Z66A 2BJMH 2F54A 4Q7DA 3WFDL 3X1NA 1SA8A 3VSTA 4BIKA 4GRWB 5CEZH 43CAA 3D85A 2YPLD 2DJ4A 3IDGB 4JFHD 4LKCA 3HZKA 2WO2B 4K3EH 2GK0B 1SM3H 3CH1A 4CVWA 2VQUA 3SDAD 1TMCB 4LQ1A 1EQDA 1BZ9A 2N1KA 1GJUA 4HS3B 4ZUSB 2X1WL 5JXEC 2ADGA 5BUPA 4X80H 1YC8A 3F7LA 3G6DL 4JANA 3HZVA 4X7SH 3MJ9A 4TVPD 3TBYB 5LGJA 3LRSA 4CPEA 5E7FA 2MH4A 4FQPA 5IFHH 2NX5A 4N2DA 2B0SL 1A1NB 1CXKA 3DOSA 4LNVA 5D5MA 3VFMB 3T3ME 1KIQB 3ARGC 4P04A 1U8HB 2AV1A 4F5CA 3HZMB 2JW1A 1WAPA 3NSYA 5B39A 4KRPB 4ANWA 4KHTL 3DGGB 3VI3B 2OF8A 2A9ML 3CZEA 2AXGA 1MIEL 3O3DA 1I1FB 2MQGA 3B7TA 5J12B 4JFXA 4AGPA 2ICEA 3GI9L 3P2DA 1OV8A 1RJYA 5DRZB 2ZCHH 3ULVH 5F6IB 1NFIA 2JGSA 2XIDA 4MBOA 4V1DE 4FA7B 4L9LC 2X1XR 2HVJA 2IBGA 3QDAA 1NCNA 4XH2B 1O1VA 4KKAD 1NGXA 2E8YA 1GOFA 2QHRL 4M6OL 3ARDB 1NBCA 5FB8B 3HHRB 4EIZC 2PI3O 3V7AG 1AOZA 3TVMB 1ZVHA 3KS0J 3RKDD 5KJ4A 1OAKL 4MD5A 1QYGL 4YEEA 4BCZA 5LCVL 3B9KA 3HG4A 1JHLL 2A4EA 3DDGA 4TS6A 1CLYL 1KCWA 2DWEA 2NY4D 1UD2A 4PRNB 3V95A 2DY2A 1COBA 4GJTB 3CX5J 5HY9B 5EV7A 5C0AD 1T6WA 5D96C 3C75A 4EDXB 1HESA 1P4BL 5A2IH 1WISA 5FO7B 3V9CA 3P4NA 4DKFH 1DO6A 4RDBA 2JJWA 1LEGB 2HH0L 3ZQWA 1BZ7A 32C2A 4DNLA 4UT9L 1I85C 1MY7A 4NC0B 2E4JA 5JA8B 1XH1A 3KYOA 5KBDA 2QSCL 5EN2B 2W2FA 5JIMA 2ORBH 4LF3B 1G84A 3DIDA 4L1HA 2CO6A 1OK8A 4BGFA 2J20A 2QQLL 3ZE2E 5HHXH 1OPOA 1J8HA 4JKPL 5GHWL 4AEEA 4NQDA 3D87B 4HKZA 4MA1C 3FIQA 3O41B 3WFCL 3QARA 4BK4A 4MSWA 5FYKU 4GKCA 1ZLVK 2X53A 3GXMA 2NY0B 2YAMA 1QOKA 5EDBA 4FLOA 5DT1H 5TK4A 1NKGA 4UBDD 5B3SB 1UD8A 2LGNA 3CLWA 1GGCH 3H3PH 4OCXL 1QZNA 1SWOA 2OVEA 3SYQA 4A39A 1X9QA 3SCMC 1H8OA 2F18A 5TFSH 1ASQA 3JTTB 5B8CB 3O45B 4MKTA 5GS1C 4XH2A 1BOGA 1N59B 4JZJA 1U8KB 1NGQH 4N1EA 3TA3C 5GZNA 4RGOL 5F7EH 5DVKA 4BQBA 2RTMA 4WEBL 3SD5A 2Y22A 3G5ZA 3DVGB 1PG7X 4OR1A 5HGHB 1XHHA 1BQLH 1N19A 5I5RA 5CUSH 1TW4A 4PFEA 3SEPA 2FO1A 2AJVL 2I5VO 1HNGA 2KT6A 2BCKB 3OKLA 1PKQE 3R1GH 1K24A 3QUZC 1UA6H 4MQ7B 2WYHA 4U1GB 5D7JB 5HYJA 3EYFB 4NWTL 2GW5A 5HBSA 1YNLH 1A7NH 4OJDH 2YAOA 2FHNX 4JFWA 5FO7A 3VI4A 1OTSD 2GSIB 4WW1A 5DD5L 2GABA 3ZGIA 4NUMA 4KDWA 4ZQKB 1T7XA 1MAKA 1Q72H 3OVUB 4PLKC 4PJIE 1KCSH 2FEJA 2W65B 3VA6A 3FQTA 1J9TA 3QQXA 2VERA 1JPSH 4GNKB 1KXVA 2L4OA 2Y69B 2B3IA 2HMBA 1K4CB 1V10A 5AWNH 3RGVA 3TF4A 2OFQA 3DC0A 2OXHB 4QHMB 3X14A 3GO1L 4WY7L 2HKFH 4YZFE 4HBQA 3MROB 4H8WL 2UUDH 3O8XC 1N7MH 4HIJA 5KG9A 4XC1H 4OW6A 3ZUNC 2DL9A 1LCZA 2CGRH 1IT9H 4FHBD 2IANB 5ESAB 3G04B 4H40A 3P0YH 4OI8A 3S48A 2BRRL 4AEFA 4ORRA 4M03A 3IWUA 5HDLA 3IETA 4HIQA 4HPOH 4NKQB 4JDTH 4OLXL 4Y2DA 2BFVH 4H0HB 2BOCB 2DEYX 1LTXA 1U8OB 1JYXA 1OP3H 3AROA 4MB3A 3DMMA 5IM7B 4L18A 5HCCC 1IGTB 3IU3B 3WLWC 1G6VK 1INEH 1X44A 4QRRA 4GIOA 2OLDA 2X12A 4YHNA 3ZTDC 4FFVC 3R0MA 3TO2B 1UD6A 3HTLX 1OQOA 4YDAA 5H2BA 4J3BA 2X89A 1GGLA 4FABL 1XGUA 2F8OA 4GSDL 5IQOA 5C0CE 4ZUWB 2OK0H 2F7RA 1U0XA 4B95C 4U1IB 3P73B 3C77X 4GKOA 1H6EA 2BSEA 1N6UA 3QCVL 4P4KA 1OGAE 2DWTA 4AVJA 5MHSD 1GAFH 2AJ3A 4BSWB 1IAIL 3QUMH 1U36A 5D93C 4G7RB 3EZJB 1XB8A 1GY2A 3F6ZB 1NUGA 3H6AA 2CZUA 1G7HA 4YHMH 5DVNA 1Z0MA 3MNMA 4NSKA 3KPSE 4QR7A 4N0CD 1TVHA 5FM5O 5IXGA 3LSOA 1B3IA 2J12B 1H5BA 4YDVA 1HCVA 2OMUB 2K4WA 3MC0A 3ZTEA 2VMCA 2X7LB 3EOBA 1MCKA 3MYJA 2YD3A 4PTUA 4YBHA 4QHUB 2KUTA 5SV4A 4LCIH 1HE7A 3CR6A 4ZQKA 1I4FA 3CFDB 4G42B 1IM3A 3EO1B 3NZSA 4OAWA 1EPFA 4XXCC 3ZSSA 3QWOB 3KW7A 1WBZA 4UILH 5AVZB 5EEWA 4H1LG 3HAEA 2B5IB 4LESA 3F9DA 1LUQA 2OJZL 2B59A 3QG7L 1Z5HA 2FO4B 3V0AC 3HRZB 2VXUL 2MSPA 3IJHB 2Z0UA 4IJ3C 1OSPO 5LJEA 4FJ6A 1KIUA 1TIUA 2I69A 2I9TB 3GI8L 3RVXC 1J1OL 4O02A 4F1ZA 3CX5K 4WCYL 3NCYP 1ECZA 1TPXB 2CHWA 2EXYC 3BVVA 5KICA 4YBLB 3ZT7A 3QUKB 2F68X 2P8LA 3WIIL 2FEDC 4LAQL 1XH2A 2OSWA 4P99A 4C8XA 3BXNA 5AZ2L 2BH0A 3QCTH 4Z18A 2A83B 3IJ9A 4A7GF 5DJZB 2O5NA 5EU3B 1MLBA 3SDDB 4TNWF 3UL4A 3DJRA 3MODH 3APDA 3ZW0A 3D25A 1I9IL 3HCVB 1DQKA 2QTVA 3OHXC 4NQDD 1PZAA 4F20A 1NDMB 5DZJA 3DURB 5AQ0A 3MG5A 1E0OB 4KRMB 3UTZA 2ESVB 1XSJA 5F7FA 4OM1H 3BH9A 1FLRH 2NXYB 3DIFA 3P77B 4B9IA 1W0VA 2F7PA 2B1HH 3GKWL 4OZHB 4XOBA 1XAUA 2HJLA 5JMOC 1Y7VA 4KUCF 1BJ1J 4PPTA 5EBWB 3QNXA 5F9JB 1O9VA 5CLXA 1OSPL 1CK0H 3IPEA 3MLZH 4FGMA 1UM6L 3RB5A 3KR3H 4ZNEA 1T89A 4R26H 1QR1A 1MCOL 2C9RA 1UVQA 2ZYSA 1UWXH 3T6XA 2HLEB 4AYFB 2A4ZA 3OGOE 5C6WH 3KFGA 2D7PA 4ZTEA 3SOBL 1U2YA 2VSDA 2DLFL 3SKNA 3LQZA 2DIBA 3Q5TA 1JZ4A 1VADA 2NY3B 3NR3A 2X0WA 3VD7A 1UC6A 4O4YH 2QZ5A 4N8UA 3OC8A 3SY6A 2P42B 5BRQA 2J1YA 4MZ3A 4HPBA 2CJ3A 4ZUTA 2PWHA 1L5GA 5C0FB 4PWHA 3T09A 1HHGB 4L1BA 4IBWA 2GKIA 4CC4C 4Y16B 2QGDA 4EI5C 4YMYA 4ZAKC 5F9OH 4P2OC 4O5LL 3FO9A 4QTFA 3NN8B 1NGWB 4N2BA 3GRWH 4BVMA 4BFBD 4CNIB 3EW2A 3DX2A 3LIZL 4K3DL 4WI8A 3K6NA 1OPBA 4OKVA 5HYJD 5E2WH 4AQ1B 4QRLA 4PCKA 5FYLL 1A7OL 2AEIT 2G2RB 3WGUB 1V7NL 1KXTB 1TU2B 2FX8H 1TJGL 2J8UA 2X4RA 3VFVB 3PJLA 4H25A 2CDGA 4L05A 2V17H 4GOSA 1YEGH 1NGYA 4HWEL 2A7BA 2IV9A 4D3CH 4AI7A 4XMCA 4R4BB 4GAYA 3V0IA 1S46A 1SXCA 4EZKA 2NDFA 3CC5A 3WXVH 3W37A 4AMKL 1UJTA 4IW4C 1F58L 2WB1A 3H3IA 4AUYA 4ZHFA 3WENA 5CAYB 1KEGL 4R84A 4U1NB 2EDOA 1EIIA 2X4UB 4OFIA 1NWPA 2DM3A 1FNSL 2EVJA 1CL7I 5KSUB 3P9MB 4LPCA 3ME0A 2CJUL 2JIXB 2FGWH 4PRPA 2RTRB 1ZVYA 4ZT1A 5CZXD 3RU8H 4CSSA 5B1AB 3ZDZF 4Y2DD 4ZO8A 5I1CL 2K0RA 1KEMH 4JL1A 4NLAA 4P57B 3TBVA 3DUHA 5E08L 5FF6A 2NY1C 3S3SA 4Z78B 3C60D 2VDOB 4M93C 4Z3HA 2GI0A 2JKXA 1FYHB 2X4PB 3QA3B 4LKXB 4QRRD 4W9EC 5KSAA 4Q6IB 4P49A 3OR7B 4MAUH 2CNZA 1G94A 1I82A 2XTSA 1AC6A 4L8BB 4NN5C 3VG9B 3PV7A 2G0KA 5EF1A 1PLGL 5AOMA 2ITCB 3DIVA 2ZOLA 5EEEA 3OE3A 1OK0A 1X5AA 3IE4A 4WQOA 4U05A 5F1IB 3QE5A 3ETSA 3QZWB 3K6DA 4ZOEA 3TT1L 1HHGA 1NCWH 2BSED 1U3HD 4P4KD 5E1HB 4IDJL 5JW4Q 1R3KA 1F3DJ 3QDGD 1EJOL 5GS3A 5J6HB 2OZQA 2VUOA 1W6LA 3PDGA 4Q9CA 3H7LA 1Y1UA 2YRZA 4E5XB 1AGFA 2W95A 2XQYA 4I13B 2ZPKL 2V4LA 1W0WB 2FQDA 1DSFL 3TASA 4KY1L 1IGFL 2IZDB 2RFXB 2Y5EA 1AGDA 4UT7L 2RTNB 4K23H 2JU3A 3ARQA 2E7MA 4AGOA 1UZ8A 3RUGB 3FU9A 5C0IB 2RA1A 1EAOA 1DJSA 2NCEA 4JQVA 4LOUD 4DPRA 3S3CB 2ENQA 5DD6A 3ULVE 4I77L 5F2BA 1PW3A 4PH8A 5ANMA 3BFOA 1IM3D 3SKOB 1JK8A 2VH5H 1PCSA 5C08A 1PQZB 3PXLA 4DTGL 1SWQA 3MOBL 4K73A 3CDZA 1X5GA 3T6LA 3LNIA 2P5EE 3PNWB 2W38A 4HF5H 4PVMA 3PPSA 2IZIA 1JHTB 1N18A 1OP9A 4GRWF 3KYKH 4MNHA 1OL0A 5JHLA 4MZ2A 1M2VA 3E7JA 4TLTA 4LGPB 3QZNA 4XMWA 5DVPA 1U3NA 1BBPA 2FS7A 3RWFB 3K71A 2GAZB 1PSKL 2A3TA 1IBYA 2XBTA 1KB5B 1IFBA 2ANSA 1E8YA 4JN2B 1NAMB 3P9MA 4RZKA 1TSRA 1BAFH 1RUAL 2F19H 1WAAE 4L23A 3NIFE 5C0RH 1CLCA 4JY5H 1UYOX 2HN7A 2YMOA 5CS7A 5BUGA 1MLCB 4FKHA 4R7LA 2OL8O 1E3FA 1QACA 4ZHHA 4NCDA 3M1BB 3V0WH 4NT6B 5F7KC 2F58L 4IRJC 3FQNA 2Q8AL 4Z1PA 3IFOA 4ZMOA 5B5GA 4R83A 5D71H 4CU6A 3CBSA 1OB1B 3PAVA 5AG8A 3VI3F 3JV6B 4JPKL 3BVTA 1U17A 3L45A 4LKXA 5T1JA 1BAGA 1IC4H 5EUKA 5LJHA 1TZGL 4JFFB 4NCC2 4TF4A 3NPSB 1LE5B 3VXOB 4DCBA 2BSCA 2J71A 2IG2L 3LXCA 4RUUA 5JHDE 4WKZB 1UB6B 5B3NA 5KSBA 5C9JB 1WGOA 4HIXL 1EW3A 2JXMB 1ZNKA 4A2DA 3GMOA 4M8QA 1U8QB 1L9TA 4ONGL 4UF7C 4YE4L 1YQ2A 1XCTA 1YJDC 5FYJE 4PI2A 4R4NC 3WHE0 1NIFA 1V7MH 4MS8C 1GX8A 5F1NB 4MJIB 3UJJH 5KJRH 1A2YA 5BOPA 1BFOB 4NQTA 2IFFH 3OPZH 3D3VD 4HS8L 4IOFC 4DESA 4ETQB 4GRLC 5B29A 5K68A 4JB9H 2V5MA 1KJMA 1ZV9A 4IRZH 2UZXA 4Y5YA 4YDMA 3T2OA 4NQXB 3U9PC 4LDEB 3U4BH 4A6YL 3CHSA 1MVUB 1XSOA 5I76B 4UNUA 3KCPB 4GRMB 3QUYB 3UMNA 4AKPA 5HHVH 5C0IA 3S36L 1MDTA 1OTTD 4LLAA 4NO5B 5D1ZA 3K6SA 1WHPA 5DEJA 3SKOA 3NIDB 3GLDA 5HYIA 4APQC 1SEBA 2CRMA 1A6TB 5D2NE 1ZS2A 4JX0A 2BNQE 4KKBD 4QHNB 4QTHA 1T4WA 1U91A 4RGMB 1TJHH 5D45A 3UAQA 4L3RA 1AGCB 1EZVY 1Z3GL 4I3RH 3SYOA 3WLBA 1KYOJ 1HL8A 3KW8A 4KGJA 4CPHA 4I3BA 3IJYA 3RWFA 3BSHA 4OZFG 1NUNB 3IK2A 1NEZG 3LHNA 1KFGA 4JDZB 5BNXD 1KBVA 1KMGA 2E27H 3MREA 4WNJA 3L3HA 1RVFH 2PTTB 3IDJA 4WSKA 2HFFB 4PBXA 2C7UA 3SIKA 4Z2VA 3C09C 4IGBC 2R56A 3ZW1A 1N67A 1OD9A 3QEQA 4QTIH 2HJFA 3ZGHA 2HJKB 3KQ0A 2IPUG 4OZGA 1XEUA 2VLLA 3FOLB 3FTUA 2Q7YA 4DKEL 2OMWB 1JZ6A 3VB8A 5M7QA 2WNKA 2QVFB 2ZUQC 5ABZA 4ON1A 2Y07H 2ZG3A 5KW9L 1O0VA 2LV4A 2EE3A 1KFFA 2F53B 2EE2A 4PRPD 3CDFA 4G5ZH 2O26U 1EUOA 4C58B 1BWMA 4CADA 3S0PA 2WBKA 3CN1A 5T1DL 2XSKA 4FYRA 3FBQA 1MPAH 1G7PB 4UOJA 4Y4HC 4NNYA 1EFQA 4P3DB 2OYBO 4KK9C 3VGDA 3A5VA 5GGQH 4GZVA 3WHE1 2BNRB 1PM1X 3L3JB 5B1JC 3KWUA 4Y19E 3WJGA 2ZXGA 3KPRE 3T2PA 5A43C 2XKNA 2VN5A 3BRGC 1JTPA 1I7ZA 4YFRA 3EBHA 4Y4KA 1J0JA 1II4E 1I3RA 1AE6L 35C8L 2ARJA 3RSWA 2IWGA 3LTVA 4UMSA 2QO5A 3HNVH 4XVTL 4D9RD 3ZK0A 4Z7VB 5FWQA 4JRFA 3PDOB 1JN6A 4L29A 3BDBA 2D7QA 1SRIA 5EEXA 3ZO0A 5CBEA 2OL3H 3MNZB 1CICD 4M5YL 1JF1B 1ZNEA 1EVUA 3SDAC 1YJDH 5BXFB 4FJZA 2J72A 5I9QB 4MQSB 2Z3FA 5DRNA 3N3EA 4OSUH 2AL0X 5FGBC 2K7PA 4DUWA 3TT3L 3FCBA 3LHPH 1U8NA 1H3WM 2BVPB 1YC7A 2WLLA 1BLIA 3ARBB 4U0RC 4X4KA 4X9GA 3SDXB 3CMOL 4AK2A 4M6SA 1JNJA 4YHIA 2UY7A 4BHUI 4DHLA 2A3FX 1HQ4B 1ICTA 2YFOA 1HHKA 4HSCX 3UFIA 3U9PH 1NCAH 3MRNA 3US9A 1BSYA 4O49A 3MFFA 4Y5VB 4MYPA 3MOAH 3QDJD 3Q6GH 4C56A 1NIDA 3H1ZA 1UZ6F 4GH7B 5DJ0A 4A7TA 1AVEA 1JFHA 1FWXA 1GR7A 1MFVA 4NHCH 5HXMA 4ZXBB 4EO5A 4OZ4B 3PL6B 1C08B 3OZ9H 4IK7A 1FUNA 2ZP8A 2KD2A 5H37G 5C08D 4L0ZA 4EKXA 3MJ6A 2QVKA 3AAZB 4NC1C 2UX7A 5FYKE 4LSSL 3FUDA 1C16A 5HGBB 2AKQA 4MCYB 5DJYA 5F72S 4KKAC 1D5IL 1NBVH 2SEBB 5F3HB 1NDGA 4K15A 5HHMD 4FBVA 1WCBB 1REIA 1D5RA 1VWDB 3LZFH 2QSQA 3P30H 4GKSA 4P23A 4W4OA 4XMPL 1NAKL 2DKMA 4NM4H 1MCLA 1OZUA 1U58B 3F6IA 2NY7L 3R19A 4PV9B 5DFVC 4AJVA 4BXVA 3C5JA 1UYNX 2BMKB 3INUL 3ROOA 4FG6D 1HOCB 1H3PH 3DHPA 1RZIB 2FAUA 2TAAA 3CFBA 2R0KH 4X83A 2P8PA 1BEYH 2NY4C 3VGAC 1KDIA 2WPUA 1IAKA 4D6BA 1D9KA 1WBXB 2OW6A 5HTEA 1IAMA 2QGEA