3P02A

Crystal structure of a protein of unknown function (bacova_00267) from bacteroides ovatus at 1.55 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
314
structure length
308
Chain Sequence
WTDEQFKQLISFKTQPGGWGVTDVHVRYANSAKYTYNLPVVSGTDDRLVSFSLRDDTLDILNFEKFGNRPELYFRELPQKYYSFPKELTIPAGQSHALLPIEFSLDGLDDSQKWALPLKVCEDNGTYAVNPRKYYRTAVLRPILFNEFSGRFSGSSLLGTMAGESDIKFSSTEIKLNVVTDSIVFFYAGQRTEDYEDRINYKVFLQFTGDKVDSKKDLYKMKIWAENEKLKFNSYSTPTYKVSSEMDATKTYLKHTYIVISDIDFDFVDYTSVPNYEIEYNMKGGLSVSRDLDTRKPDEDQGSDSKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a protein of unknown function (BACOVA_00267) from Bacteroides ovatus at 1.55 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 78
structure length 308
sequence length 314
ec nomenclature
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14274 DUF4361 Domain of unknown function (DUF4361)
A PF16343 DUF4973 Domain of unknown function (DUF4973)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.440 Mainly Beta Beta Barrel Lipocalin Lipocalin 3p02A02
2.60.40.1740 Mainly Beta Sandwich Immunoglobulin-like hypothetical protein (bacova_03559) 3p02A01
3N91A 3P02A 3POHA 4DQAA 3NQKA 3SOTA 4QNIA
chains in the Genus database with same CATH superfamily
3IRPX 4DP2X 2NX5A 3X2QB 1A3ZA 1EAQA 3QA3B 1YWBA 4A38A 3AS3A 3FUEA 3GI8H 3OKMB 2HZQA 4YXHH 4OCRH 3GMPA 5J06A 3ZR5A 2J8UA 4UZUA 4OZ4B 2ODIA 2GTFX 2NR6D 1SJHA 5DK0A 1YP6A 4LLDB 2R56L 3AG1B 3H9HA 1GAFL 3F7YA 4LCYA 5HHPA 5ICXA 4MKTA 4X6DA 4KO7A 5FGCB 2YEZB 2DTML 1FPTH 4GI6A 3HE6B 5FO2A 3VXSE 4DVBA 3BAKA 2Y06L 5AOKA 1MX7A 2P8MB 1UM6H 1X5LA 3EOTL 1BWMA 2VL4A 1EBAA 3I17A 5HY9B 5FHAL 4K73A 1RK7A 4JFPB 3NSFA 2IH3A 3BKYH 4GXVH 1OP5H 2RACA 3VFMA 4HK3J 4JUSA 1HDMB 1R3LB 2IEPA 2V8MA 4Y4HD 2X89D 1TEYA 1N0SA 3BPNB 4XMXA 3T0EA 4M8RA 2DM7A 2W60A 3CQQA 4PJGA 3C87A 4B97A 1NFDA 1G9ML 1XVSA 3BPCA 1J05B 3FQXB 3P69A 2A6IB 3FT3A 3WTVA 5FYKH 2ISDA 1CYWA 1KEMH 1WTLA 1G7NA 2ZWKA 3X1EA 3HAEB 5D7LA 4X6CF 3G6DH 4E68A 4N1HB 4XP1H 5ECJE 3UJJH 3NRPA 1H3GA 1TJMA 3PWUB 1MQ8A 4AKQA 2ZAHA 2KLRA 1N26A 2ZKXA 4B96A 3NCMA 3ARZA 1RUQH 3UGXA 5E95B 2GJ5A 1V3MA 2VLKB 1TSHA 3TNMA 2WQAE 1UFGA 2X1QA 5GHWH 1M57B 2WP3T 4JCWA 5F0JB 5IUSA 1T89A 3QQNA 1W0VB 1M6OB 3VXNA 4HFUL 2J5WA 5LKFA 4K8RH 4FFYA 1T3FB 2EDOA 1AYOA 5DJZB 1IBDA 1SVBA 4WWOA 4GKCA 2SEBA 4GD9A 4JFEB 5DUBB 4I3SH 1K4CA 5B8CB 2P42B 1DBJH 2QV4A 1SUHA 3ES6A 1JPFA 4W9EC 5EOCL 3NJJA 5C08E 1RJCA 4HYTB 4O4XA 3K81A 1JI2A 4K0OA 2JJVA 4AGNA 3TVMD 4CVUA 4BX7B 1KZWA 3O8XB 4YFQA 1NC2B 4XBEL 5EZOL 3FN0L 1PEZA 1UC6A 1EVTC 1LQBC 4TQHA 3V4VA 3RVVD 4JRXB 5IVOA 2ERJC 3MRBA 5D4QA 1M1XA 3WEBA 4ZSOE 3IJ7A 4M8QA 2B59B 1X6NA 4YZFF 4PJHA 2P24B 4R4BA 5T1KB 4NQCA 3QEHA 1J0HA 2NPLX 4ZPTA 4LVOC 3P4OA 1ETA1 2CIKA 1TXLA 4IRJD 2K9FB 2HKFL 4JRFA 4IYKA 3QFDB 1RZPA 1PX4A 4BVMA 3B37A 2JB5L 3BZFB 4CC4C 4GSXA 1VHPA 1IAIM 4L8SB 1D9KA 3W57A 3ZPDA 5FXCH 3WXVH 1J0JA 3G08A 1X44A 4JN1L 4ZQKA 2Z8VC 5FYJD 3LIUA 2W81C 5C8JA 3H9SA 4U7KA 4QRRB 3ZGIA 1MRCL 1K3BA 4ZW7A 2Q2EB 5A3IC 4IRJC 1YCSA 5F21B 3HG1D 1FEMA 1H8NA 1MFNA 2E74C 5EORL 2VDLH 3N0PB 3KYKL 3MLRL 3SDAA 5HHNA 2BY0A 2Z7ZA 4G11A 1KT5A 2ASNX 5M95B 3SO5A 2JIXD 2CAKA 2LA7A 4ZO6A 4FTVB 3R7RA 2D7OA 4ZUTA 2TRYA 2XVGA 3WJLA 1IT9L 2A73A 2MQCA 5DHMC 3AFLA 3LV3A 2QLVB 3GMOA 4GB9A 5E9NA 3RWIB 3B5GA 3KPSE 3NJGA 3EFOA 4KROD 4K3DL 2RMNA 5F88A 1NSNH 2IZKA 3L54A 2C9SA 4KROC 5A2AA 4J6RH 1RULL 3GJEA 7PCYA 4GSRA 5HGGS 2VMDA 1I1AB 4PJ6A 4MJJA 1QVOB 1XGQB 4K07A 1QRNA 2BSTA 4NT6B 3CDZA 4DPCX 1YLBB 2MNUA 4NQUA 4CNIA 4P23C 1JV5B 4CILA 2P5WE 4P5TA 5E6UB 5K06A 1KXVC 1GXAA 4ZXBD 4ES8A 1RZIB 2W65B 4N90E 1NP4A 2DQJH 3KDMB 4JFYA 3OMAB 4YHZL 4FQHB 3ULUD 2ZT9C 4KY2A 4OQTA 3WIFA 1I3RB 4J4PD 2RTGB 1Z9SB 1I7RB 1J0KA 1GT5A 3ZYOA 1EJFA 1N5YH 1UUSA 1B6DA 1NDMB 3CVCA 1OT4A 3CWGA 3TJEH 1WRFA 2FZ3A 2FHNX 1HQQA 2YC1A 4AQEB 3PQYD 3KBFA 4X80L 1YNTB 1DSFH 2GHWB 5H35A 4E41E 4HKXB 1XH2A 2CBMA 1I85A 2IGFL 3P0VH 4I85A 3SBRA 1VZGA 2EYRA 4LZKA 2ARJA 4FQ2H 5HBSA 2BNQE 5A2LH 3RWCA 3U0WL 4W9FC 4JY6B 4FNQA 4U1LB 2GIMA 1G7MA 2PMZA 3ROOB 4G7YH 5H9NA 4HOXA 3OG6B 4F1ZA 5AOJA 4P5MA 4NN6C 5F7MC 3ZY7A 5E2UH 2H2PC 2IMMA 3N9GH 4NHUA 3SDYH 2WAQA 4JPWH 4L3RA 1MDTA 4HWBL 4I3CA 3DJTA 4MDJB 5DFTA 3PJNA 4GMSH 4WSKA 2OYMA 3S35L 1HWWA 3W3BA 3FA6A 3BRNA 2ESVE 4YGGA 3FTVA 3QUGA 4QTFA 3B6SA 3D05A 7CGTA 1KBWA 4PMEA 2J55A 2CUMA 2XBZA 3QUZA 1PYWA 3I02B 5L8OA 1YEIH 4HH9A 4GKNA 1T1WA 4LCWE 5CP7A 5JHLL 5AD0B 3CX2A 3DHUA 4WY7L 4NM8L 3RUGA 2BVPA 3EMMA 4NP1A 3WIHL 2WC7A 1KGYE 3HNTL 4NHUB 1EHLH 1OCWL 4L4TD 1SY6A 4W9CC 5H94B 3GI8L 4N2FA 5CXPA 2EZ0D 2WOBA 2RBLA 1HN2A 1VERA 3WL9A 4KKPA 1OSPH 4PREB 2OZ4A 1DBAH 1CLCA 5KBLA 5I8KL 1B0OA 2ENJA 1CFTA 3UERA 1M9WA 3CZGA 3K5SA 3NIGE 3QJSB 4JPVH 2XKNA 3T77B 1QFVA 3FPYA 3GNMH 3LHPL 2XG4A 5GPRA 4PGCA 4AIEA 2RTDB 4GAJL 2HN7A 1XWVA 2I5ZO 1U9KA 2Q7AA 4JJHA 2DTMH 4NKOB 4BCXA 1GGCL 3BP7B 2YWZA 3UDWA 2A74C 2E6PA 2VB5A 4DEUA 1WZ1L 4E42A 2NY5C 2ROYA 3AABA 1BZOA 4H40A 4DZBA 4H8PA 4MQXD 3RDQA 5TK4A 3HJ0A 4L3FA 3SHSA 4FRWA 1FDLH 1ECZA 1RUMH 4AEFA 3RAJL 3QQ9D 3V4PA 2DIBA 3U9UA 1WBIA 3Q6GH 4YNYA 1I1AC 1ZGLP 3SDDB 5IROD 5F58A 3KW7A 3CC5B 4U31A 3RKPA 5HZ8A 1TITA 4N2GA 4U3SA 3KLDA 4KPHH 5A6LA 2OTUA 1J5IA 3RGVD 2KT6A 2AJUL 1KY7A 1MLBA 4Y19A 3T0EC 4XO5A 3MA7B 1I1AA 5DWPA 3VD3A 1RZJC 2EO9A 1YPZF 4LQFL 3RZCB 3TT1H 5CEZH 4QXWA 2SODB 2WXNA 1TQCC 4M5TA 3WEAA 2MNWA 3GSXA 2J1XA 3JZYA 2ZCHH 2WWPA 1IVLA 2BX5A 5ICUA 3MRCB 2B1HL 4U1SB 3O9WA 3TEUA 3KYNA 1U3JA 2OZ4L 2WJ7A 3IMSA 2NXZD 4KFZC 4W81A 1OM3L 3FO2B 3BYYA 3ZDZB 2EICA 2JE8A 4EE2A 2HCZX 2CRZA 1F6AA 3IJEB 3VAEA 4G80B 1PZ5B 5E8PB 1NGQH 1ES0A 3ARTA 3L3OC 5E03A 3QT2A 2PI3O 4JFFB 1JWMB 3T6WA 4OCRL 4CV7A 1DE4B 3CDYA 4QYAA 2DYRB 5JORA 3FQRA 2Q86B 3VGBA 4NLHA 1Z24A 1ZSHA 1TFHA 4K8RC 3K80A 2Z4QA 4Y1AA 5BV7B 1KQWA 3KYOB 2A0LD 3MNWB 5TDNA 1RXKA 1N7MH 5T3XE 5HVHC 5D7IA 3S88H 5LKEA 5L3YA 1TW4A 4XBGA 2OI9B 3PFUA 4MWFB 3L6FB 3QQ4A 2IBBA 3MHZA 4UT9H 1NMCB 3TASA 4LB8A 5I76A 4UQEA 4D9QE 2HWZL 3OMNB 4OD1L 1J7VR 4N6QA 2EDLA 1MJ7L 2GJ6D 1M2VA 4RIRB 1AOHA 1FL3B 2A9NL 4Y5XA 4ZTOH 2BS71 3F65A 1RFDL 5T1KA 1AXIB 1B8EA 5AW6B 4ATWA 4M8QB 5CS7A 1F4AA 5EF2A 2QMIA 1BVLB 5T33L 3VQMA 2Z0BA 3ZQWA 2ZONA 2ALAA 2A0AA 3OLGA 1WICA 2H3XC 5AVZB 4ICWA 1NC2A 1N4XL 1FLRL 1U8LA 1KPRA 2AZUA 1L9NA 4U4IA 4Y5XC 1U0XA 4H20H 5DO8A 5AVQB 1KOIA 4MSWA 3RDJA 3NFPA 2NYYD 5MEQA 1KEML 4UMGA 5E9AA 3U1SH 5IJCC 2OL3A 2CH8A 5EB9A 1ADLA 3RFZC 3S3SA 5L2KD 3KYKH 3WYQA 1A3RL 1GSKA 2IMNA 2WQWA 4HHGA 5DVOA 5F0LB 2NNQA 3CFDB 3NIFF 4HOWA 4CDDA 3MVSA 3NH7H 4QHKI 3FFDA 3DETD 4YFLI 1OBQA 2DAVA 3TCLA 1SJVA 1CDBA 1ADWA 2X7LB 1YMHA 4P46C 5C2UB 2OMZA 1H15B 3JS1A 3AT0A 3ETBJ 1TCRA 3CSYA 1IT9H 1B3IA 3D25A 3O6LL 1BD2D 4GAYA 4OZFB 5IFJB 4O4YH 5E0QA 5ESVB 1SA8A 3QDAA 4TKBA 5DK2A 4HAKA 1TVQA 4YX2L 3AREC 3QAZB 4LLWB 4X4ZA 1FGVH 5EUOB 3V55A 3X12A 1JUFA 1GVIA 3GHEL 3OKOA 1CF1A 2PPAA 4C59B 5I71C 4JGNA 4M43L 2APTA 4WGKA 3MYJA 4ETQB 3BFWA 5DJCB 2OR7A 5MENE 5IFHL 1MQKH 4GZVA 1WG3A 2F54B 2EEXA 3INUH 4AIZB 1UZ8A 2QVMA 5C3IA 2Z91B 3VSUA 1F4XH 1YQVL 2DJSA 3OJ2C 3NPSB 3FIDA 3FCUB 2XPGB 3NZSA 1QY2A 2Y1AA 2IAND 1R3LA 1RV6X 3JWOH 3T1FB 3F05A 1BRPA 3DETC 3PQYB 3DJ9A 4DFIA 3II1A 4ORGB 3FS9A 3PQYE 2Y36H 2NY0C 2CBSA 3S60A 1L5GA 2EE2A 4HIHA 1OARL 1BF8A 1G7QB 3PP4H 2CLVB 1KXTA 1Q0XH 1AGDA 2JK5B 2COQA 1YIVA 3T0ED 3S8GB 2EYSA 1YJDL 5T1LD 1MW2A 1U3HB 4ZQTA 4PJ5E 3WXVL 2A83B 4IIQA 4G6AC 3VXQA 4GRWE 1JZ3A 4N1CA 3FHQA 5E2TL 3ULUE 6FABL 4XVOA 1JPSL 1XIWA 4YSTA 1PY4A 1OPAA 3D85D 4JGJA 3JTBA 1ZPLA 4FG6D 4XCYA 1AGEA 3D07A 4J39A 4YWGH 1ZLWH 1MEXH 2D8KA 1MUPA 3FB5B 5AUMA 5IEKA 3H3BC 4L0PB 3ZRCC 5K93A 4BGLA 5BRZA 2DJMA 2ILLA 2IZJA 3R1GL 4IB7A 1K4DA 1Q0EA 2ITCB 2W80C 3GSVA 1UEYA 5IBTH 5DUJA 3HI6L 4RMRA 1IAIH 2BVTA 2BS8A 1C16B 2QTEA 3DX2A 1N6QL 1S3RA 1RKRA 2NNCA 1F45A 1IIIA 4MKMA 1Q38A 5KYUA 2CO3A 3VI3B 4EOWH 5GS0D 3TGBA 3JYCA 5I15H 3KFIA 4AUYA 5I71B 3D51A 4JK0D 4JG0L 5D1QB 4KGJA 4DP4X 1QWUA 1J1XH 4I2XA 2KMWA 2PP8A 1MREL 2W0KA 1MFEH 2BVQB 3BWSA 3IU4H 1NDTA 5BYPA 4XVJH 5CEXB 1NEZG 2YKLH 1MOEA 3IDJB 1S7WB 2KLTA 3GHPA 2XY1A 4AMKL 4BZ1H 1JNNL 4M7KH 4U4BA 4LHUA 3QORC 2A6KA 2P8GA 5I8EB 4JPVL 2EDRA 4WCYL 3MQIA 4ORRA 4NQCD 4MNQD 1T1ZA 4LXFA 4QI3A 2IPTL 3QNZA 2WBXA 4WUUE 5J6HB 1KEGH 1VWGB 4J3SA 2FSEB 3FEPA 2LLLA 1KJ2L 3K6SB 1MW1A 5FWRA 1HEHC 1HHHA 1VACB 1JN6A 3UJTH 4YGAB 3UC0L 1FSKC 1ERNA 4JL1A 4JM2D 3P1VA 5IESH 5ID0B 3D39A 3PV7A 1EXSA 5CBAA 2PW1B 5FGCE 3HS0B 2JCCA 3FRPA 2XIIA 4L2YA 3G5YA 3T3PB 1S78C 3D06A 5JIHA 3Q2CA 5F1SA 4Z77A 3K6DA 3ARWA 3DGGB 3GSNH 3KPOA 3A4EA 3HHSA 3WV0A 5I82A 4WEUD 1S7SB 3M46A 5TE4L 2AC0A 2HRPL 1SYVB 3HG1A 3VI3E 3C5ZA 3BHBA 2AGJH 3ZUOA 4YDIL 3D87B 1A65A 3MRGA 1YECL 1BZEA 2WYZA 3QWOA 4LEOB 2Q7YB 4J28A 4QGTA 2VKXA 4FNRA 2X4NB 3O3EA 1H3PL 4L1BA 4TUJB 3VFRB 3NZHH 3H8NA 3QPKA 5FOJA 1EJOH 2E9WA 2FL5A 3D12B 5DZVA 3IVKB 2VYRE 5FOBA 5GGSY 4JRXD 3GSQA 4QMEA 5LDUA 1ADQL 4QOKA 1KJ2B 2F9BT 2J5LB 3QDJB 3S37H 5C0DA 4A7GF 1OHQA 2NW3A 5KVDE 5CN2A 2PW2A 4NV7A 2EDBA 3C5SA 3AAZB 1SWCA 3CUPB 3QQDB 1AQKL 5IK3B 3FONB 4AOFA 5FM5M 3T6VA 3ARBC 1OM3H 3NACH 1YEIL 3GIVB 3FELA 4BJLA 2X4QA 3GD1C 3CDCA 1WK0A 3F7VB 4L4VA 3ARYA 4UT6L 5K1VA 5IR1B 4FNSA 2ESVA 3SDCB 5E56A 2VLKD 3AXLA 5D1ZA 2YLHA 2PR4H 3VXSB 4O4SA 1S7VB 5DGQA 5I8KH 1SYSB 3OPZL 5E6IA 1QWDA 4GJSA 1Y55X 1MAKA 1T4KA 1DVZA 4TUKL 4NP4L 4AQAA 3QGVA 1UM5L 1JERA 5IB4B 2DMHA 1LFOA 5AYTA 1JGDA 5DDHB 1A6TA 2OMTA 1N7ML 4PGZA 4ZFOB 5CEZE 5MEPA 5J6GB 1OP3K 1Z9MA 2UZ2A 5FGRA 2OMNA 5F7EH 3NN8B 4NYLA 3QUML 4XCFH 1XV8A 1JV2A 5HPMB 3ZTJH 1T2JA 5GGTA 1HXYB 2V33A 4J3UA 4CGTA 4MDIB 2N4IA 4WU5B 1SWRA 1G5GA 3B9VA 3CDGB 1MJ7H 4Q6IB 2DWEA 3CVHA 1DUYB 4YHOL 1BZDA 3IBOA 3IGKA 4Q8BA 3PF2A 1YEDB 4HJIA 1XAKA 3FB6B 4I9RA 4HS3A 4QHLA 4LF3A 3N43F 2D73A 4Q9QL 1T22B 1LP9F 2ZSWA 4NN7B 5T33H 2VXUH 2NMSA 1NOAA 3NQIA 3VH8B 5EUOF 2AV7B 3ULVL 3QIWC 1LKEA 4N2IA 1FLRH 4FTVE 5F6IB 3QUKB 5CIPA 1BWYA 2F15A 1OM9A 3K1KC 3SKOA 3JUZA 2GSMB 4PRPA 3GGWB 4JJOA 4PGEB 5A16A 2PYEB 3G3LA 4KX8A 3NAAL 3QO0B 1OQOA 4WTZG 3DROB 3VTTA 5D2LE 4RFEA 4ICXA 2XVKA 3AEHA 1KCSL 3DUSB 4PV8B 4NQDD 1E5AA 3MCKB 3EHBC 3MV9D 1QEWA 2PP9A 1LXMA 4UV7H 2Q9SA 4L29B 4U46A 1ACYL 2HT4C 5DD3H 1LO2L 4KGLA 3PJLA 2AJ3B 3MLVH 4JHWL 1S7QB 3L7EB 4JN2A 5D96B 3ZHKA 1LP9E 1NZRA 2G8CO 5FYJU 4NPKA 4HIEA 2P5EA 1E02A 1A7BA 2CHNA 4WBKA 1MQKL 2Y07L 1H3TA 1H3VA 5MP6L 3OE3A 4C56D 2YJLA 4XNZC 2RFXB 1UWYA 3OB0K 4F15B 3CLEH 4JCLA 2XJLA 2XWBA 3TO2B 1Y6MR 4L5FE 2XKUA 4IW4C 3BCDA 2EDYA 2JGSA 3SGDI 3P24A 3QRGL 1AZNA 3CBRA 4UILL 4PYGA 1XFPA 1XHHA 3ZZLA 1YN7B 2X4UA 4Z2OA 5FYJE 4AYFA 4NYQA 1U8IA 2NXYC 1CE1L 5IROA 4XN4A 1H3UA 1NCCH 1Q0XL 4JKNA 1RFDH 5LGJB 2DYPB 3DO7B 4ZO8A 1CBSA 3PWNA 5DHVA 1HHIA 1MZZA 4N87A 3CU1A 2R69H 2BERA 3LNDA 1IQDB 4XTRC 5HDBB 3PAZA 2WINA 3FO1B 1KCVL 4ZSOA 5CCGE 1DVFD 5CGBA 1T4WA 2MKLC 5CSBA 1S7DA 5J8OA 4ZZFA 3ZX1A 1CBJA 3QIBA 4JFOA 3VQ1C 3C60A 4YHYB 2FWSA 4UTAH 3CZLA 2F7IA 1I53A 3GQFA 4HWEL 4YPGB 3VXMA 4UZSA 2ICEC 3BUBA 5JMRA 1ZLSL 2BSRA 4QHUB 4RWYL 1DLHB 4Q74A 2E9IA 3GBNL 2EXYD 2NR6C 3MLSL 1B88A 2D7PA 1GIGH 1LEIB 4FJYA 4YX2H 4MVIA 4X4KA 3I6KB 1G7JA 4IRWA 4MMXA 1YY9C 2UXVA 1NQMA 3QIWD 4KHTH 4U6YB 1KIQA 2FD6H 4ZFGL 1KDJA 4PJ9C 1HXZA 3V4PH 4M1DH 3GI9H 3WG7B 1JL8A 5FM4A 2NR6A 4M93B 3SDXB 1BYNA 1QSVA 4KZEH 2Z0UA 5FFOA 4JQXC 4X7SL 2QBWA 5D5MA 4BZYA 3S3PA 5CGMA 3X00A 3EJPA 5E5MB 3ZYZA 4XPBH 1E4WH 5GGUB 4Y2DB 3Q01A 3EYQC 5B1AB 4JFED 3BP6B 5IXGA 4GFTB 1U93A 1QFWH 2BHYA 4Y9BA 3VSVA 3VXTA 4B9YA 2F1EA 2ZYIA 2YR3A 3QJHA 1QFPA 2RIKA 3AY4A 4R2GD 1ANUA 4N8UA 5C9KA 3ZGHA 1XBDA 3B5TA 3AXIA 1U33A 1DJZA 1UA3A 4ZMTA 1MVYA 4JG5A 4E41B 4ZOCA 1A3LL 3CCHA 5IJVA 1NCTA 3K6OA 3W0WA 4IBYA 4CADA 4NRXB 3TBWB 3DMMB 4X8CA 5CJQH 3IMWA 1J87A 1JZIA 2ADFH 5DC2A 5DI8A 5CFHA 4FG0A 4AW7A 5L2KA 3STLB 2AKQA 5DEZA 3VQLA 1QHQA 5TD4A 3ARBD 2FWVA 4G59C 4RGND 2DL9A 3MBWB 4KQ4L 2GQHA 4C56E 3Q8FA 3BXNA 3UTQB 3VXRB 3CZSA 1J0ZA 3UFIA 1X7SA 2BRQA 3EW1A 4AENA 2B39A 1A47A 3FTGB 3LPWA 4KOCA 3UEXA 4LRNH 4W70A 2X55A 3KAAA 4A55A 4WAFA 5GGSB 4OFDA 5DQDL 2XRAH 2JH2A 2DLFL 3KL3A 4JZNB 2BSED 1FUNA 3QEGH 4TTDD 4JG0H 4LK4A 4XNMB 1AMYA 4C83A 4Z95H 2G2PA 4NM4H 5K59F 3C2AH 4NPJA 1A8JH 4YUEH 1Z5HA 3ZTJG 2VR8A 2ZSVA 3ARFB 3RLSA 1S9WA 2OR9H 4UT6H 5L8JB 2ZX7A 4CPFA 5IB3B 4Q7DA 3TN0A 2OL6O 4YHMH 3SPIA 1LEGB 1T0MB 4P2QD 4BEIA 2PR4L 1TTBA 4G8GE 4XN7A 3C6LB 1XDTT 2NYYC 2HYMA 3EGXB 3GMLA 4OS8A 1GOHA 5G5DB 3EUUA 5AWNH 4KO5A 4PJ7A 2IANA 4UAOB 5DRXA 2F7PA 2NZ9C 3M17A 4O2CB 3U4BL 3Q8BA 1GKOA 4PBVC 1NIFA 4KZDH 4JM2C 3ZE0B 4E5XG 1KEGL 1S7TB 5CD5C 1XF3B 3VDCA 3QUMH 3P30H 4Q4IA 2I32A 4FFTA 3CFBB 1MCLA 3LPFA 3MLUH 4H8VA 1Q72L 4WENB 5F6HI 3ILPA 2QFRA 1KCUH 4P3WA 1L0XA 1G85A 4Y9EA 1HSBA 3PU7A 2WLIA 3PNWB 3QORD 1HINH 3ZXAC 2A6DB 3F3HA 1NGPL 4OFIA 5E6SB 1D2PA 1S4IA 1MCEA 1GGLA 3NCWA 4PTUB 3ARBB 4IBLT 2WXFA 3PGDA 3IMRA 3L3DA 4MA7L 4MAYD 5EN2A 4DEWA 3C8KA 4OJFH 3VXSD 5I18L 1H91A 4GUOA 4LCCB 4CC0A 1DQTA 1QABA 2D9QB 1LEKB 1NFKA 1JMZA 2Y0SA 2B14A 2F53E 4O51A 4YVUA 4ODUA 4AGQA 4DGWC 5T1DL 1DJSA 5IHZA 4LHUG 4JFZL 2BCMA 2AEQH 4NERA 2BIOA 2QPDB 4YVBA 3FL7A 4GJTB 4NGHH 4OTXL 3EFFB 4Z9KB 1BAFL 3BWUC 4YXKH 1P84K 1TSRA 1YPZB 4AZRA 4ZUSB 5DJAA 4BDVA 4I2XE 4HIJA 2ED6A 5EF3A 3QDJD 3S5LA 5JDJA 3GZPA 3MO1B 3LS4L 3NACL 1UWGH 2LTQB 4BD4A 3A6BL 1UB6B 4XNYH 4GLRH 4POZC 2RB8A 3EGSB 2B5IC 1JIWI 1LO0H 1ZXQA 4Y2DD 3SLTA 3LEXB 3TEYA 5CHKA 4FE9A 4ODWA 4PFEA 4Y2LA 3NGBC 4GK9A 2RJMA 4LOUD 4PJFA 4DQ4A 1QA9A 3UYRH 4KK6C 1ZLVK 1TJGH 2GVYA 3LN5A 1GMIA 4Z18A 1AXSA 1ZT7A 4R96B 3VFGH 4G70B 1RCYA 2DJGA 3OD3A 2QVFB 3RVWD 1S9VB 2ZOLB 5D1XC 5KVEE 3A4AA 4CSTA 3Q3GA 3SO3C 1G0XA 4OZHF 1EFXD 3AKNA 4HUUB 1QR1B 3WBDA 1NBZB 2F54D 4OF6A 3FW4A 4U1MB 3D39D 3LQMA 3R06A 2Z1KA 5DS8B 4PBXA 4R0LA 4N2HA 2OYKA 1NBZA 1NLBH 1IZKA 3K4ZA 5C0BB 4MQXC 3B8YA 3MOAL 4OI9A 5KVMC 2DD8H 1GYCA 3HR5B 4YBQC 2R1XB 2ZJSH 5CLTA 2FX7L 4LLYA 2BW5A 3C5ZD 3LXBA 1UZ2X 3RWDB 4U6HA 2NLJA 3NCYS 4PJEB 1L4IA 2Q4NA 2CO6B 3O3AB 4Y8DC 2HH0L 3MROB 4RQQB 1CQYA 1EZLA 3N44F 4KK5C 2QJDA 4JFXA 5JW4Q 2Q10A 3EJUA 4IBZA 2N1KA 3ZW2A 1XCQA 2O5YH 2ZKMX 5LXVA 2HG0A 3WY4A 5D4JA 4LGPB 4ADIA 5I1HL 4ZO7A 3ZDYF 1NOLA 3A23A 1OPGL 3UAAA 1CR9L 5A7EA 2VN7A 2XICA 1ZLUH 3PQUA 3NGBB 5AG9A 3VXOB 4IKLA 1JNHA 1KN4L 2NW2B 4OZIA 3UTPD 1UKQA 4D0DB 4Y16A 4U9CA 4LEXL 4PJAF 5B27A 1KTDA 3MRLB 3O6FC 4N9OB 1R24B 4AE0A 1C1EL 3VSTA 4PJXF 5CSGA 3HPEA 4WFFD 4A04A 4GYBA 2WIIA 4JL2A 3UEQA 3D4ZA 4R8WH 3DBXB 4EMZA 2X6AA 1J11A 2ZCLL 3GBNH 1CGWA 2WXGA 4UZGA 2XWXA 4L4VD 3L45A 1ZE3C 2CCWA 4L4TA 5B3SB 3RX8A 5HI5D 1V3LA 3LKNA 1I7TA 3APCA 1WIPA 1ZJAA 3GZQA 5GRVL 1HXLA 3BWUF 3G6AA 5DD3L 5BQ7A 3NP3A 3S96B 1MFAH 4JHWH 3BP4A 3GI9L 1BIIB 2J8OA 4QO1A 4PWKA 2OYBO 5AZEL 3VG0L 1G7PA 3SIKA 4CSBA 1DVFB 1WCBA 1E40A 5IBUG 4B7LA 2Y07H 3TLRA 3KDPB 3FR4A 2FT7A 3LS5L 4NZJA 5C0CB 4FLRA 3E1F1 3WUZA 3CLEL 4JQXA 4XGZB 4FA6A 2F5BL 1GY2A 5I73C 4S1DC 4ACPA 4A2LA 5I1DA 4CAGA 2EVFA 4DSYA 1G6VK 1ZANL 3BN9C 2D7TH 4HJ0D 1SWSA 2J2ZA 5DO2D 2OXHB 1E5PA 1JK9B 1S7TA 1CF8L 4F2FA 1A7QL 2GIYA 2X5PA 1ULVA 1IGYB 3P4LA 3H2QA 1B4JL 1OTUC 1NFDE 2W38A 4GNKB 4JMXA 4JUTA 5C0CD 4PLKD 2IANB 1KBBA 4TUUA 4XP6L 1EMTH 4P2RD 4F9LA 4AG4H 4YDNA 5LQBH 2NCEA 2C7FA 3C6LA 1G7LB 5L4JA 2CKBB 3CVIH 4Z8FL 2R15A 3IDNB 1MWAL 3KNBA 4I4WB 4OV5A 1A6UL 4PV9B 1T5WB 4CA4A 2YS4A 3IPFA 3EAKA 5K9QI 3U30B 3ARFA 1PSKH 3RGBA 2DQTH 5B5FA 1KCVH 4RGMB 2Q3XA 4PRNB 1B4TA 4O3WA 3BZ5A 3O6ML 2F8IA 4PWGA 5F89B 3CFQA 3GXTA 1SQ2N 1OP3H 3WN5C 1I8LA 3MBXL 5I1AA 1WWAX 4JREB 4NC0B 3MBED 4U3CA 4NDMA 3KJ6H 3SY0B 4CBPA 4FQXB 2ADGA 2QADD 1L0PA 3VJ6B 4RRPA 4BA0A 1ND0B 4ZMWA 4K9EC 1EUOA 2EADA 1GW0A 3RPKA 4MJIB 1TVBA 2B4CL 1OP5K 4LVHC 4XCEB 4HJGB 4G72B 1JDDA 1KCBA 3MLSH 4LZVA 4X6CE 5DJ0B 5TQ0H 1PG7X 3RX5A 1E43A 1L3WA 3NCFB 3TESA 4JGMA 3TPKA 3CBCA 2BZ7A 2FR2A 2OFQA 1KJ3L 3DA0A 2R0LL 4PJBB 4IBWA 1XD0A 2YA0A 2YA1A 2GI0A 2WZ5A 2Y72A 3EDFA 4FJZA 3W82A 5IJVB 5ANME 4FQBB 5KS9B 1MNNA 4KZEL 5CBEA 5TGBA 4M7JH 2NDGA 5DFAA 4MA3A 1JWSA 1ZSDB 3MRHA 4XVTH 1I9IL 4R4FL 1EAPB 1QSZA 5B7FA 1MXGA 4I13B 1SLDB 3PECA 4ZTPL 1L0QA 4N2LA 4WV1C 3SKJH 4EZKA 5BRPA 1OAZL 3QISA 3CSPA 4JRLA 3QDGB 4N8VA 5CJOH 1P0SE 5KANG 5J4MA 4GW4A 2HFTA 4NWTH 1NDGA 4JO5A 2Z7UA 5FIEA 4RMVA 3V0GA 2H6PB 3SZIA 3IFNL 5AJCA 1AXTL 5CGYD 1BQ5A 2PTVA 4N0CC 1RJYB 4JKPH 3GWJA 3TO4D 1HOEA 5T1KD 2BPBA 3ZT7A 3MV7A 3KS0J 3TBVB 1XF5B 3N06B 2Y5TA 4CSPA 1WAPA 1SY6H 1HINL 5BS0B 3MRMA 2NY3D 1QSFD 4O02H 4ODVH 4WKZA 3ZT6A 1A3LH 4C8XA 2XQYG 1OWRM 2EZ0C 5EIIB 4NX0A 2DIAA 4Z7NF 5B1KA 2R23A 2GEEA 3H9ZA 3WUWA 1FL6B 4MISA 4U7MA 1E6JH 1PQZB 3ZMNA 1UD2A 1HXMA 3KGTA 5KSVB 5AAWC 3PHOB 2CJTA 1NMAH 3ML8A 1G94A 5KG9B 5JXEA 2IBZX 3RVTC 2ED7A 5ACZA 4OAWB 4JFZH 1SHSA 2AQ3A 2VISA 1DLHA 4PCTA 1PZCA 1BZ8A 4FP8H 5G4MA 3WEXB 3OR6A 1NMBL 1FV1A 4J3BA 4OM0L 5AKVA 1I3VA 5AW8B 2HX9A 3NIFE 2IZCB 4ZAKA 1LILA 3G5XA 2VTFA 1TZIA 4JANB 5T8IA 2E7DA 1GKAA 3QIBB 2QLYA 1H8OA 4ZJ9A 1S3KL 5TFSH 2EEAA 2BVYA 4IS6B 3DOIA 4I0CC 1IFGA 4ZFZA 1ZY9A 5DURB 2V5SA 3LD8B 3P0YL 3U25A 5BZZA 1YNTF 5FEBA 2BLGA 3UO1H 3BGMB 5CCKL 2OR9L 4DHLA 1S5HB 1QYGH 1ZXKA 1K2DA 5DVNA 5DMJB 3KH4A 4M1GH 4HCIA 2IDQA 4YHML 4MCZA 1IO4C 1IUZA 2HSIA 3FQTB 3B83A 4OLZH 2I5YH 5C08B 5LVEA 4OLXH 4RSYA 1ZGLA 5KAQG 1SWEA 3OBAA 3DURB 4KAQL 2AQPA 2ZIDA 4P3CH 4KTDL 5TJWK 4EUPB 3NCEB 3VRJA 4OBRA 3V6ZA 3WNNA 3ECBB 2VXSL 3U30C 2LV4A 3LB6C 2J20A 3ZKSD 2F19L 1DVQA 4A7GA 4YHLL 1GR7A 3RIKA 3TYGH 4M29A 1RSTB 3F8UB 4PW9A 1M2OA 3N2JA 4BFFA 2G78A 4KV5F 5JHDD 1SXBA 2W0FB 1A7PH 3BVDB 4Z3HA 3LQZB 3GJFA 4HF5H 1I75A 4Y4KB 3IMTA 2VDML 4WNJA 3UOAB 3SKMB 2YBGA 1X5ZA 2VM3A 2Z8WC 3ABZA 4KDVA 5LXGH 2IH1A 4MCNA 4DP8X 4O00A 2RR3A 4L37B 4L29A 2HTLC 4HXBH 1BJ7A 3K71A 3PWPB 3MV7E 4UM8A 3D52A 1KULA 1MH5A 2CK0L 4GMTH 1SFDA 4NSKB 2AZAA 4PRBB 5I1HH 2F09A 3W5MA 3N04A 2J6EL 1M9SA 2J71A 3S36L 3ABMB 3D48R 1Z9PA 4M5SA 5CZRA 3T6QC 2AEQL 5D9SA 3EHBD 1NUFA 4JRYA 2DBLL 1EDQA 2WNKA 5ENWA 4RUUA 4JO1H 5DJ8A 3N6YA 2PETA 2CM9A 1W8NA 3K72A 1C1EH 4JHUA 2R7EB 2PYFB 1E28A 1MVUB 3ARQA 1ODAA 1ED3B 1FZOB 3F9DA 4EUPA 4ZAKB 2BVOA 2GTZB 4IHOB 4CU7A 1KPUA 3QWQB 3CMGA 2FHLA 3WOVA 2EE9A 2ZUWA 3BGFC 4MQTB 4XNYL 2VISB 5CIPB 5D93C 4DCQB 5C6TL 5A2KH 3WJJA 2I85A 3FTYA 1VWRB 3LNHA 3LZQA 3FOMA 4KWUA 5B1JC 1H5BA 3A21A 3N3EA 4QZTA 3G5ZA 2CK2A 1A3QA 1OW0A 5J9PA 2DF3A 1KXVA 2FYVA 3LRKA 4XX1G 3SJVA 1CBQA 3P3SA 3PP3H 4FQJL 1ZE3H 4RGOL 1DEEB 4IRSA 1DQQA 1O6SA 1ZWIB 4V33A 4ZFZB 1DVTA 1DN2A 2WTOA 1G7IA 4MJ6B 4BE6A 1HQ4A 3JWDL 4DKFL 3KVQA 2J21A 4MASA 3FH7A 3QJQB 1PZ3A 3CX5J 4LESA 5EEDA 4XI5D 3TBVA 5J6GA 1RI8A 4AYHA 2VQ1A 1KGUA 2Z93A 3F5WB 2DM4A 2Q2MA 2G4EA 5CUSL 4HZLB 1FH5H 5I8OL 1PX3A 3BMVA 3NJIA 1DZJA 1T4KB 2NY4C 3PH5A 1KLUA 1ZHNB 4N86A 1KLFA 3P0GB 1VADB 3KLHC 2UY7A 3UCQA 1NKOA 2RTJA 2ZKYA 1EHKB 1PQZA 4XNDA 5E00B 3VXSA 4KCAA 4E9YA 4ELMB 3RBYA 5IQ7L 4MBOA 4NQXB 4M7LT 1IE4A 3P2DA 3VD7A 5HGAA 2X6VA 1NCBH 4M6MH 3VMOA 5EIIA 1L0YA 2C3WA 5AYQA 3T65B 5FHAH 1ZNLA 3MBTA 3SYCA 3CBJB 3AXHA 1CR9H 3APFA 4IMKA 4NJ9H 4BWTA 2Q1EA 1PMPA 4LFHD 5JZ7C 2FLMA 3OMZA 5FENA 1YC8A 2ZP8A 3TJPA 5C0BD 4P4KC 2FJHA 5ALBL 4GG8B 4KK8C 3QDJA 3MRKA 4XMUA 2F08A 3AU1A 1ACXA 2NY1B 3RSWA 3RDXA 2Z6FA 5KUKA 1OD9A 4JJ5A 4MS8C 3QDGA 2WYTA 4TRPL 2XWTB 4BHUI 5CZVL 4QRAA 1WFUA 2FL5B 2IAMB 1YPZE 3RTQD 4FNLL 5FF6B 4D0BA 3ZO0A 3MRHB 4FI6A 3T71A 3TL5A 4G8FB 4ZNEA 1NA8A 5F3BB 1RU9H 4Y88A 3T2LA 1E5ZA 4E5XB 1I1YB 2G0KA 4LLMB 3IXAB 4GJVA 1MFAL 5E6ID 2YFNA 1DYZA 3O6FD 1RXHA 4PJBA 4PRNA 4LSTH 3LSOB 3C08L 3VNZA 1XL4A 3BP5A 5EU6D 4PV9A 1ZPUA 4A7QA 5F96H 1LP9A 2IALA 4ISVA 5IMOB 1N68A 1VDGA 2WUBL 3AT9A 4MNGB 5CF3A 1IKNC 4W6XB 3DRTA 3RVXD 2J25A 2VW7A 1ZV2A 2DW5A 3JVFC 4UTBL 4AQ1B 2EXSA 1ND0A 3DHJA 2Z65C 4OCWH 1U4EA 2BIQA 4P05A 2PO6C 4WK2B 5B3JF 2NY1C 1HEZA 4NDMB 4MD4A 3SY0A 3RDMA 1GJIA 1VWDB 1OPOA 4I1RA 2QSQA 5FECB 3IK2A 4F33A 2EIEA 1Z32X 2D7NA 1PZSA 3EBKA 1FORH 4XBEH 5F89A 4MJ4A 3WJMB 2WKOA 3O2VL 4NNPH 4O02L 4JG1H 4ODVL 1M6UA 2X9XA 3EO9H 3WLBA 3CSFA 5I1DB 3IBEA 4IBSA 2FGSA 1S7WA 4TS6A 3NA4A 1XAUA 5GSRB 1QUNA 2H3NA 5EBLA 2BVQA 3K2IA 1Z1WA 4XBPA 4TNNA 2HKFH 2JMBA 3PGFH 4IHBA 3MLZH 8FABB 3P11L 3FYFA 2PTTB 3O6MH 4N3TA 3D69B 4PRIB 4TUOB 3MRPB 1XCTA 4TV3A 3V2AR 3QI9C 2Z9TA 5LB1A 1ZTXL 1K72A 1IAOB 4FP8L 4MHHI 5HTSA 4IU3A 1J9TA 1SHXA 2X3AA 1TTAA 3K91A 1X9RA 2CBRA 1OSZA 3OKEA 1CYGA 1ASQA 5BRZB 1XGUB 1KTDB 4NOFA 2AABH 4K5LA 3KGUA 2PXYA 5HYQB 2BNRE 5AB0A 4JFSA 4XCYB 1Y52X 3B2HA 1Z3RA 2G3NA 3FEKA 4X5XA 1Y1DA 1BIIA 3D2UD 4UTBA 3B2UD 4A1HA 4WFEE 2EKSB 5IHUH 3BKYL 3FTZA 4GXVL 4A1YA 1QPKA 3GSUA 1CBRA 1Y1UA 2ZPKH 3M8OL 1J8HD 1PLGH 4PV1C 1V27A 4A6YH 5IW6B 1CFSB 1BGXL 1H0DA 4HMDA 1JNLL 1SXSA 4M7LH 3ZO9A 2CLVA 1T7YA 4R7DA 3JV6B 2GYSA 4BFKA 2WTRA 4HSAC 4XNUL 1TYRA 3GLZA 5F7YC 3V0VB 1MHPL 3IDXH 1CL7H 2GJJA 3WS6C 4NWTL 1ET5A 5IT2L 1IW2A 5EUKB 3FUJA 3PL6B 3TYGL 1PNDA 5IFAL 1P4LB 3BD4A 4PJIA 4RMQA 3PE9A 3DTUB 2FT9A 3PWLA 5DJ6B 3S35X 1CPUA 5EZPA 2P43B 2HJKB 2IV8A 4H7VA 4PJ5B 2VAAA 5D6DA 1MCIA 2Q76A 4Q9RH 2BHFA 2P7TB 4H1LG 4W4OA 3B34A 3BRFA 1RUQL 1MHHA 3IKKA 5DJCA 3AB0C 5DC4B 3VO0A 1KBPA 2F53B 1E9OA 1TYJA 4P5KB 5C7XL 7FABL 3AW5A 4AM0B 4OZGB 3OKOB 4ILDA 2F01A 3UMTA 1SM3H 4RWHA 2O4EA 2NLJB 5EF1A 5J12B 4XMZA 2L8AA 1BQLL 2Q6WB 1DBKL 1AR1B 2NY2C 1UXWB 1JGLL 3P9MA 3X14B 2N7BA 1E7UA 4KVPA 1SY0A 2DYSB 5HWZA 4X80H 4ADJA 2WXOA 2YQ2A 1QZ1A 3KBHE 3MRIB 1SREA 4MFHA 2D3LA 4PCSA 1X5IA 2X7LA 1TTFA 4WI7A 3SOBH 1AVDA 4ZHDA 3PNRB 4JO1L 5DZAA 1DFVA 4J12A 2K4WA 2WXLA 1ZVYA 1FO0A 1IBZA 4WW2F 1JK8A 2APWA 2B5IB 1CDUA 3ARPA 3FUNA 2GSGB 4YC2B 5KVDL 4ZUSA 4DUWA 1SOXA 5I0WA 1KT4A 1D6EA 3BPOC 1FN4A 2DL2A 2QPFA 3CZUB 3WO3B 4ARHA 3E0GA 4XAWL 4PG2C 3HZYA 1MJUL 1Q1JH 1ZEAL 4EI5C 1TTGA 3KPLB 4O51B 3OTTA 4M1GL 1JMXA 2YUXA 1GMEA 4K3JH 5KVGE 4AMWA 2YJQA 2BY1A 3RTQC 5KJ4A 3L5XL 4OLXL 2V9RA 4PJDB 1BM3L 1FL3A 3EBWA 4Y5XB 5L4IA 4B5EA 3IMVA 2NY2D 1WHPA 4N90D 4GDAA 4EN2A 3BIAX 2DWYA 1N2RA 4LU5L 1MRCH 4WO4A 2DS4A 5DHYA 1T21A 5MI0B 1U30A 4UOW1 5TDPB 4JB9H 1QSEE 1IEAB 1FBIH 4YDLC 1GC1H 2Y7SA 4FQLL 2K6ZA 3L5WA 2CDFB 1A02N 1U8NB 3KBEA 3OKLB 3MLRH 4WK0B 3RBGA 2CZNA 5T5FH 4QNPE 2OA9A 3KYOA 2PCPA 3X1FA 3CU7A 1JYVA 1FH5L 3O4LD 1HX0A 2FHFA 4XHJC 4KTYA 4NQQA 5DGRA 5HP5A 1P5UA 1M4KA 1S5IL 2PPCA 2X05A 3DV6A 3K7UA 3UO8B 1WZMA 2R56A 1KB5A 4GG6A 3MUY1 1UYOX 3OJDA 1BRQA 4QY8B 1Z0NA 4H4NA 4PJCF 4NENB 1JJUA 1GGCH 3ARBA 4K3DH 2PYED 4FXKC 4BQ9A 5F1EA 1PLCA 3DSFL 3EGXA 4JFDD 1P5UC 5CD5D 1XGTB 5C0GB 4F15C 2VOTA 4OGXL 4JFTA 5EBLB 3S9DB 1RSFA 3FQ1A 5LNDA 1HSBB 3F01A 2G2RB 3SBWA 2KZ1B 4CKVX 5DHDA 5C0JB 3ARDA 2JU8A 3TU6A 1P4IL 5CLZA 4MXQC 3OBLA 5JQHC 1ZTMA 5ICZB 5EBWA 5BO0D 5HYSG 3ZJAA 5DXWA 1BFVH 1IGCH 2N3JA 3GMRA 4ZX4A 3E7JA 4X7TA 3V0EA 4GI9A 2FQEA 4F33B 4PD4J 4F37K 4EZMA 5J13B 1KMGA 1VGEH 5D45A 2DQJL 2OXGB 3AS1A 3IGAA 4XAKE 2RAMA 1B2YA 3HLAB 4Z7QF 5B3NA 1P1ZA 3EYVB 1V8HA 4L4JA 2C9UA 4QD2E 4RVBA 3D69A 4PRIA 3UL4A 3GUTA 5FAZA 1U8CB 3EGDB 4TTDC 3N9GL 3SDYL 1UOVA 3GMLB 4XBPB 4TSAH 2E86A 2ZUQC 1T7ZA 3CC5A 1LELA 4WHCA 5I6MA 2HB0A 2UZIH 3ROLB 4CSSA 4X5WB 2W9DH 4XP4H 3S8WA 3EYSL 3CSBA 3JQOB 1PD0A 4GAAA 4B9FA 4KJWC 5HJGA 2E76C 4WWID 3S5LG 3CD4A 3KMDA 3MFFB 5IM7B 1Y53X 1OSEA 4DZBB 4JGUA 5HHOE 2YQ3A 4LCWD 4PSRA 3CN2A 3ULVF 3NK3A 5GGSA 1DN0A 3CV5A 3HNTH 4K23H 1OCWH 4XN9A 5FDYA 3PREA 2HN7B 2O6FA 1AD9A 3OAUH 3UTQA 3VXRA 5BV7H 3ARGD 3BSZE 1E6OH 1Y07A 3ETSA 3WY1A 3A0OA 3IN0A 4P5TD 5IRUA 3HOGA 2XKNB 4GLRI 4MNGA 3AU1B 3FRUB 3BH8A 1BAWA 4ISVB 3IN2A 4PRAA 3BEWA 5K69A 2CRIA 4AJWA 2A3TA 4P2AA 3U2JA 3EO9L 3KWVA 3WL9B 1KFGA 2XDHA 3OGCB 3QRLA 2JKXA 4PWEA 4RGMC 3S88L 5H94A 2EDTA 1S9XB 1FVDA 1CFVL 3JTSA 4NRXA 2V6HA 4PG9A 2IZBA 2IH9A 3T65A 5F3BA 1T1WB 4ZMQA 5B8CC 4KDWA 3QNFA 4E41A 5FA3A 1JBJA 4JRYD 1P7QA 2JJTC 1YEJH 4V1DB 5E8NB 3MOBL 5LJHA 1G9HA 4AX3A 5E00A 1MIEH 2KPNA 4NRZA 4HSCX 4TPRH 3VGWA 1RK0A 1CCZA 5F3HB 2EIZB 4HCRH 1MLCB 1N67A 3NESA 3VWJC 1CG9A 4YHKH 4FBRA 2OL8O 5ALBH 5L2KE 1TQCB 3VXTB 1HHJA 3GMQA 3LHPH 4PTTA 2F0CA 2OJZH 4OSUH 1D5ZB 1DVSA 1JZJA 4ERSH 1LE9A 5CILL 2Z93B 3QKGA 4NFDA 3ABLB 1YYLL 5DF0A 3MR9A 4K19A 1PEEA 1HSAB 4QCIA 1TIUA 3I50H 2FECL 3HBQA 5CCHE 4G82A 1UA7A 2BY2A 3CVBA 2Z4TA 3RWCB 5AOLA 5AL8A 4BXSV 4MJ6A 4KRPB 4Q4EA 5GS2H 2Y3FA 3FDWA 1T03L 2A5BA 3QUYB 4P4KD 3TURA 1LO5A 1J5CA 4IRSD 1RZFH 1E9QA 4KY1L 5H2BA 2V5TA 1P1VA 3VFWA 3DSNA 2VH5L 3C08H 4MVLA 3Q6GL 3Q2WA 1IQDA 2OZ4H 4YXLL 1CO1A 2G5RA 1JNLH 4Y16C 1TZGL 5FUZH 3HN3A 3G5ZB 3CHQA 5JIIA 4NZUH 1DFBH 1U0QA 1EX0A 1H3WM 1LDSA 5ABAA 3AITA 3QZWB 1RUKL 4WEBH 3F5WA 3WIFB 4ZGFA 2WVVA 5D7EA 4FQHA 2UY6A 1EBPA 4P9ML 4X6CA 1ACDA 1BZQK 1L9SA 2V17L 4IM8A 1VKXA 3WTSA 2VDPL 1RQ5A 1N3NB 3VRLE 2N0MA 4MCYB 4J4PC 3INUL 1XGPA 4MB5A 3P2BA 2P45B 3FULA 4JRYB 1GHFL 2J1KA 2XCMC 4D8OA 4J8QA 1WJ3A 3DJSA 3JWOL 5JOEA 3QHTC 3HI1A 1QSFB 1SXWA 1VFBB 1H5BB 1CI3M 1WZAA 1TJHH 4K71B 5IQ9A 4R9HA 4D6BA 3JTTB 1NIAA 3OHXC 4OUUB 2F7RA 4LBAA 4MMXC 3DO7A 2BP8B 1LMIA 2I27N 2CR6A 1JGLH 2A9NH 4MNQB 4IHOA 4IMLB 3WHXB 1DQDH 1IM3D 3L7FB 1C8PA 1E28B 1MVUA 1PW3A 2BWDA 3EO0A 3D4YA 5CSZA 2C1OB 2NUPA 5F1IA 3D08A 2W2BA 5HHNB 5HHQA 1AMXA 1R3JB 1UD3A 2VERN 4BZ2H 3U1SL 5IMLA 1DSYA 4YZWA 3NA9H 3VI4E 4JFVA 4EF3A 5GS0L 4TNVF 4AV4A 4U1KA 4NSKA 4BGDA 3L3JA 2LGNA 4XN5A 1JFHA 1F1DA 3IRCA 3WHXA 3BZEA 2WXHA 1F90H 3MJGX 1NAMB 4JPKL 1R1CA 3CKFA 1JZ7A 2EDFA 1IC4H 1VWIB 2R1YB 4EOWL 1DBML 3FRPG 1Q9WA 2ZE0A 3OR7A 4QHPA 4WHYG 1UKTA 3L5XH 3WXWL 2WNXA 5AAPA 1H19A 2NYKA 5FO7B 4MCZB 4IOSA 1FZMB 3FUIA 2C1PB 2UYLA 1IC7L 4LLVB 4RMSA 4DGUA 2NP1A 5JW4N 4Z7WE 5DMKB 5IQMA 4JM2F 1U8MA 4BX5A 1XR8B 5I9QB 1SXAA 5DC0A 3X1GA 3RVTD 5ITFA 4KI5E 3VG2A 2CJ3A 1OCOB 3GEWB 2GK0B 4QTIH 4PWJA 1NBYB 3ULVD 1REIA 4MD0B 1LD9A 1TVDA 3V4VB 1KZXA 4RFNB 2XQBL 4N24A 4JFQB 2MHDA 2ZTBA 1UD5A 2HLFD 4IMLA 5B38B 3GMNB 4PCYA 4Q9RL 4BX7A 1UJTA 3O8XA 4H44C 4OLUH 1YQVH 3RVUD 1UM4H 2VM4A 3ARFD 3QUKA 2IPTH 1KDIA 4XVSH 2BDNH 3QZWA 4I9WE 5LBSH 1SOKA 3VI4F 4C58B 4NUPA 1NGWB 2AKRB 4HEMA 4XI5C 5E4IA 5L4MA 1ICMA 2Y69B 4XXDA 2DQDH 2OQJA 3AWFA 1FFTB 3WNIA 3GHEH 4JLRB 4JM0A 3WUWB 3OJYC 2BHZA 1DBKH 2GJRA 1VESA 2HFGH 1LO5B 2DKMA 1XIWC 2W95A 2COVD 4G8IB 1EIBA 4NQEA 3BT2L 2OI9C 4KO9A 2D7MA 3TV3H 3SOBL 2VXVH 5E8OA 1AZRA 3P3RA 1JV2B 2XN9E 3FK3A 1AKPA 4GIAA 4ZPVB 1C5CL 2CSPA 1FV1B 4AQOA 5JPNB 2EDMA 4YDIH 5AW3B 1JGDB 2UX7A 3FAWA 5DDHA 2WSKA 3VGAC 5AB2A 2R8SL 2X3BA 1XB6A 4FFZH 5KG9A 5HJBA 1F0LA 4GQ9H 4DOHB 4AV5A 1MN4A 1C08B 2W5PA 3BT0A 1H6FA 1IBFA 3E3QE 1RK0B 4HBCH 5F3HA 1IKFL 2D0GA 2W60B 2WLJA 1C5BL 3NZ8B 1Z6JT 1I8AA 3WI9A 3O19A 1QLRA 1DQIA 3I74A 3MA9L 4XX5A 1B0GB 4INNA 3QUYA 2ESVB 4UTCA 5FA3B 3QWOB 1IQWH 2J4WH 4HPAA 1JYXA 3ECQA 5KS9A 4XXCA 4XVUC 4HEPA 4WUUD 1N0XL 4H8UA 3P02A 3W39B 4Y9CA 2Z31D 4PRDB 3FFCD 4LU5H 2JI2A 2XZAL 2ZOUA 4ZW6A 4WZ9A 3ASWA 1P2CB 5KOMC 4LVOB 4YDMA 2B16A 2HT3D 3T2PA 1GC1L 2Y1ZA 3BUDA 3RZCC 4J3OD 1VWCB 2J1WA 4NIYE 1J10A 3RILA 5E1GA 3UP6A 3WCYA 1AACA 2F7QA 3BLGA 5L8IA 2GCYB 1CG9B 3WFBH 1MLCA 4X5RA 3HNSH 3WNKA 2X4NA 2XZQL 3O3EB 2XWDA 4ONHA 1NIBA 2CLRA 2VC2L 4FFYH 4EZJA 4MRBA 4MBRA 2D3VA 4GNWA 4PHZA 4X6BA 1N59A 4LSVL 3RPBA 3NEOA 3HIZA 1FSKB 1S7SA 5B2AO 3NSJA 1QNZL 4KT5A 1L6MA 1MREH 3CAFA 2ACOA 2YUVA 1M71B 1E4JA 3HMXH 3QPXH 1V10A 3PDDA 4L3EA 3FUMA 1P69B 2YKLL 1KNOA 1VIWA 3BEWB 3IDNA 4I4WA 3V4VH 4XCEA 3ZRFC 1MIEL 1KL4A 1QAWA 2DMKA 4J6IA 4P4RA 4TPRL 4AYMC 3LZRA 1NDJA 1CXHA 1JN6B 3DTDA 3BKJH 3VJ6A 1BFVL 1IGCL 3L2LA 2CKBH 3VMPA 4CPIA 4QRQB 3OPUA 3ILQC 3HG1E 5CILH 3VI3A 4CC4A 5KBNC 1VFUA 3B2XA 1SWGA 1I8UA 4PUBH 4I7ZC 4F7TB 4ZMNA 1S8DB 4HXAL 3WVMA 1IGMH 3H3PL 3L4ZA 4JM4L 4ODHL 4OJYA 2MEJB 3F6ZB 3GXIA 3RWFA 2G75B 3UAJD 4RSVA 3S37L 3ZDXB 5L8NA 2VJ0A 5DT1H 1NC4D 3FSAA 1T03H 2YGOA 2A9MH 3X13B 3H54A 5B3MO 2VH5H 2V5RA 5HGHA 4AH2B 1XIWB 2YD9A 3ZUNC 3F7PC 1KTKE 1AHKA 4ZH6A 2P5WB 1OHZA 5CYBA 2KERA 3MU3A 4GXFA 4RDBA 5D1ZC 3UPCA 4L8DB 3ZE2F 4NIKB 1X4XA 2F1AA 2Y22A 4S0HA 2EYTA 3CZEA 2BH0A 1ZNEA 4GG6B 4UU9B 1KXTB 3O2YA 2WSPA 2QVKA 3O22A 2ENQA 5EZJB 5DA0B 1V5JA 2OXHA 1CBVL 3CFCH 5EBWB 1XR9B 3UPAA 2VDPH 1F4WL 4UOQA 3QRBA 4XGZA 2ZUUA 2G2NA 2VFBA 2R27A 1CYXA 4M6NL 3FB5A 5AUMB 5IEKB 4LCUA 5G4NA 4MNGE 2JKLA 4J4PA 5IJKC 1RPUA 1LIDA 1AQKH 3F62A 5T3ZL 1EGJH 4PQXA 4AIZA 1FQ9C 3QBTB 3T3ME 5K67A 4FFWC 1FNEA 3G6AB 5C0ND 1IKOP 4DK6A 4P23A 4ZUWA 2WLYA 3H3KA 4BHUA 3KVNA 2IJ0C 4XNAA 5D4IA 4FG4A 1HQRA 1I78A 1TF4A 3E6FA 2OFMX 1CLZH 2IFBA 4HCFA 3H7BB 3IFOB 3KQ0A 5EDBA 4UOW0 3VFVB 4GUCA 4X98A 1I9JH 3FOLB 5IHLB 3L4TA 4BKLA 3P3TA 1KTLB 3DNKA 4WJKB 5FW6A 3B9EA 5FLVA 4L1TA 2WIIB 3OPZH 4YHKL 1W8OA 4W9IC 4L1NA 1E06A 1BJ1H 3E3QC 1ETJA 1R24A 3DX0A 2DWTA 4KJWD 3L5WB 2GSGA 1NCAL 2ZUTA 3OXSB 1H15A 3TBYA 4YFEA 3NABH 2OW7A 1JNHB 4OZIB 4L3EE 1KWGA 2FBRA 3FFDB 3SE9L 3AREB 4PJAE 4F24A 5AW5B 4G5ZL 3BD3A 1KGJA 4PJXE 3L9EA 2EH8L 3OF6A 1UD4A 2V3EA 1ET8A 1X5HA 4OCXL 5F7KC 2OSWA 1RL1A 3HHMA 2WO4A 3U4EB 4G43A 4KY1H 4LSQL 1UADC 4IBUA 2AJYH 5EUOA 4L1HA 1C8QA 1KB9K 1OAQH 1XCAA 2HZRA 5EULV 4PJCB 4G43B 1N10A 4DJMA 1LHZA 3CSYB 4R84A 3VPJE 5HTEA 2OMZB 2YD3A 1IGFL 4FADA 2EDWA 4HUVA 3ARGA 2YAPA 3AY2A 4OZFH 2Q76B 3NP4A 4QEGA 2VAAB 2NT0A 3QUZC 2ADYA 2JTYA 4XO3A 2EEBA 3SQOL 4H5SB 1P4LA 4PJIB 2YEQA 3FMGH 4ZX3A 5FK9A 3AADB 4G9FE 3OZKA 3TONA 2LLGA 1BQHB 3I6GB 2K8QA 5DJXB 2EH7H 3IWUA 2WTRB 5B5GA 2FRGP 4A68A 1TETL 3BE1L 1FVEB 2GH7A 3TEXA 4ODWB 3AMLA 5CU5A 1N5AB 4P5KA 4PJHF 3UBHA 4UILH 2FATL 4JFFA 2A6JB 5IW6A 3PWJA 3BIKB 4RDQF 4P23B 1EZVX 3QFJE 3QXAB 1EO5A 2VLRA 1FNEB 3IRZA 1YNLL 5EN2B 2HFGL 3T2QA 2XUWA 2Y25A 2VDPB 1NCCL 3BT2H 4QRPA 1IBGL 2NTSP 3QCTL 1TQBC 3DVIA 4I48A 1OD7A 5DRWA 5TH2B 3TV3L 4MJIE 1X71A 5E4EC 3BKCH 2RQ0A 3V5KB 1MI5D 2J72A 4LOUC 1YMME 3VA6A 5DCCA 5CJQL 1II4E 1Z7JA 2DKSA 2F8OA 2GFBA 4U1JA 4FNPA 3EFFA 3ZKMD 3QIBC 4A2HA 3VM5A 1UFUA 1XF4B 3VXUE 2IBGA 5ISZD 3DTXB 2B8OT 1F11A 2ZUQB 4KKRA 2J43A 4HPBA 1JWMA 4QXUH 3F7QA 4UTAL 1EPAA 1C5BH 4EQ3A 1UREA 4DEPC 5DRXB 1IIUA 3WFHB 4PJ7B 2VDKB 1MLBB 4Y19B 1PZDA 2PTTA 4FYTA 2XA3A 4HUCA 4N2BA 4XH2B 2OTUB 4HMEA 5IZ7A 3U46B 1HS6A 4E9QA 3LN4A 1JPTL 2VM9A 2LB6A 2AEPH 1NPUA 3X13A 3M07A 4NM4L 5JIDA 5SX5H 3BH4A 1RSUB 2ZSVB 4NLJA 4LSRH 1XSOA 4C47A 4F9PA 2WVSA 1BLNB 5GRUH 5IMKA 4FOMA 3RB7A 3WLBB 3DVNA 1DHKA 4M1DL 2JKIS 5HD8D 4Z0XB 1J8HE 4W4NA 3U03A 3QJOA 4XXWA 2KC0A 2WY3B 2AT6X 4X7SH 2IZHB 3VFTB 4RH4A 4Y5YC 5DURD 3F2LA 4O4UA 4RWYH 4PY8I 5DFWH 1F3DJ 3LKRB 1BJ8A 2MPAH 1WQVT 1PLAA 2BXZA 4NAJA 3TA3A 5DYOB 3MJWA 5ABDE 3QNXB 2X0WA 1CXEA 3BPLC 4LPCA 4DN3L 2H3NB 4OW6A 5J5EA 1UD8A 1QNZH 3T1DA 2DQDL 4FTDA 2NZ9D 3RVWC 4AQ1C 4LLMA 7TAAA 3RUGB 4L9LC 5ISZB 3W0WB 4R7XA 2G5UA 5SWQA 2OW6A 4DP5X 2P8LB 1T83C 4X9GA 4ENEC 3AUWB 1Q8MA 1VYGA 3EYQD 2EEDA 3QUZB 5D6DC 1E4WL 3MV8D 1JRHL 3ZW3A 3G7TA 4ZS6C 5I18H 4PRHA 1INQB 2NNAB 2ITEA 4WNSA 5GJSL 2GCYA 1HU8A 3C60D 1YEEL 2N59A 4M5YH 4PJDF 1ORQB 1NC2D 2O5XL 3MKKA 2Z31C 4GQ9L 3N42B 4NZTL 4QHNB 4OCMC 3BP5B 3BWZA 4Z7QE 5I6XB 2YK1L 1DDTA 1P2CA 3GJFH 1YZZA 5FKPB 1BD2A 3BU9A 5CMAA 4F57L 3NFNA 1E5BA 5DQDH 3DUHA 3KPPA 4M6AA 4XN1A 3Q06A 5D71L 4NP9A 4OCLC 3HKFA 4G8FA 1D5XB 1NAKL 4HKXA 3BWAB 4OR1A 2ID5A 3J07A 4QT5A 3S3DB 2WLMA 4JX0A 2XWTA 2YC1B 3E8UH 4JJ5B 5E1AA 1ZLWK 3EJYC 3ULVE 1D7DA 2NY2B 1S7UB 1A9BB 2FR3A 4CDFA 1FFQA 1R19A 4HZLA 1BQSA 1JGUL 2OKMA 3DIDA 2YEVB 2VFCA 5GGUA 4FQIL 2X32A 2XZQH 3PRZA 3U4BH 1YWAA 1G1OA 4JY6A 2XRAL 4O9SA 4GG6F 2POAA 2C4FT 4FFYL 1QOKA 4CSZA 1MDAA 3D9AL 1EEUA 1O6SB 1ZWIA 5JW3H 2IWFA 3EC5A 2UZXA 3FO1A 4DO6A 2R0ZH 1YY8A 1XH1A 4KDTC 5J9PB 1W72H 1VADA 2JKTM 4QRSB 3H55A 4M61A 3U4AA 4HUMB 1ZJBA 1NEUA 1JPEA 2AKRA 1OEZW 4HFOA 1OEJA 3D85A 4TQ8A 4Z7UE 1R75A 1Z9SA 3EFOB 1HHGA 1OVZA 4QHUA 1JXJA 4KJYA 1U8IB 3OXRA 1ZV9A 5B1CA 4MA7H 5I9QC 2GTZA 1ZLDA 4JDEA 3RIAF 4ZR2A 4O2EB 1ED3A 1SWQA 3TZVA 3EADA 4E9LA 4Z7VA 2JU7A 5FHBH 2V2XA 2QTVA 4FKKA 2BW4A 3MLUL 1QABE 3MLXL 5ENWB 4KKQA 4POYA 1HOCA 2JWYA 2YPLB 3MACL 4NRYA 5DMKA 4OTXH 4LLQB 2X4TA 1M56B 2HA1A 4JO8A 5J1TC 5DT1L 5IRAA 4EXKA 4DETA 3QJZA 1OT1A 3GJEB 4U1IB 3WTTA 1NGPH 1TQUA 5AOZA 4RETB 2DICA 1ZKAA 4OH2A 5AL0A 4X9YA 1C7TA 5C8JB 4LSDA 2HJFA 3K2MC 3CG8A 3ZKND 5I0YA 3HBZA 4ZOAA 1AG6A 5ALCH 1DJWA 3CPLB 4PJ8C 5LAXB 5DQJA 1I85C 2WWMD 3WKMH 2OZNA 5ADPH 4L8SA 2AVFA 3V0DA 1QASA 1ZA6A 3A6CH 3TT3L 4F3FA 4P46B 1AKJD 1CXFA 2W2FA 3QI9B 4HPOH 5LNEA 1HH6A 4G42B 2YKKA 4GRWF 1E27B 1R3IL 3CFCL 3PABB 4TSCL 5DJ8B 5INDA 4YMYA 3IE9A 4OD3L 3H56A 3G6JF 3U48A 1FIEA 5AW9B 3PH6A 4JE4B 4ODSL 1IVTA 2NXYD 4L8SC 2DPKA 1QD0A 1LDQA 3FMGL 4U1GB 4HJJL 2B59A 3VRLF 2ZXEB 3HMWH 1RAMA 3EH2A 2PYEA 4N3UA 2MMXA 3VFOB 2P5EB 4LARL 5T3ZH 2EE3A 1VFAB 2D7TL 2IFGA 2XTLA 4KMTL 4QRRA 1EERB 3BE1H 1VRSA 4MNQA 3QORA 4HQQH 1GOFA 5TTRA 4HVBA 4ZMOA 3ES6B 4LMQI 4NKQB 5FLUA 3ETBF 1D9KB 3MPCA 4RFOL 3ZI8A 5GSVB 3POCA 4UB0L 3UYRL 5IB1B 2CDGB 2RTEB 3OZ9H 2UZPA 1B3JA 3BGMA 5CJ8A 1LDOA 1KT6A 3FB6A 5CCJA 3C6SB 2XWCA 1PIGA 3CVIL 4Z8FH 1SMDA 2HH0H 4GBXD 4GRLD 5HYEA 4ODDA 1N18A 3D30A 3Q9QA 3VQ2C 4PCKA 3LRLA 4GUZA 1KB5L 2X6MA 1NCAH 3AWGA 4HUXB 3EKCA 2DQEH 4ORSA 2O5YL 2WEXA 1FE8L 5B1JA 4E2OA 5AKRA 2JJWA 3GTTA 1FYTB 3K0YA 4WQOA 5E99H 2HJLA 3UMNA 1NC4A 1H6EA 2HKHL 1OKEA 2UY6B 1CICC 3IU3B 1BREA 2WVVB 1KN4H 3MBXH 2G5BB 3JWNC 3FCTB 1G0YR 3TF4A 5C08A 3IF1A 4S1QL 1K4CB 4KKLC 4TNWF 1YEFH 2ZZUT 4P2QE 3OC5A 3CXDL 3QCUH 1T3FA 1K2DB 1PVHA 3FAXA 1N8OE 4DAGL 1CGTA 2ZKHH 1FJ1E 2E7HA 3EO1B 1YEDA 1PAMA 2AEPL 2K7QA 1E9QB 2OR8A 5I74C 3N43B 4IDLA 3QXWA 3VI4B 4XPAH 2VLKA 1KOAA 2AF2A 2OS7A 1Z0MA 2AQNA 3QXDB 1E5CA 1HXYA 2MPVA 2X4QB 1IGFH 3DX8B 4X8JB 3P4MA 4ESKA 4P57A 4WKZB 2DQUH 1TZIB 3O2DL 5ADOH 2Y5TB 35C8L 3I9GH 3MR9B 3MRFA 4ANWA 3TIDB 2KHAA 2NCMA 4IMOA 1A6TB 2OMTB 4LP4A 2EKJA 3Q7JA 5FUOL 2H4EA 2V3DA 4OAWA 4G83A 3DWTA 2WAHA 2VABA 4YAQB 2FJFA 3ESOA 4U8UM 2F5BH 1OEEA 5E6IB 3TBSA 4LCYB 5C0NA 2HG5A 1SJHB 4PJGB 5I1LB 1D5IL 1U3HD 3GK8L 4L3CA 3CN4A 2X8TA 5CKGA 1X5XA 3T2NL 2ENSA 1THCA 4MNHB 3K4AA 1CF8H 3GMPB 5IWLC 3SGJC 1HDMA 4OT1H 1JZ5A 3QIUD 4G7QB 3F7VA 5CLWA 3FT1A 3FUFA 3ZLQC 1YNLH 3RUGF 3NQKA 2A99A 2AK4A 4W9KC 4XP6H 4S2SA 5DS1A 5HY9A 3LB6D 4M7MA 1XF5A 1SF5A 2P80D 2PYEE 4KVNL 5IK3A 1XMEB 1CN4A 2PCXA 3CUPA 1CB4A 5E1IA 5AVRB 3D4GA 4ZW3A 1JPST 1BYPA 2O1AA 3BSGA 2R29H 4NNSA 2YEZA 1OGTA 3IKCB 4DKAA 3BMWA 4PRAB 4K7PH 2X09A 3BQUB 2PW1A 5I1EH 5GRVK 4ZG1A 5ID0A 4HK3N 5KJRH 1CU4H 1RP8A 1RY7B 2C9XA 5I0VA 2VQTA 5GJSH 4YH0A 3DO4A 4YDZA 1X5MA 1NCIA 3ZZSA 3K6SA 4J1UA 1B0RA 4QNIA 4X99A 1A7QH 1E9PA 4FQXA 4LBEB 3MV01 1UZ6F 1XH3B 2IWEA 4PR5B 3FH5A 1HBPA 4HLJA 5T3ZD 43CAA 4PRPD 1SYVA 1GS7A 3HG1B 2Y32A 1HJBC 1LM8V 4QRUB 2P44B 4D9LL 4R5VA 1IARB 2A1WH 5TFSL 3O45A 4Z77B 5L2JB 1J8RA 1FPTL 4TMPA 4DKDC 2WP3O 3O3DA 5F97E 3MV9E 1FENA 2AEIT 1MHEA 3KNBB 1QZNA 3PUCA 3P0YH 5HA1A 4QRBA 3Q43A 5EF0A 2YAHA 5GRUL 4HJUA 5DD0L 3ZDZE 4DW2H 2OK0H 2QGDA 1V3JA 4WEMB 4C56A 3I0AA 2OTWA 4X6EA 1QW8A 1P1ZB 3EYVA 4EXPX 1HCVA 3BY0A 1EALA 5F0PB 1OGSA 2AXGB 2K3HA 2P4AB 3OKDB 2RA1A 2APSA 5EC1A 2OVEA 5ES4B 5HI3D 4PVMA 4KAQH 4UU2A 1BLRA 1I9IH 1XGRA 2CUHA 4R4FH 1BV8A 2V7NA 2A6KB 1A6WH 3DX4A 2J2ZB 1VCAA 3UZEA 4JG9A 4BUQA 3NSCA 5JUEH 3GT6A 4YDVB 5CJOL 4CN4A 5IV2A 4ZYKB 3KLKA 3VYNA 4YMPA 3W56A 1NFAA 3GRWA 5C0CA 3TVMB 4ABUA 1NBQA 1T2XA 2YD1A 4M93C 1RJLA 1AR1C 4G8AC 4JKPL 2R2CA 2E9JA 4QO1B 3RL1B 1A6AB 5EOTB 1SY6L 1FAIL 1WFMA 4M48H 4KX9A 3V79C 4W9ZA 2LVEA 1EEYB 4QY8A 2E5EA 1T66D 1AZBA 4NPYB 2UXFA 5AAWA 4TVPL 3LKNB 5LXGL 1RVFL 1U21A 2A0LC 2GBTA 3PAYA 4GRMA 1E8WA 4A2EA 2FH6A 3E9TA 1G87A 4HXBL 3O41B 4KKAC 1W9XA 4LSUH 3DYOA 4XE5B 3T0VA 4OCYL 4DUXA 3KCPA 2J7LA 2JELL 1WO2A 4Y16B 1N7YA 3ILEA 2YK1H 4L5FL 2QT6A 4OM0H 5BNXD 3M7FB 4UIMB 9PCYA 3U6RB 4Y0PA 4IMNA 3RE6A 1U2YA 2PR9A 3NPZB 1ZVNA 3QR2A 1KSRA 5FYLE 2GUOB 5TQ2H 5D71H 5JOPE 1SLUA 5H37A 1A4BA 5SWZD 5JLZB 3C60C 5HHOD 4I77H 5HAEA 1E6JL 2NTFA 1ALBA 3PFQA 5FYJH 1NMAL 3SQRA 4ORGA 4MCMA 2JB5H 4MZIA 1FN4B 5D8JL 4BFNA 2DMCA 4TSCH 2BT9A 5F1NB 2OSLA 2IAMD 1SMAA 4XO9A 1UYNX 1NMBH 1CLYH 2X6CA 2Z8SA 2IFFL 5BW7A 4TXVB 5E5UB 4ACTA 1BSIA 1WDAA 3MNZA 4R0LB 5L4FA 3V7AG 3R06B 2FBJL 4DKFH 2YQBA 3CTTA 1TEFA 4OIBA 1CVRA 3H42L 2OVAA 4XZ4A 1PX8A 4HWZB 4NXSA 5AVXB 4ZI8A 4OB5L 2GITA 1LNUA 2ZOLA 1QBLL 3MYJB 5MEQB 4N6RA 3DMMD 2YPVH 4CN6A 5K9KB 2X4PB 4XB8A 5IB2A 1KBVA 4KXZH 2LU7A 4WW1B 1ZS8B 1USZA 4MXWH 1YG9A 2FJGB 5EZLB 3RWEB 2MWCA 3T04D 1ML7A 2I7SA 4W9JC 3ARUA 1UUNA 3E6HB 2VIRB 5GS2D 4PRHD 1MWOA 4WV1B 3KHOA 2BNUB 1R5VB 1L7TL 1NSNL 3Q5OA 4R5TA 1NCBL 4M6ML 3FSWA 1JPGA 2E7CA 2HJKA 3CFDA 4K7PY 3H3IA 3WIIH 5DJ6A 2YD6A 2A2QT 2ERJB 2K0RA 4FN0A 1KXQA 4LKPA 3B2JA 3O81A 1ZLVH 3LKQA 4KJQC 4LPUA 1WD9A 2ROXA 2IQAB 3WJCA 4RGNE 4Y4FC 4MSWB 3CMPA 3FENA 5LDSA 5HI5C 4B9CA 2APFA 3Q05A 3LKSB 3TIEA 4PJBF 4NKIL 2EUVA 4R7DB 3FB8B 4I0PA 1YN6A 4X42A 3QZPA 3SSGA 5HJDA 4KJPD 1NKRA 2Y7QA 1KT2B 3KLSA 4DAGH 1TU2A 3TO4B 1G6RB 1EJ6A 2XFGB 1WE5A 2XV3A 1ES0B 1QR4A 3EH5B 3FFOA 4NLAA 4RIRA 4PJIE 5TE6H 2P8PB 4HLEA 3MO1A 1IILE 2UVFA 3LH2L 3ZE2B 2XWRA 3L4UA 2BSEA 4HULB 4LLUB 2DM5A 3UBGA 4I95A 1AO7E 4TKHA 3FF8A 3WGVB 3KPSA 4LCCC 4LPTA 5SX4H 3WS3A 5HDWA 2VDKL 1XGUA 2IAMC 3DVGA 1A4CA 3WKYA 2V7HA 5IHZB 3N5AA 1EFQA 4P06A 2OY1O 5JORB 1I8KB 3LXAA 3FT4B 2H0PA 2WQUA 2BP0A 4KOBA 4LCCA 4HJ1A 1LE5A 2NNRA 3ZRSA 4EVNB 4Y5DA 2VLJD 2Y2TA 1BSYA 4TUOA 4WWNA 3BPNC 1CT8A 3MRJB 5HHMB 1TZHA 2IGTA 5CO1A 4JPWL 1JOIA 4QXGL 3NIDE 4WJG3 4J3VA 4MJID 2OX5B 1MCWW 4JM2A 8CGTA 1KFAL 1CFMA 4UB0H 3SGJA 3T0EE 3TN0B 5JIMA 3OZ9L 1JJJA 2WLIB 1XSJA 1HKFA 3HG3A 1DZPA 3IWVA 1UXSA 3DPDA 5AVWB 3S5YA 2VITA 5K59E 3JVGC 3S98A 3B2MA 3ISWA 4JNXA 4OI7A 5EU3B 4I9WD 3CFBA 3OV6A 3C9NA 1FH2A 1KACB 1PBOA 3DIFB 4MYWB 1Z66A 4UU3A 3UBXI 4B53A 1VEMA 2OV0A 1FE8H 3PGFL 3WZQA 1NWPA 2ALWA 2QPSA 3RGHA 5I17A 1SMOA 3BC9A 2F8VA 2ZX6A 3GXUB 3VB9A 4EUPH 4Z3GA 4Z78B 1OWWA 5KIDA 1OF2B 2XBTA 2DKUA 1T66C 3LRMA 3OZLA 3MBWA 3DRTB 1DZMA 3K3LA 5BJTB 4QYNA 4QZUA 2VDOL 1SWBA 4YHPB 2IALB 5IMOA 1WPCA 5EFIA 3KBPA 4DP0X 1QTPA 3LH8A 5I16A 5L2KB 2FNBA 1JZFA 1NGZA 3R0NA 3VW3H 1BBDL 1MRDH 1LDPL 4JFDE 2Y6TE 3GB7A 1D5BB 1T1XB 2AABL 4H88H 4XNMA 4CADB 2FWLB 1I1YA 4Y4FB 3ZE2E 4Y9GA 1OK0A 5TDOA 2W1NA 2K7PA 4GKNB 5CP7B 3QG6B 2QL1A 5DD0H 2OK0L 3MODH 3MX7A 5ESQB 4FLHA 5IHUL 4GGTA 3A67L 4PW3A 2FJSA 3M6DA 5GGQL 3GS0A 5C0RH 1TQTA 3KVDD 4OVUA 2WTPA 4U2ZA 4JAMA 5GZNC 1SHWA 3LDBC 4GH7A 3MRKB 1A6WL 3BLBA 4GW1B 2FJHB 3US0A 1N8ZA 3BQVA 3DOSA 3OAYK 1D3SA 2XV6B 2RTOB 4XC1L 1AS6A 2Y9RT 2FH8A 1AE6L 4LQFH 4FXGB 1N8ZB 2V5YA 5I75B 4YBLB 4Z7AA 1FNGA 5AD0A 2E27H 1STPA 2LBAA 2EYRB 2RTQB 2NY4B 2VN6A 3FW6A 2B1AL 1E67A 1TT6A 2OULB 3RNKB 3CLFH 1A6ZB 2XIBA 3DPBB 3QZNA 1OB0A 1WWWX 3D0VB 2DEXX 3QHFL 3QR0A 4KVNH 3UIZA 4M4RA 4FLSA 1NJ9B 4ZXBC 1A66A 3OHXB 2FUTA 2IDTA 5C7XH 1SWDA 1NDMA 1ZHNA 1VJSA 4AITA 1SRIA 2A9AA 3F04A 2OL3L 1U93B 1SXXA 3UTTD 1NGQL 1BQLH 2J57A 4TJZA 4R97C 3VNYA 4EI6A 3B8SA 1QNIA 5BVPH 3VXMB 3P9LB 2R9HD 5AFAA 5I6LA 2P3YA 1YUHB 2NQCA 3UTSA 1E4XL 3CVHH 3QDGD 1JV5A 3PJSB 3T0XA 3OVUB 2C5DC 1OE1A 3NR3A 1C5DA 4F92B 1XB8A 1QVOA 1YEGH 2WBJC 1DEEA 3LJ3A 5B21A 1F13A 3BGFB 4UYQA 1YNTA 2R59A 4JY5H 5KVDH 1G7JB 5I17B 4KZ0A 4X0NA 1TXKA 1IKEA 3SE4A 5MERA 1NBCA 1U3HC 5EDXA 4ORXA 3O6FA 2OCCB 3NX2A 1FJ1B 2KL6A 2XN9D 4NQDA 1BMGA 3TYFA 2DYPA 1FWXA 1X9QA 4MQSB 4NBXB 5IEHA 4UWQB 3GMOB 3RWIA 1KPUB 5EU6A 2VMEA 4YR6A 5K9JL 5EWIH 1I7ZB 1PLGL 1YEHL 4PJ9A 1TLMA 4HD9A 4DGVL 2XY2A 2PYFA 1T20A 5C86A 5BO1H 4X7CC 5ANMA 2EU7X 4FXGC 1VWOB 3KL5A 1CT8B 1AS8A 5DTFB 4JFFD 4XOAA 4JB9L 3SDAB 1AHMA 1L6PA 3GM8A 5IT2H 5IOKA 5C0EB 4JE0A 3UP1A 4O3XB 1KTBA 2MTPA 3FT2B 1LE5B 2QKIA 4CJ1A 5C0AA 2P5WD 4AQ8C 1IC5H 1ZT4A 3CH1A 4PRBA 5D6CB 2VQ4A 5SX5K 4ZMPA 1MVFA 4G6FD 4HIEB 1BF2A 4UQAA 4BZ1A 2LU3A 1BLIA 2ALLX 4GINA 5L2JA 5E0FA 3WFDH 3L3KB 3PV6B 1H6UA 3SKUD 4TQEL 2ZPKL 4L37A 4YFLF 2VZOA 5AB9A 3QWNA 2ED9A 4HS8H 1UD6A 2FR4A 2B20A 3KPSB 3SKMA 2Y24A 4ELMF 1OZTG 1SJMA 2JKJA 4Y4KA 5IVXB 3WU1A 5D2NB 1SM3L 2VR9A 5A6IA 2C7UA 4AL8C 3N40F 1FELA 3MJ8B 3SYQA 4PJFF 4HIXL 5HCCC 3C6LC 2CWRA 3OAYH 4NQVB 4OCYH 2BOBB 3SQBB 1TU2B 3V6OE 2Z7WA 3QC5X 1JTPA 3WKNA 3KJ4C 2V3FA 1X9LA 1M1XB 2QHLA 2L68A 1YY9D 2Z31B 4BQBA 5E8EB 5IFHH 1P4IH 1J9RA 5F8QC 3GSWA 3SKOB 5KSUA 4KUCF 1XXDC 4N0YH 3CQNA 5IOPA 4L9LA 3DURA 3IJYB 1SN5A 3WHE0 5I19H 4AQZA 3NOIA 4G7VH 2N93A 1QEWB 3QYCA 2NT1A 1STSB 4Z7NE 4YSOA 3LKOA 2JJSA 1JPGB 3I3BA 2FQDA 1GGIL 2HLEB 5FC9A 4CW1A 2B2XL 1GX3A 1KYOK 4RFEB 1D5MA 4UIKH 1MWAB 5AKTA 5L9DL 2B7DT 1M05B 2C3VB 5BMFL 2AK1L 3O0RH 1GYVA 4ZODA 4QRLA 4D3CH 2AF5A 2OPCA 4B9IA 1YJDH 2AQ2A 3CK0L 1KIUA 1SBSL 2CKNA 4DCBA 1RZ8B 3A3YB 4KUCD 1AIFB 4B9PA 2FJGA 5EZLA 4U2YA 1VWPB 1A5FL 4RZCB 3LKPA 2ADJB 3NN8A 4NYLB 4OFKA 2I26N 3O3BA 2ZQKA 3CN1A 4PGDA 5DZPA 5DUML 4XPHH 5D7LB 4UINL 1J9SA 3LQAL 4NQDE 4S1RL 5D7SL 3RWHA 4BYHA 4D8PA 4N8VG 2EC8A 3ESUF 4K23L 3Q9PA 4NWUH 1AHWC 2W8CA 1MFDL 1XXFC 5MEND 4X2UA 1Q9KA 4KC3B 2YPVL 3PHOA 1J8SA 1GCYA 1A1NA 1UQSA 5EBMB 5KSAC 2WXMA 2EIMB 3MNZB 4E0RA 1RH8A 1YNKL 3NQ9A 3RX9A 3F85A 1QSED 3ILDA 1KFAH 1SFHA 4X4XB 1PNCA 5ELIA 2DWEB 4FYRA 5T3XH 2O6CA 2R4SL 5F1NA 4ANXA 4WU5A 3IE4A 3PAUA 3WYPA 1ASOA 2W94A 1JBHA 4FQ1H 3WTYA 4JQVA 5HPMA 1AZVA 2FS6A 4DQ3A 4NO0D 1IBYA 5D4HA 1NLDH 4XMHA 3FONA 4ZO9A 2A5CA 3MV7B 1OQXA 5D7IF 5IG7A 2VDLB 4ZFOA 5JLZA 1B2WH 4EZLA 5DG4A 1I3UA 1BXUA 5C09E 1AVEA 4ZAKD 2NZ1A 1IJ9A 4LIQE 1NDGB 4BRJA 4ENED 1O1UA 3GS4A 5FOBB 2AW2A 1WC7A 3GKWH 3CHSA 3P3UA 2FT8A 2DQCH 3N42F 4FLQA 1BF5A 1A9VA 1JYDA 2J8UB 4F58L 3PL6D 1JVLA 1X6LA 2R74A 4HKJA 2VSCA 4TUJA 4LEOA 4GKZB 2OMYA 5DZLA 3S3BB 5E4EB 1A21A 3WUWG 4RLDA 5L7XL 3MLWL 3I50L 5IIEB 5FQ8E 2F61A 3FFCE 1U41A 1JS4A 4PS4L 1WA2X 1QRKA 5B39B 5C07A 5CAYB 4KC8A 4BJ8A 1A9EA 4MB3A 3ARVA 3TZVC 1VEOA 32C2B 2L7QA 5KVGL 5EU7E 1EIIA 2PW2B 4GW5B 4NPYA 4X6DB 4KRMB 3CLWA 2CDEA 3GSNL 5JDSB 4MLSA 2EABA 1TVBB 3MGOA 4YXLH 2R2BA 1VACA 5FGSA 1J5DA 4OZ4A 2ICWJ 4HKZB 5HDBF 2ADGB 1YECH 3VFRA 1L9RA 4WEBL