3P02A

Crystal structure of a protein of unknown function (bacova_00267) from bacteroides ovatus at 1.55 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
314
structure length
308
Chain Sequence
WTDEQFKQLISFKTQPGGWGVTDVHVRYANSAKYTYNLPVVSGTDDRLVSFSLRDDTLDILNFEKFGNRPELYFRELPQKYYSFPKELTIPAGQSHALLPIEFSLDGLDDSQKWALPLKVCEDNGTYAVNPRKYYRTAVLRPILFNEFSGRFSGSSLLGTMAGESDIKFSSTEIKLNVVTDSIVFFYAGQRTEDYEDRINYKVFLQFTGDKVDSKKDLYKMKIWAENEKLKFNSYSTPTYKVSSEMDATKTYLKHTYIVISDIDFDFVDYTSVPNYEIEYNMKGGLSVSRDLDTRKPDEDQGSDSKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a protein of unknown function (BACOVA_00267) from Bacteroides ovatus at 1.55 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Unknown function
total genus 78
structure length 308
sequence length 314
ec nomenclature
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14274 DUF4361 Domain of unknown function (DUF4361)
A PF16343 DUF4973 Domain of unknown function (DUF4973)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.440 Mainly Beta Beta Barrel Lipocalin Lipocalin 3p02A02
2.60.40.1740 Mainly Beta Sandwich Immunoglobulin-like hypothetical protein (bacova_03559) 3p02A01
4DQAA 3P02A 3POHA 3N91A 3SOTA 4QNIA 3NQKA
chains in the Genus database with same CATH superfamily
4NDMB 4U31A 3HPLB 3NYKA 3TBYA 1EIIA 3TO2A 1PYWA 4YFRA 4GUZA 2RBLA 4OUUB 5EUOB 2X6MA 2HRLA 4B97A 1LNUB 2VZVA 2VDPL 4N0CD 5TGBB 3ATDA 3SE9L 1AACA 1YEHL 1G94A 3DGGA 3ZT6A 4G6AD 1UB6B 2NXYC 4HWNA 3FQUA 2Y06L 2HJLB 4UNIA 3B9AA 2W2BA 1IU1A 2XT1B 4MXVE 3U2IA 3CFQA 5A7BA 5ANME 3NACL 2N3JA 3X11A 3HPJA 4LVEA 3VG3A 1KYFA 2XPGA 4MJ2A 3FTUA 1I9HA 1UFUA 4B5EA 2ZSVB 5JOEA 4QHPA 5C3TA 2XN1A 2YPLD 3LD8B 3OX8B 4PV8B 3T0AA 2Q76A 6FABL 3GPEA 4NZUL 3BVTA 1AANA 3D3VA 5LDSA 2YHGA 1IGCL 5JQHC 3HRZC 4Y5XC 3RWEB 2VDPB 1VGKA 4MB5A 5H37H 4FA7B 2KDGA 3MFGB 1OIOA 3I0AA 5EZLA 3MUGA 3ZDXE 3H8NA 4XBGB 2NZ9D 2VDQH 2OYPA 2MQ3A 1HDMB 2FECI 1PG7X 5TE4H 1RPUA 1KENL 3FOLA 5C9KA 3BRDA 3FEPA 3APUA 1S5HB 4NNTA 4Y7OC 1VFOA 1DE4A 1QG5A 2CIKA 2FCBA 1BM7A 3RX9A 1DUYA 2H41A 1SLDB 1FIEA 5ERWB 2ZX8A 5EC2B 4HCRH 1S9WB 5DK3A 4LIQE 4B9GA 3F6JA 4B6ZA 3HTYA 4HBQA 4QNPF 2ZF8A 3TJEH 4CBZA 4P46B 5T3XH 3G6JA 1E2WA 2NXYD 3L45A 5DGQA 1OGAA 2F58H 2YPLE 3QIUA 4XPTH 3IKCB 5EU6A 3ZI8A 2G3NA 1G7MA 3N40F 5C9JB 2B3IA 2IZGB 2DLTA 2XBZA 1JP5A 3GK8H 4PJGF 3LRSB 2ZWKA 3B9EA 5DVLA 1K5NB 1K8DA 4HUNB 1DN0B 1MN4A 1QO3B 5I1LB 1NFIB 3MNWB 2UXTA 3J2PA 2YGQA 4N0UA 4WCYH 1GKAB 3COOA 3G5VB 4JGJA 5D2LB 2GBUA 2Z91A 3H7BB 5J0BA 3QJVB 3PWJA 4MSWA 3VXNB 3JVGA 3FH7A 4PI2A 4IIQA 3I9PA 3KW7A 2W0KA 4KZ0A 3LV3A 1X8OA 5ACZB 3MV9D 2W0FA 1MX8A 1WWWX 4N3TA 1G9NH 4L3FA 3O8XA 1YO4A 3KL0A 4AV5A 4K19A 4NLAA 3FUEA 1ZGLB 3ZDYB 5DD1H 4J6RL 4DP0X 3QAZC 3T0EB 4BZ2A 25C8H 5A16A 3M1BB 1P7KA 4PWKA 1MHCA 4YDJB 4XCFL 3WIIH 2J44A 3BH9A 4P2QD 1X7TA 2DS4A 3VWKB 4DKFL 3OGCA 1AQ8A 5AZ2H 1G1YA 3V0FA 1I8UA 4M6ML 4EVNA 4JHUA 5CZXC 5FOBB 3P24A 4XNZB 4E9SA 1HKLH 2VH5L 4FNPA 1TQVA 1JPST 2NUTA 5MP6H 2RTNB 3OAZK 4JM2F 4QRFA 4QXTB 5C0CD 4X6FB 1B4JH 4G7VL 4ZNEE 2FSEB 3UXFA 4KIIA 4QRSB 1Y9TA 5DWUH 5F7DA 4EI6B 2VLLA 3QPXH 3QFDB 1LEGB 2BHVA 1UT9A 2UYLB 3QFGA 4UDUB 8FABB 4J23A 3MV9E 4HPCA 1JTPA 3B37A 4EI0A 2D03L 4B3EA 3W57A 1YMMB 4TNNA 1D2OA 4MD4B 4TQIA 1KV3A 2VERA 5DZJA 3ZDXF 3VI3F 1YAIA 2ZNXA 2FEDC 1PIGA 5D96B 4HZLB 2DN7A 3MTRA 3QJHB 4MD5A 4P2QE 2AXFA 2DLEA 4EN2A 4WNSA 5E4OA 5AAWC 3MV8D 2ETWA 4GK9A 5CIPB 1I1AB 4Z78A 4UIMA 3GKWL 1MHEA 4LLMA 1WICA 4POZC 4NRZA 1XB6A 3K6NA 2K6ZA 2GTZA 3U1QA 5C0CE 5LNEA 4HJJH 1NC9A 4G8GB 5DD3L 5DZOA 1SYVA 1U2CA 4YSAA 4O9HH 4X4MA 5LCVL 4BFRA 4WK2B 5CZXD 1JPSL 5HYEA 3M1OA 1JHKH 2EDLA 4K23L 1A9EA 4Z7WB 1FLRH 3FU9A 1QFPA 2OFRX 1I7TA 4R97C 1N8ZA 1VFAA 2ERJC 3IGAA 5K68A 1QFWM 2CO2A 4KXZI 4HBCH 4PTTB 2VRAA 4AV4A 3ILPA 4CDGC 4XZ4A 2DV6A 4OEMA 5FGSA 4ENZA 1I9RL 5E5LA 2BCKB 2FH8A 1AYOA 5GGTA 4R7NB 3OMZA 4CVUA 4ERSL 1IKNC 3MV8E 4B27A 3VRIB 2L3BA 3AY2A 4L8SC 1OAXL 4L4VA 1NWPA 1HL9A 3H0TA 3NH7L 4XBMA 1RAVA 2O6EA 1FNSH 5TF1H 3ARUA 4HEPA 1KIRA 1HHKB 3U9PC 1P5UB 2BDNH 4PRIA 4XPAL 5I6PA 3VXRD 4M1DL 4POZD 1STPA 1LMKA 3EO9L 4FQXC 1OPBA 4IOSA 4DP2X 1QBAA 5KOVC 2COVD 1KXVA 5FA4A 3GKZA 1JJJA 4HOWA 2K3HA 3GZPA 2C5DC 2VXSH 1MLBA 3N9GH 4J3OH 5D72H 3U79A 4NQCD 3WDJA 1ZT4B 2UXFA 1S9XB 5D55A 5CEZD 2X28A 3QYNA 2Y3EA 2WP3T 2VL4A 5I1DA 3TLRA 3EBIA 4HPDA 2DYPA 2FVNA 2DAVA 2NNAA 4HC1L 1KTDB 4JM4H 4NKQB 4K9EL 4XR8C 4DGYH 3GS7A 4I0KA 4QYOB 4WKZA 5IMOB 3MRMB 2GC7C 2PO6C 3ARSA 3U30B 1YQVH 1BFOB 1D2PA 1RD6A 4FYRA 2CBSA 1R3IL 3OAUL 3I50L 3OKKA 4XO8A 5D5ME 4IHOB 3B2VH 5E1AB 4JG0L 4HQQH 4YDLC 4PJEE 3RWIB 3WBGA 1L6XA 3RUGF 2AAVA 1K4CA 4MJID 2Q6WA 3VXRE 3MX0A 1A6TB 1G0DA 1IQDA 2PNDA 1RV6X 2Y7NA 4UT7L 2PYED 2PXYC 3ESMA 2IZLB 3BISA 1EZLA 4AIZA 3WJEA 1BG9A 1PD6A 2VSCA 3FTZA 3ZHDA 3VXSD 2OL3L 4HMEA 4F37F 4Z76A 2V17L 4H4NA 4YDKL 2TSBA 2XWEA 4NQCE 5CEZE 2B0SL 4F7EA 4FQXD 4GUQA 1IC7H 3B2UC 1ZEAL 2FX9L 3BT2H 5AKRA 3BZ5A 4Y16C 4QT5B 4ZZFA 3TPKA 3ELZA 3SKOB 4S2SA 3VSQA 4HJGB 2B16A 5HVFB 1AI1H 5FIEA 3KM2A 2JFCA 2X4QA 3STLB 2VDNH 3UTPD 4FXGC 3BUYB 1KQWA 2OJEA 2OL3B 4Z7VB 4M43H 4XN9A 4LHUD 5B8CB 1A5FH 5D6DA 4HGMA 1HIMH 4MJIE 2RH0A 4R90H 4Z3TA 3QG7H 2PO6D 1F4XH 3PG2A 4WJ5A 2W0PA 2KMWA 2PCFB 4TQEH 3TONA 4DT2A 1H6UA 2EXSA 2IADB 2OS7A 1ROWA 4FNSA 4U6YB 5KN5B 1UZ6F 1TPXB 1VFMA 3BGAA 3KDMA 4IM8A 3I6KB 2I07A 1K9TA 5IHHA 1AIFB 2PXYD 4RMWA 4D0DA 4W9GC 3SDYL 2DM2A 1DBAH 2VLRA 4YR6B 3P6DA 3K6FA 4ZAKA 1ZVHA 2XN0A 3QXDB 3K0YA 4FE9A 4ZUVA 3IDMA 1O6VA 3H7LA 4NSKA 4UOJA 1Z9OA 3GB7B 5JPNA 1DVFB 4XWGH 5KVEE 3C08H 5HJGA 4QRPD 5FEBA 3NBNA 2BS9A 3UTPE 4OFIA 4Y16D 4KWUA 4GRLB 3QAQA 1XFPA 1A6ZA 1TSHA 1LHZA 3ZZ1A 1IVTA 1P4IH 2XQBL 3QXVA 1RZFL 1N4XL 2Y7QB 3QXUA 3TN0C 3H3PL 4I0PA 1ESOA 1EZSA 3QUGA 5JDSB 2QFRA 1PTSA 4NW4A 1EXSA 4LDEB 4KVNH 1IO4C 4L3EA 5AUMB 3X1GA 4LSQL 5KUMA 1FZOA 1IB5A 2ASNX 3FCSA 1OB1A 3N0PB 4P9HH 2X55A 1CR9L 3FOMA 2FGWL 2IAMC 4N6QA 2F5AH 2JQAA 3WIFA 1CDHA 5KW9H 4GAGL 3ES6B 4UAOC 1LJMA 4AQ1C 4OLWH 3FU6A 2X2YA 2NY3C 3E0GA 4AT6A 3BX8A 4G11A 3MBXL 3NRQA 5CBAB 4JDZB 3LRLA 3NZHL 5E00B 4QRPE 1BSOA 4Z27A 4PPTA 4G8EA 4OT1L 1XIWB 2D3LA 5MEOB 5L2KA 3FR5A 2NX5A 3KFGA 1MCWW 2DIEA 3V0WH 2RTBB 4XMTA 3WY1A 4ODUA 4OY9A 3ABKB 2P24A 4JY5L 4OQTH 3BD3A 2CDGB 3DX8A 1YWBA 3VD1A 3D2UB 4DEPB 3LQAL 5FF6A 3BKCL 1MAKA 3JUZA 5BQ7A 3JTTB 3LVEA 3BEWA 3TN0D 1B2YA 2WBXA 2HVBA 3K4DA 3NRFA 4OZFA 5HDOA 1LCZA 4GKNA 4FHKA 1MCFA 3WNPA 3RZYA 1AD9A 3MNZA 4AWJC 4N5UA 3V7AE 5IB5B 4GYBA 3H3BC 1NINA 3LN5B 5D7LB 1PY9A 3MRIA 3MRDA 2ZYSA 4PW9A 2IAMD 1MUJB 3EGSA 4BK4A 3ZDWA 1ULVA 1FIGL 4P23A 1LO4H 1I3GH 3CDZB 3I2CL 3PAYA 1A7RL 5JLZB 2EO9A 5K39A 2HTLC 1NEZG 1Q9LA 3D34A 4QEGA 4AZUA 3UZQB 3UTQB 1S7TA 3HNVL 4FTVA 1KGLA 1R6VA 3GI8H 5DUPL 1GZPA 3VFTA 5ID0A 3F3HA 1AKJB 4YSOA 3C2SA 1LEIB 2ZOKB 3Q01A 5EDXA 2RTPB 1X9LA 4WFGD 1TXKA 3QBTB 3FHEA 5HYSB 2ZOTA 1HNYA 4GUCA 3Q13A 1IGMH 3MU3A 5TE7L 3B1TA 1KPVB 2VN5A 2NYKA 1AS7A 4RDQG 3D6GA 5AL0A 4DN4H 1U8IA 5CXPA 4F7MA 3KDPB 4M8VA 5FM5M 1A7OH 1KTLB 1XBDA 3AVEA 1G1CA 5AAMC 1J9CT 1JNLL 4AXWA 2XU9A 1N7YA 2FT8A 2ADIB 2NDFA 1TTAA 1VF5C 1YUKB 2XV6B 1YIVA 1FO0H 4D9RD 3S0PA 2WNWA 3SD2A 3GAQA 4GIPD 4IU3B 3BKJL 3C5XA 3X14A 2X12A 2J1YA 2PYEA 5I76A 3C60C 2E7BA 4RMBA 2MO5A 2B2XL 3L3OC 5L2JA 4N8VG 3RIAF 2YSSB 3VXSA 3H9HB 1A7NH 1JTTA 1RK7A 3KWWA 1CD1B 1N5AB 4RFOH 2HTLD 4TVPH 4KBPA 1GMIA 2EECA 1K24A 2XKNB 4WFGE 3TZVC 4D3CL 4DJMA 3SBWC 1P84J 1BLIA 1CD8A 3VGDA 4E5XG 1J5OH 4TNWK 3CLFH 1YC8A 5EWIL 2XBDA 2BT9A 3TBTB 2P47B 2GJPA 1FH2A 3M45A 4RSYA 3QJOA 4ODXA 3CN2A 1QABE 3VE0B 3EAKA 4F7PA 4NBYB 1LDSA 2QPSA 3AREB 4Y19A 3M1CA 4KAQH 5A2FA 2R29L 3DJSA 4ETQA 4F9PA 3ULVF 3MRCA 3NCJH 1TQTA 4U1KB 2ODIA 2EIKB 4RRPM 4D9RE 1PZDA 3HS9A 1FGVL 2AH7X 3F85A 5FKPB 4RZCB 2O5XH 2JK5B 3LD8C 4HPOH 3AT0A 4P4KB 1YG9A 3W5MA 1LE9A 5IMKB 1CL7I 5C0GA 2QQLL 1IBZA 2JH2A 3EJTA 3IDNB 4QOKB 1Q0XL 5F7EL 5DUBA 3V55A 1JJUA 3LNIA 1FFOB 4TNGA 1NCWL 4GMSH 4NFBA 4DCBA 4W9DC 2ZUTA 3C60D 5E6YA 1PMPA 4LCUB 3W81A 2WTOA 1CK0L 3UL4A 4R4NC 3NJGA 3WSQH 4YNYB 5EEXA 1BVNT 3LYRA 4B9IA 1K3ZA 2Z3FA 4K9JA 4ACTA 5L4JA 3J7HA 3S8GB 2BNUA 2XHNA 2K8MA 2WLYA 3KPTA 3TBWA 4LRNH 5DEZA 2FR4B 1RLBA 3CR6A 1UYOX 2J4WL 4OZ4A 2WPGA 1P9MA 3H9SA 4MVEA 4OCWL 4KTYA 2K0RA 2IFGA 5LJGA 4P46C 3VA2C 1UKQA 4KKBC 3DO7B 3C9NB 1JVOA 5T33L 1YUHB 3N50A 3LDBB 4YL9A 2X4TB 4ONGH 2VLKA 4U6HB 4XNQA 1LD9A 1MCNA 2ZCZA 2JI2A 5F7NC 1DLFL 3ALWA 4GEIA 1YNKH 1Z5YD 4XVTH 3KJ6L 1IGIH 2AABH 3PREA 1J0IA 3DVGA 1L9QA 4OGZA 3D85B 3IPFA 3ATEA 4JFYA 4QTIL 1M4KA 3G5XB 1AGDB 2VR6A 3KR3H 4YSDA 3N42F 3MQIA 3L9EA 3D8MA 3FBQA 2FBJH 3VD3A 2CRMA 4TLJA 2QSCH 4HCGA 4MIRA 3ME0B 4GFTB 5CP3H 4UQAA 3W0WB 3D06A 2AHIA 4GSUA 3O22A 5EUOE 3QUZB 4R4ND 5E8OA 2VR3A 3WTXA 1G7PB 4PMEA 1M56B 2MOGA 1GSKA 2AI0L 4J3OG 3ZO9A 2QGDA 3T0EC 1JHLL 2J43A 3M17A 1XSJA 1DBML 2A9CA 4U6TA 1J0ZA 1M1SA 3EW1A 1WPCA 1W72A 1LMIA 3LKNB 4FQLH 4ZMXA 3UJTH 1KFGA 4PJ7A 4Z23A 5HYJA 3VWKC 4NO2A 3WJMB 1YJDH 3DIDA 4P46D 4BSWB 4KKBD 4YHML 5IWLA 2GCYA 5HPMA 1MCCA 3ROLA 2YBRA 1KG0B 3VXTB 1WH0A 1ZPUA 2OCCB 4JKWA 4EUPB 4OCYH 3VVVA 3BSZA 5L8NA 2W1NA 4L8BB 4NYLB 4QRTA 1IC5H 1ZA6A 3I9IA 4Q9QL 4G5ZL 1OEKA 2DL9A 3R1GL 4ORXA 1BQLL 3AU1B 4FG2A 4I18A 4M7JH 4LOEA 4ZTOH 4P2OB 3WHE0 4M7LH 1KB9J 1CD9B 1Y07A 1MJUH 2YGVA 3M7OA 1E5CA 5EF2A 3SQOL 4Y0RA 1IKJA 1A4JB 1TOWA 1FDLH 1IAIM 1QSVA 3FQTB 3O0RH 4HIJB 3TTYA 1JZ6A 5J8OA 1YP7A 1Q9KA 3A23A 5T1KA 1XHHA 2X42A 4ESKA 2BZCA 4BJLA 1OD7A 3RVTC 4X7DC 3WHE1 1OXYA 2K4AA 1CGUA 4AH2B 2E8ZA 5D96C 2P5EA 3P11H 1MH5A 4QRUB 1O7DC 5F2BA 4U9CA 1MIEL 2V7HA 4M02A 4C83B 3HJ0A 4FQ2H 3T0ED 4Z3HA 1MSPA 3APCA 1I1AC 3AB0B 4LL9A 3I9GL 5EDSA 3TIDB 3U0TA 1EUUA 2BVPB 2DI9A 2RIKA 1UOLA 1FNAA 2VL5A 3FRPA 4MNQA 1A7PH 3MRHB 2EXWC 4O2CA 2OTWA 1WLHA 1R5IB 3LS5L 3UYRL 3VWKD 3GXDA 4E42B 2WIIA 1TOUA 2RTLA 3IGLA 3EYCA 1ZNEA 5BQDA 1SOKA 4FDWA 1UVQA 1QWUA 5DYOB 3F7VB 2VXTH 2WUTA 5D2LE 1IARB 2DM3A 5FCUL 2WK2A 1T22A 3BWAB 3KWVA 3RA7L 4GSQA 3UJJL 4PJ8A 1NBXA 3FQ1A 3FSVA 3CZSA 3S5XA 4H0HB 3SE4C 4OFYD 1CYGA 1RP9A 2NNRA 3FH8A 1URLA 2WGNB 1N2RB 2FB4H 2WUCH 3EH5B 1N9YA 3NCWA 1PZ5B 1MCBA 2OP4L 4NKMB 4XMLL 1EXUB 5E6SB 5D2NA 5IBTH 1E8YA 2JQMA 5DA4A 4TL5A 1YMMD 2RCSH 1FYTB 1RUAH 3UGEA 3V0EA 3ZDYE 4GG6B 4WHIA 5E9DB 3T0EE 1AHWA 2C9UA 2XX0A 3EJRA 3IS1X 4GI8A 3RVTD 3E6FB 5DLLA 4YHOL 5F7HA 2N01B 4U6VH 3K7UA 3LB6D 3I17A 4WUKH 1E2TA 1DFBH 2ADJA 3PUCA 5HJDA 1T21B 2IBZX 3IDIA 3RDTA 4XBEH 5CLZA 4M3HA 3VSUA 35C8H 1ET7A 2JNZA 1CPUA 2E3VA 4AYHA 2HMBA 3ARZA 4LRIA 4C56D 2EXWD 3IRCA 1IZJA 3QDJB 4IBLT 4LP8A 1FVEA 3LEVH 2WZPD 1LEKB 5GS0H 4G8GD 5TDPB 3SPCA 2AQSA 5LGHH 3S3SA 4A7QA 3DXAB 3VXMB 5EN2A 4ZCBA 2X70A 3DIFA 4YSEA 2YWYA 4K3EL 4PV1C 1EZVX 4K15A 5ECJE 1H0DB 4D0BA 3SPGA 3RBYA 1INEH 1OCWH 4NO5A 5IR1A 4LZUA 2AMUA 3E2HB 5D7SL 5BVQA 2KW1A 3IJHA 5E8NA 1PX8A 3A6CL 1YMME 4F33B 5B3SB 2CR3A 1ZANH 3MJ9A 4NOBA 1L9TA 3VYPA 4Z7OF 1FZMB 2BS6A 3TA3B 1G9MH 1EFXB 3O11A 5IF0B 3ZUIA 1ZHBB 1IM9B 5B10O 2H32A 3FQNB 4HCFA 2A1WH 2Z31A 2Y7LA 2BWQA 3ARFB 3U0DA 3VTMA 4LCIH 3R19A 1O7DE 2K8QA 1UATA 3UCQA 1KCUH 3V0IA 2Y6TE 1GZQA 1SEQH 2YUVA 2DBLH 3S7GA 5F6IB 1L6ZA 4YS4A 3OKLB 4Q0XH 5AOLA 3SE8L 4I1PA 4G8GE 5IGXH 1X9RA 1AXTL 2JGSA 4LAQH 4K9EC 1MVGA 3BPLB 1OT1A 5KBNC 3KMDA 1MI5A 4MVLA 2WO3B 5D70H 5HI5C 2EDEA 4JFHE 2DQJH 3KVDD 5ICXA 1WZAA 4ALAH 2XXFA 3AZUA 3AXLA 4PJXB 4HUWA 4Z7WE 4CJ1A 3B3IB 5DHVB 4HSAC 4HX1A 1WTLA 4S0HA 4CVXB 1DVSA 5EF0A 2EEFA 2CALA 1INQB 3T0DA 3QORB 3EYQC 1C1EH 2E56A 4K5NA 1NAMA 1LE5B 2VDKH 2B59A 4M62L 4OLUH 3W9DA 4BH8A 1W0VA 3EOTL 2APXA 4FQJH 3I74A 4V1DB 2QSQA 4ZX4A 2UWEB 5I1KH 4J3TA 4KFMA 4LBEA 4YFQA 1G7HA 1A1MA 4AE1A 1TKWA 4ORRA 4PJ2A 2WXHA 5B8CC 1T4KA 2WKLA 2BMKA 4PJAA 3UACA 1ZLUH 3L6FA 5E2WL 5C8JB 4BH7B 3KPLB 4FFTA 1DQVA 4HWZB 5D8JL 4H1LA 4U1SA 3F2LA 4I3SH 5DEGA 3Q48A 2NT1A 1WRFA 4JB9L 2GABA 3DPBB 4KKCC 3QXAA 1QG3A 4AEEA 4FD0A 5BYPA 2EYTA 2IDQA 2A5BA 2XNAB 4DK3A 2CH8A 4PRPB 4YSRA 4AJYV 4CSPA 1QBML 2E74C 3TCTA 2BVUA 2A6JA 2ARJQ 3HUJA 4DHLA 1FDQA 1RPKA 1D5ZB 3U7WL 4JQIA 4BHUA 1ONQA 2BJMH 1P1VA 1KGWA 1IBHA 3GBMH 3QGVA 1DVFC 3AFLA 3GMLA 5F88B 4APXA 4GSXA 1YQ2A 3ABZA 4LQFH 1AQDA 4DGIH 1P5VB 1L3WA 5JIMA 1NGWB 3FR4A 4ODWA 5EOCL 2M1KA 1EUOA 4FTDA 4GRLC 3EYQD 1QY0A 3ABGA 5AYQA 3APFA 3VM5A 2ZICA 2BINA 4PUBH 3L08A 3S4SA 4HT1H 2RCTA 5IJVB 5IP4A 3X17A 4XOCA 5I1LA 1ZAGA 3BWUF 1KN2H 3DTXB 2E9IA 3PP3K 5C0BA 1OF2B 4HA1A 3V52H 1HSAA 5ESQA 3SZKC 1LO2L 1ZIBA 2WP3O 3A22A 5AAPA 3IGKA 4UU3A 1AZBA 1TVHB 1BW8A 1DVXA 3FT0A 5F7GA 3P54A 4LIQH 3FO1A 4NUQA 4P9ML 1MWAL 4LVOB 3ATBA 1IM3A 4MX7A 3GJEA 4M61A 4JPSA 2A5CA 3CDGB 1LO3L 1ZLEA 2X89A 2A77L 2IZCB 3TGCA 1AOHA 1T7ZA 2CO7A 5EPMB 3OJYC 1UM5L 3DMMA 3GEFA 3ESVF 4KKCD 4XH2A 3EOYG 2G0KA 3BFWA 3T4YB 3T1DA 1TCMA 1PGRB 3WUWG 1UM6L 2XXMB 1DZMA 1IJ8A 4D8PA 2CLVB 2DD8H 1XGRA 1NMCB 3BX7A 1XIWC 4PJIF 1BM3H 1H19A 1MWAB 2F68X 3FDWA 2JJUA 1UM4H 4JO6A 2Y5TB 4ZO6A 4FHBD 4GP8B 2O61B 1KJ2H 2H6OA 4EBQL 3APMA 3ABLB 2GY5A 3QO0B 4Z7VE 4GRLD 4YGHA 1OCOB 3V9FA 1QAWA 5F6ZA 3GJFH 3VQMA 4DEPC 3QT2A 5DI8B 4YSPA 2LVCA 4DKEL 2GHWB 2HYSA 4KI5C 4JPVL 3RHWK 2X87A 4Z95H 4LL1A 3KE0A 3T1FA 1Q1JH 4Y9BA 1T4WA 1T2QH 5IRUA 1SPDA 4FEMA 1TQUA 1F4WL 4OZHF 3OB8A 4TKWA 5I0DA 1QQDA 2W65B 4HOMA 3AACA 5TQ2H 3FS9A 5FYJU 1U58B 4MZ3A 2MF6A 4G80B 1ZLWK 1R0UA 4MLSA 4FBVA 2G75A 3IDJA 4FJZA 4NJ9L 2YKLL 1OSYA 3RL2B 4F58L 5I17B 6PCYA 4INNA 3Q6FB 4UILH 5CHKA 3LQAC 4CBPA 1ZGLM 1ZS2A 2FJHB 3PPSA 4LASH 4NP4L 2RTKA 2GFBB 5LO7A 4NLJA 3DOIA 3IKKA 3MLXH 5LBSL 4DGVH 1NIFA 1S7QA 4LSVH 4MAUL 4PWFA 3F7QA 1P84K 1NAKL 3C6LB 1OM9A 3WEAA 2XETA 4CAGA 4JGNA 2WQ8A 4B9PA 2ITCB 3O4LD 1XGQB 1XIWD 3B2MA 5BZDA 3WNIA 3FCBA 4JZOB 2OSYA 1P6WA 1RZIB 1SXZA 3W1ZA 1GYAA 1SQ2N 5KBDA 4Y8DC 4U33A 3CZJA 3U46B 3D7PA 5J6HA 3F84A 4O4SA 1I53A 2XSTA 1N19A 1Y18A 2B5IB 2WWKT 3FCTA 3D2UD 3QQXA 4M5YL 2OFMX 1JRHH 4GW5B 2OM5A 3KH4A 2J71A 3PABB 2EVHA 2YPVL 4KI5D 1J86A 4MGXA 1HN1A 5E03A 1DL7L 2FQGA 3WOVA 4ZFGL 4AW4A 4YBQC 3PHOB 3BLGA 3PGCB 1LL1A 1M1XA 1RP8A 1LCWA 4GQ9L 5CJXC 1P4LA 5D7LD 4Y0SA 3ZT5A 2RTCB 8PAZA 3T77A 4EDXA 3WJJC 3OZ9L 1KT2A 5K9QI 3RVWC 1AVAA 3L4ZA 1U8LB 4UAHA 1H3XA 5IB4A 2F7RA 3BKML 5CM1A 4ZZKA 3HC2A 2GEEA 2VAAA 3BJ91 3D4YA 1INDH 5B1JA 3UEZA 2R56L 4L05A 4PVNA 4J2QA 4XMGA 1JZUA 4G43A 3L8QA 2OSWA 4AIOA 3U9UA 4XXWA 1AKJD 2R1WB 2DYRB 1B9ZA 4PJGE 3DURB 4P5KA 4EZJA 1BF2A 4XB3A 3HZ3A 4WWKB 4F57H 1JZ5A 1HZLA 3AREC 3X12A 2OMBA 2E6QA 4KI5E 1U8NB 4L9LA 2H3KA 2WQAA 2X2HA 3CBJB 3S96A 4GH7B 4MNGA 5IEHA 3QC5X 1PTZA 3RWCB 1DQJB 5FYLL 5CE4A 3PUUA 5TH2B 4UINL 1ZDQA 4ZW6A 1HCFX 5D7LE 1PCXA 3P3UA 1QOKA 4P4KC 4YC2B 4OGAC 2VUYA 4MA3A 3D52A 3OBAA 4JFDB 4LLAA 2XTJB 5A2AA 2X4SB 1ZHLB 3X3GL 1ZA3A 3MJ7B 1DSWA 3DHJA 3V0JA 1BZQK 5L7XL 2X34A 2R69L 3RVWD 5ADOH 2F7QA 5FYKL 3IFPB 3QSKB 1E5PA 4BX7B 3N85H 1GX9A 2W07B 2XY2A 4NQSA 4TLKA 1M6OB 5JZ7C 3FTVA 4YBUA 4ZSOB 4AEHH 1CDGA 1JN6A 3CQFA 4FCHA 1NGQL 3QEQA 4NNPH 5C6TL 1GOGA 2MTAA 1RUML 2PPFA 2VABB 4DTGH 2I5VO 3F5WA 4ABUA 4QO1B 2V2TB 1O9WA 1OAZH 1RHHA 2XBTA 3ARED 3L4UA 5DRWB 3KHQA 2AF5A 2QZ5A 3LDBC 1KT6A 4G7QB 3BP5A 4GAJH 2HKFH 1P7QB 4H5SA 3QK0A 3LSOA 4UT6A 3QRGL 5F70A 3IDXL 5D4HA 3ZGHA 3NP1A 4L1LA 1QW8A 4OD3H 3RBSA 1S3RA 1HSBB 2MPAH 1BYPA 3QJSB 3EBAA 3C78X 4WU7A 4P4KD 2V2WA 1KB9K 1WFJA 4OGAD 4ANXA 1IILE 4ZFZA 5CEZH 4QOKD 2IH8A 4Q89A 4X6DB 5T3ZL 5J1SC 1I1YA 4A60A 1E9PA 3WNMA 1K6QL 1EHLH 4OVUA 4ORGA 2CHWA 5I6MA 4OGQC 3UTSA 2ZXWB 4FNTA 3GSUA 2K70A 3QUZC 3KD4A 5JOFB 5JZ7D 4AENB 1Q38A 5IO6A 4AYFA 1JGIA 2ZAIA 3MPCA 1ZNGA 1OHQA 3OJDA 4JHVA 1QFOA 2CRYA 1N9MA 4LMQI 1ZLSH 3GM0A 4BIKA 2JJTC 2EIMB 2FWOA 1F02I 3T8VA 2AERT 5CP7B 4OJFL 4X7TA 4OZIB 3KVPA 3LZFH 1AO7D 3BH8B 5AW6B 1AZUA 4WGKA 4IJ3B 5JHDA 1QPXA 4I1NB 3U9PH 3CU1A 1COBA 2FQFA 2HFGL 1NLBL 1YNTA 3MV11 5EO1B 2OULB 1G1KA 1KPUA 1K8IA 4PJBF 1IEAA 1XMWA 4KQ3H 4QOKE 1T1YA 4X5XA 4RUUA 1VWPB 4P2OC 4XPFL 5CMAB 4ZD3H 3P4LA 3QUMA 3JUYA 3V4PL 5LNGA 5FFGA 1DSFL 3CZGA 4U7MA 5DUML 3EFOA 5KYXB 2PPEA 3C5SA 5E2UH 1A66A 4P5RA 1EGJH 5KVEH 4ATWA 4FXLA 3NJMA 3AQDA 4M7KH 4J2XA 3INOA 3AS0A 2FHLA 2P26A 2GAZB 2XWJB 3HG4A 5DVKA 3W0WD 4HK0B 5JW3H 3NA4A 4KMTH 2ESVB 1W15A 2L8AA 5EIQA 1C16A 3QUZD 3UERA 4ODTL 3MR9B 2ZKMX 3O4LA 2AXJA 1GGTA 2Y0SA 3QR2A 2E7DA 3TO4B 4OZGF 3CNKA 2D7TL 4G1EB 3AB0C 1UYWL 3V4PB 2PR9A 2EUXA 1W0YT 1W2KT 2AMGA 2NP1A 5L0QB 2V6HA 3EZ8A 2A9ML 2L0DA 3QCUH 1R9FA 3CHXA 2LTQB 4JO5A 4PB0L 4WEBL 4Y5VA 5A2BA 1MXGA 1PCSA 2LVEA 4G8FB 1VWKB 3FDCA 1REIA 2BP3A 4BZ1H 4BD4A 4HVBA 4M8QB 3ZU8A 1JZFA 3GSNL 3SLJA 4PWGA 3PAZA 2OXGB 1N8OE 1OPGH 4RBPH 1LKEA 3EG9B 4ZHCA 4OD2A 2R51A 4B0MM 4P2OD 3KFHA 5L3YA 1WGVA 3QHZH 3SY0B 5CEYA 4KXCA 3W0WE 4GETA 5KJ7E 3UTZB 3K6DA 2OXHA 2VQ1B 3UH8A 4A7SA 3TNMA 4QQ1A 3VU2A 2AK1H 3NSXA 3GSNB 1SXYA 4H2CA 4CMMA 4IOIB 1E0OB 1DDHA 4PJCB 3QO1A 1X5AA 5K9KA 1PEZA 5TJWK 2UZXA 1FNLA 1DZ0A 1IAIH 3V6FB 1QHPA 4RWYH 1QYGH 3AW5A 3ZW0A 3CAFA 1UH2A 4PGBB 5I8EB 3TA4D 1CBIA 1J0HA 2GG1A 4HEPG 3ZKNC 4D0CB 3Q2WA 4PGEA 2ZCKL 1I9IL 4WU5A 4TLSA 2Z4IA 3V4UL 5EBLA 4OLZL 2FBOJ 4FEIA 3NABH 3HCVA 4BSVB 3KLQA 4DKAA 1SJEA 4XCCL 3ZE2F 5B39A 2JCWA 1A47A 2HLAA 2DIBA 4AVHA 4N2HA 1NDMB 1CBJA 5ANHA 3OXSB 2ATPB 3VG0H 5A7EA 3T2NL 1I8MB 3TYFA 1B56A 3SKNB 3P4OA 5CD3A 3N1QC 5MEQB 4G72B 4AYMC 3EFFA 3WS3B 5C0JB 4GLRI 4QHNA 4D7BA 4YDMA 4FQQA 1K3BA 2CM9A 3RY1A 3TA3C 4HKJB 1GGIL 5DGRA 4AC2A 5F9JA 5AVSB 3T8XA 15C8H 4BJ8A 2O4EA 1KBPA 3FSZA 1BFVL 4QXGH 3ARFC 1FYTD 5D71L 5I30L 4WI8A 5E9DD 2OMTA 5E2TH 5A6LA 1BOGA 3C5ZB 3CVHL 1Q1PA 2ADFL 2CE6A 3GIVA 1KY6A 2NY7H 5EIVA 5HPOA 4WEUD 3EH4B 3HAEA 5F6IC 3RDOA 3CZFB 2NT0A 5AFAA 2EKSA 1S7XB 3VRLE 1J5IA 1L5GB 4IB8A 1FG2A 3MFFB 3OAWA 5I1CH 4X5WB 3V5KA 4AUYA 3ZKND 3TWCH 3P0VL 4NQXA 5F1KC 4F37K 3FTXA 5KSBF 1R3KB 1DJZA 2OMWB 3JZYA 3WD5L 2FX7H 1KCRH 4BXSV 1A6WL 1A9BA 3BP6A 1QY1A 4M6OH 5CUSL 1OCRB 4YE4L 5DRZB 1R75A 3RGVA 3QORC 3VXMD 2FWVA 2F53B 3CVHB 3QA3A 4I87A 4OELA 4L8CA 3RY4A 3DJ9A 2BK8A 4QGYA 2DQTH 3NIDB 1RUQL 3EXLA 3E7JA 4U4BA 3TV3H 3AABA 1VWEB 3FQYA 4O58H 4DF9A 1FYTE 4GG6E 3UJIH 2C1PB 5E9DE 3TA3D 1EFXD 2FTBA 2GHZA 1VWIB 1RIVL 1IM9D 2R0KH 3UTOA 3ZLQC 3FUJA 4IRSA 4NRXA 4GRJA 1LWJA 3EGXA 3MRQB 4G59C 5E9NA 5DVPA 3TC9A 3VFVA 3ARFD 1KWGA 2NR6C 1MCDA 1EQWA 2OZ4L 2J8OA 2KKQA 4E9VA 1I7UB 3WXQA 3QZNA 4ON1A 1AGCA 4I5BB 1A22B 3OB0H 4U2YA 1D3SA 3PWNB 4S1DC 1D3CA 2OLDA 4MDIB 4OI8A 3QDJE 4TULL 5F97E 1ZS8A 5E94A 2HX7A 4U4IA 4XPGL 3RE6A 5DJ6B 5C0AB 4LCCA 5DWPA 5SWZA 3ASWA 3DXAE 4NOFA 4UV7H 3VXME 2ROXA 1Y1DA 3D25A 1I8IB 1JYJA 5K67A 3QVAA 4I88A 2FKJA 1SDDB 3SKMB 4A6YA 2GB2A 1PQZA 3L9RB 1SLGB 5FA3B 3SYQA 1VACA 1EQDA 3C2AH 2B15A 3CN0A 2Q3XA 1L6MA 3QORD 4OM0L 2CQVA 3QJFB 1DVQA 2R4SH 3NSFA 3LZNA 2OSXA 3NFNA 1RZ8A 4U1IB 4V1DD 4XAWL 2AVGA 2PWFA 2GIYA 2Z8SA 4JKPL 5DJXB 1ROCA 5D4QA 3GINA 1H3VA 1A4KB 1BIIB 5DQJA 5FO2A 3VW3L 4TN9A 2AJUL 1TDQA 4L1DA 2OW6A 2GKIA 5TPWL 4JDTH 4LVOC 1UWXK 3B2PA 4Q74A 3SPIA 1KBGH 3GO1L 4KKQA 4ELKB 1JWSB 4V33A 1IMHC 2IGFH 4MYPA 2DWYA 3ZQWA 2UYWA 2NR6D 1CD0A 4XPBL 2NW2A 1R1CA 1Z9NA 4XCNA 1SWFA 1ZHKA 4ORUA 4NPYB 1DVUA 1ECZA 3ISWA 4PRBB 4PRPD 4S1DD 1BVKA 2X38A 3MLVH 4NQVB 1JXGA 2R2EB 3E9TA 4PJXE 4PLJC 5EO0B 4XGZB 3ZIMA 1NMCC 1SJXA 4HAKA 2E9WA 2XV2A 4J8RB 4RH4A 2X8TA 1KCWA 1I1FB 2H32H 1TIUA 4HKXB 3B6SA 4I3DA 5KG9A 4TUOA 1TYEB 1SJHB 4KJYA 2C4IA 1MVUB 2K4WA 1BECA 2YMXL 2H4EA 4V1DE 3MLUH 2WXLA 1S7RA 3SCMA 2VM9A 2J1KA 2UWEE 4MBOA 3HI1A 3CG8A 4PJHB 1F90L 1TNMA 3O3AA 4JO3L 4RQQA 3L3KA 4OAWA 5EZIH 1N5YL 1DCLA 4PD4J 5I6KA 1F3DH 4C4BA 1A3LH 2APSA 1BOYA 5DVNA 4JAMA 2Y25A 3G04A 1G5AA 1U8CB 2QR0A 5AVTB 4A1RA 3MRJB 2BNQA 4MDJA 2ZAGA 1QHOA 4P06A 2GJ6B 2BVQB 4J3XA 4LQZA 2QCBA 1CFVH 2PCPA 3VB9A 4ELMB 1NGPH 5GS3A 1XR9A 1JD9A 1KB5L 1MAML 2DMHA 1MVFA 3CZNA 4NXKA 2FS7A 4N1HB 2DRUA 2QTVA 1HL5A 3MGTB 4OCSH 1KYAA 3SE9H 2VDPH 1MG2C 4N4YB 1SMOA 1YEHH 3RNQA 3SB3A 3ZN6A 4Z18A 4PLJD 4LPYA 1A65A 1VEPA 2NUPB 2Y06H 1QFUL 3C6LC 2XVKA 1WS8A 2EDNA 4PCKA 2PY1A 2WPUA 4AYSA 4WTQA 1KSRA 3OXRA 3GSRB 5DHDA 3NACH 1UXLA 5JA9A 4A67A 2YAPA 3DA0A 4X8JB 5DJCA 2HUHA 2QFPA 1IL1A 1UG9A 4P5MA 2DBJA 1KB5B 4M00A 3CBKB 2K9FB 6FABH 1RI8A 2APBA 4QHMA 4NZUH 1C8QA 1U91A 5EIIB 1XV8A 3Q3GA 4DZBA 3EUDA 1IGCH 4IBTA 3HNSL 5CGMA 3APWA 2DLGA 4NRYA 4MLIA 1L9MA 3KPQB 4XXCC 3QIWB 1WBZB 4OV5B 4F80A 4Z5RA 4CADA 3RY6C 4HMDA 4NQDA 1N6UA 5BVJB 1CRBA 4DVRL 3JWDL 1LO0L 4X6CB 4N6RA 2RR3A 2AP2A 3K1KC 2H26A 5DS8B 3VDBA 2DQEL 1E4HA 1ETB1 3NIGF 1KENH 1A6AB 3JQOB 1OARL 3RJOA 1T83A 2NY1B 4H88H 1I82A 4HS6B 1L9SA 3A6BL 2BCMA 1Y6NR 1T0VA 3H4HA 3WFBH 1VWHB 5ENWA 3V2AR 2A5UA 4FQ1L 3RIAK 5HYJB 4MZ2A 4FFZA 4P2RA 4JCMA 3VHHA 2FL5A 3B1UA 3US0A 2FEEL 5DMKA 1J05A 3C6LD 1QEXA 5EO9B 1OKEA 4FHJA 5DZNA 4Q9CA 4QRRB 3GWJA 3MYZA 4BQ9A 4WWKC 3SE3A 1XXDC 2E27L 1IKFL 2HVKB 1JYWA 1PZAA 1HHHB 2C1OB 2BRRL 4IRZL 2IZKA 1SA8A 2YZ8A 3P3RA 3PS6A 4HETA 4JFZL 3WV0A 4GZVA 1YEGL 3FPXA 2BLFA 2HKHH 2Z8VC 4HHAA 5J11B 1HH9B 4IOFD 4Z0BL 5GGRB 4LHUG 4W1TA 5E4EB 4YC2C 3UMNA 1DSYA 4HIIB 3EM0A 1JPFA 5IIEA 3PIQA 2B39A 4UTAL 3GSOA 2XTJC 5IVXA 3QNXA 1AD0B 3WFCL 3PQUA 1RSUB 4FFWC 5AQ0A 3RIFF 1JF6A 3HZMB 2OMUB 4WFFE 1N0XL 1OSPL 1MRFL 3FO9A 4MD0A 2CDFA 2Q7AA 4J6RH 4C4UA 4MMZA 4GJTB 1WAAA 3OKEB 3RKPA 1ORSB 1PF3A 2XOTA 4XOBA 3AT8A 3QQ9C 4H0GA 2RFXB 2OYBO 3O3BB 5AVXB 1FL6A 4DKFH 1CBRA 3U7AA 3H53A 4M6MH 1LCVA 3GZQA 2N56A 4L4TA 4BK8A 5I1AA 3CMPA 2N59A 2VH5H 4ARHA 5EBMB 2R2BA 2LU3A 1SXCA 4FXKA 4N90D 3FB7A 1I7ZA 4WWKD 3DYPA 4TKBA 3V8UA 1HVXA 1GGLA 1MJ8H 3MXWH 4NM4L 3K1DA 3P3YA 4YGGA 5AW8B 5CIPH 5FLUA 5IK3B 3U2JA 1PKQB 3BZDA 2EDXA 3V79C 3RU8H 3D9AL 1SOXA 4H0IA 4ADJA 3T4AB 1D5BB 1RIHL 2WWKO 5I16B 3HNTH 3HRZA 4MMYA 5HZ8A 4KKZA 4ZMNA 2E9BA 4ZQKA 5DSCA 4ZNEA 5C0DB 4JDEA 1YN7A 4M29A 2AJZA 3STMX 5JORB 4JFDD 1LGVA 2XTJD 3GHEH 4FFWD 3IJYB 3BUIA 4R7LA 3GGWA 5I8CA 2XICA 1SWRA 3V7AG 5LG1A 4LKXB 4ZTPL 1TENA 3EF7A 3FW6A 3BXNA 3L3IA 2R74A 2ZXEB 2WSJA 3QQ9D 5FYLD 1OBQA 2ENPA 4XP1L 1NOFA 1JGDA 2XYBA 3KEDA 5DD3H 1EPBA 1YEIL 2ZKXA 3FTSA 4NNYA 4WENB 4PI0A 4RDQF 3S26A 2Q9SA 5LCVH 3WLBB 1JPSH 2DQMA 5BNXD 2BLGA 1CICD 1UREA 4K23H 4QXUL 1A0QL 2W9LA 4XI5C 4A2DA 1XH1A 3WFZA 3QFJB 2A9BA 3M7FB 3UAQA 2A4ZA 1IAOA 3HMWL 2XQYK 3PXJA 4IJ3C 5E7BA 5JIKA 5FYKD 3VXOA 5KYUB 4O2FA 2VXQA 5JNYB 4JFDE 2G78A 2XTJE 4TPRH 1NGLA 2XN2A 5E51A 5FKAB 1I9RH 3A47A 2P28B 4JANA 4PWIA 2EXYC 2WBJA 3E38A 2DWDA 4HEME 1HEHC 3QPQC 5TDNB 4ERSH 3G6AB 1ECYA 1U36A 4L18A 3K6SB 1SY6L 2PPDA 1OAXH 4Z2OA 3NH7H 3EHBB 4Z7QB 5FYLE 3MBWA 3BUDA 4AMWA 1R3JA 5C3LD 4YSUA 4XPAH 3UABA 2WLIB 4M1DH 4COTA 3WXVH 2X8FA 5FECB 2EDKA 4P05A 1HOCA 1NGZA 3EO9H 2BSBA 3QQ3A 4BV1A 3TO4C 5DZPA 1F4AA 4KVCH 3QRBA 43C9B 1EIBA 2B14A 2PTTB 3ZTJH 4MKTA 5L0QC 2VQTA 5D4JA 2HLEB 1I8LA 5I0WA 1WF5A 5FYKE 5F1OB 2MNJB 4R5TA 5D9SB 4LSTL 2I60L 1L4IA 3HOLA 1Q9OA 4HC1H 4RMQA 4K9EH 5KVFH 1QFTA 1IGJB 3KJ4B 1NCDH 4NBXB 5JIDA 5EZOL 3II1A 4X6DE 2DWTA 2ZXQA 4X4YA 3OAUH 2M2DA 3CFEB 3VG9B 5IEKA 3IAGC 1XB8A 2EXYD 2CLZB 3QUHA 4RAUB 2G5BA 2VN6A 1LIFA 4JG0H 3QPQD 1G5GA 1QA9B 3NIFB 1A6PA 4ALBA 4UT7H 2JCCA 2XRAH 3ECBB 4EN3A 5CGTA 5TDOA 4LDCA 2E5EA 3GRBA 4ZO8A 3HUJF 2YUXA 3RX5A 1V27A 2OL3H 3ZZSA 2XG5B 2DQHL 5C86A 2V17H 3L1FA 2WEXA 4YDKH 2ESVD 5F9DC 3DO4A 4HSCX 4N8CL 2HZRA 2B0SH 5T3ZE 2XZZA 3PDGA 2RD0A 1FZJA 4UQ2B 3TO4D 1ZEAH 4P59L 5GZOC 4LCVA 3U2SB 3UDWC 4OZIE 3P3SA 5FC9A 3B2KA 4LSDA 3I6SA 3BPCA 3MHZA 1VFBB 5E8EB 2VZUA 3T6ZA 1MCWM 1PLCA 1FFNA 1OT4A 3HTLX 2AQ1A 4MA1B 3B2IA 5JR1L 3FUKA 4O4UA 3T3PB 2BWDA 4MBRA 4PJDF 1RFDL 1FGNL 1NSNL 2WWNA 4S1QL 1ZVNA 4U1JA 1S8DB 4JRXB 5DFVC 1H9DA 4MQ7B 2D4FA 3BW9A 1YYLL 4WW2B 4F8OA 2XTSA 2X40A 4GKZB 4YHIB 3U4AA 2I9TA 5EU3B 3RPIB 3CSGA 4LO9A 4PN6A 1BVNP 4NGHL 1AMXA 5GGUA 3LH9A 4J3OF 2ESVE 5C07B 3QISA 4B9FA 3VGWA 5DO2C 3LNDA 1A4BA 1JV2B 2QDVA 3C5ZC 4JFWA 1PG7L 2X46A 4OTXL 4X6BB 1NBZA 2X1OA 5AVYB 3O3DB 4EIZC 2W60B 2WLNA 2VLJA 4XNYL 3ETTA 2ENJA 4UDTB 3WIHL 4BE6A 2BVOA 4MAYA 1MCRA 3TEZA 5HDRA 1TW4A 2IIJA 3WLWC 5GZOD 3ELAT 2WD0A 1XCTA 5D1QA 2VLMD 2J6EL 3AT9A 5DG4A 4WV1B 4E9WA 5CKGA 4YFDB 4OSUL 1RZFH 4CC0A 1N4XH 3BAIA 3PDOA 4KUZL 4NQEA 5HGDB 1IFHL 3VFOB 4CNIB 1QR1B 4PJ9C 3H3PH 3DSNB 4BCSA 3F00A 3ZDZB 2Y7OA 3F7KA 3DK2A 5FK9A 2DMKA 4M9PA 3V5DB 4IBUA 1NFDA 3GXTA 4K7FA 2AJYL 2IGLA 4KUCD 4LSQH 5DFVD 3BP7B 3P9LB 1KLGB 5E2VH 2AK4E 5GGSB 4ZYKB 4CC4A 3N1FC 1CR9H 2FGWH 4KK9C 1IC4H 4PGCB 2X3AA 2JMBA 1TLKA 3N1MC 1TZ8A 3M86A 2O5ZL 2NCEA 4PJCE 2LFGA 3ATFA 1B88A 3D0VA 4QKXB 3MBXH 4BRJA 2F54A 4BX5B 1ZIAA 2CHZA 3NZHH 1TOXA 2V5SA 3QJQB 4H1LG 5DO2D 1ACZA 4ANKA 3BUBA 4OT1H 5IJKC 3C5ZD 5CJOH 2HWZL 3IJ8A 4M4RA 2MCPL 1F11A 1MCOL 3H56A 4ZUSA 2VE6B 2VLME 3BO8A 3VFRA 1BZ7A 3G5ZA 2MMXA 1FVDA 2UY7A 5FENA 3APVA 1N64L 2P80D 3KPPB 5MEPA 1KXOA 1MWOA 3DLQR 5F1EA 3WLWD 4OIBA 3I02A 5IKCA 2YARA 5KOMC 4JY5H 1QD0A 3WKYA 3QNZA 3B83A 5HHMB 3GDBA 2BVTA 3LQAH 1R5VA 3BKCH 3PK2A 2WIMA 1TJXA 3ZW1B 4ZUTA 5FWQA 1BCIA 4PJ9D 1I85A 1NCNA 2WANA 3OR7A 2KLSA 2C9SA 2F53D 1XZ0B 3L1OL 5DEFA 4LKCA 3SOBL 4X9GA 3V6ZA 1KBKA 5DJDB 1ET8A 1WZMA 1YN6B 3KPNB 3BEVB 2X3BA 1HXLA 4PD4K 4XVSH 3UZVB 4IGBB 1IE4A 4Q6IA 4CPHA 3LN4A 1G5WA 2QVIA 4HXAL 4KK9D 3LHNA 1FIGH 4Y7MA 3BP4A 1B0RB 1D7FA 3I2CH 1A7RH 2CM5A 4ZPVB 5FM4A 4BX6A 4DNEA 5DEJA 4ZOBA 2VMFA 3WAJA 5M7QA 5DUPH 5JYMA 3DBSA 2W9EL 4Z0XA 5TQ0L 2GIMA 4KO5A 4PJ5B 3WDHA 1HI6B 1NBYA 3W5NA 1S3KL 4MWFA 4ZMPA 1M6UA 2Z7ZA 3FB8B 5T3XL 3N41B 3MRNB 1KTBA 2Q86A 2F58L 5IHZB 5TE7H 3S2CA 4XPTL 4XWOC 5C0AD 4RETB 2ZUVA 2AQ2A 2F53E 5DC9B 1PD1A 1BVLA 1L9RA 2IV8A 3GK8L 3GSXB 5D6CA 4D8OA 2LU7A 3NIDE 2AEIT 1JNLH 2BSED 5T1LD 3AG3B 3TVMA 1KJMA 4WCYL 4XMFA 3ZQXA 2PLTA 3BQVA 2EUWA 4EI5A 2OL6O 1YAZA 4L2LA 3NFPA 2AXGB 3BKJH 4GAFB 5DU7A 3QUXA 3D69A 3VNZA 4XT1C 4B5ZA 1LP9A 3DX3A 3EO1A 4CVZA 1WEJL 5HHXH 1C5DA 3QUKA 2VISA 2V7NA 2B2XH 1UQSA 4NZ8A 2X4UA 1C5BL 5J06A 1G9NL 1B3IA 1H8OA 2EACA 3EDJA 3SQBB 3UBGA 4LMQE 5DD1L 2E9GA 4G7RB 4D3CH 4AITA 1CXLA 2WZ6A 3VGFA 2F8IA 3VXPA 4AQ1A 1DFXA 4KNTA 4MA7L 3K6OA 1RBPA 5C0AE 3ZT7A 3P73A 4GIAA 1HILB 2UUDH 3N44B 4Y4FB 3RWDB 2AJ3A 4JFEA 4HFOA 2NQ3A 1T0OA 1E67A 1OP5H 5AZ2L 1EFQA 3EYSH 4ZQTA 4Y4HB 5E7FA 1CN4A 2R29H 4UM9A 1HL8A 4XWOD 1MLCA 2Q3AA 3HE6C 1T5XA 4TQHA 1GT3A 1KIPA 1QP1A 3ZYOA 4PR5B 5GHWL 1QABA 2P45B 4KZCA 1WSST 4G82A 3FPYA 1M42A 4LLUA 3WHXB 3MROA 4A68A 3L3GB 2I32A 4GKSA 2QQLH 4NCDA 3H2PA 3EO0A 3SO3B 2JB6B 1Q0XH 3BIKB 5F7EH 3FQWB 4TLTA 4N8VB 3D18A 5F9WB 3FQ4A 1NCWH 1T89A 1S9KC 2V2XA 2VR5A 4ZT1A 4I3RL 2VM4A 1M9SA 4JQVC 4YIQA 1V5JA 5CSZB 4E5XB 2GJ6D 4XB7A 1EAQA 3OR6B 3ROOB 3VGHA 4FADA 4MYWB 2NY1C 1O75A 1SXNA 4AZ8A 1QY2A 4UQ3B 1FORL 4W4OC 3IFOA 1TTRA 2D3JA 3L9YA 1ML0A 2J4WH 4OCWH 1AY1L 4LSSL 5IUSA 3ARGD 2P43B 5IB1A 1CIUA 1KLFA 5EU7C 2IZJA 3L7FA 4PV9B 5HVGB 5T33H 1I3RB 3JWDC 2XI9A 2R23B 1CJYA 2DTMH 2ZOLB 3MNVB 4O9HL 4OJCA 2W5PA 1E4XL 4PJHE 2OQJB 1LO5A 4GMTL 3ESPA 4LLVA 3HE6D 1FLRL 3HRPA 5AQ6A 4LVHB 5DMJB 1FBIL 1DLFH 3MOAL 2X4PB 2Q20A 2J21A 5EEZA 4OFQA 3HMXL 4TLUA 4ORYA 3DVIA 3MRRA 5BRZA 4ONFL 4QTIH 3PPTA 5F89A 4D9QE 1M05B 4ZTEA 5J11C 1BYOA 5KICA 1FNFA 1MRCL 2DF3A 5EG6C 1KXHA 5E4EC 4BA8A 4ELME 2HFFB 5CO1A 2B3RA 5AG8A 2D4DA 4EUPH 4JHQA 4I2XA 4O02A 3W82A 2G9HB 2GH7A 3ZTJG 3CCHA 2NY1D 2A83B 3AG1B 2YEZA 1YPZF 2BDNL 3OG6B 4HKBA 1DBMH 1OL0A 5C08B 2BIQA 3PHSA 2UXGA 3TZVA 1H15B 4NDMA 4N2EA 1MW3A 3F58L 1X6NA 1ML7A 3AS3A 4UTBL 2CGRL 2BP0B 4YHMH 3FT9A 2Z1PA 3OKNA 1LNUA 3L16A 5FGBA 1OAJA 4BQ8A 4XPHL 1P6PA 4MJ5A 4B41A 2QEJA 4QRRD 4OCNC 3WL9B 5ICUA 4JFSA 4NFCA 1M57B 3R1GH 1BQLH 1A1NA 4ZUUB 2YRLA 5B7FA 1EXHA 3RWJB 4GT0A 3BGMB 2X4OB 1U3HB 1XSKA 1CIDA 4X6CE 3OHXA 4YH0A 1LFOA 2EIZA 2E8YA 3T4AC 3PDFA 5B29A 1YCSA 2RGSA 2BXZA 3L95A 4M8RA 1UZ8A 4NEHB 3LH2L 3VXUA 4IRJA 4HIHB 5ID1B 1BXUA 1RMFH 3PY9A 4PG9A 5BV7H 4NPKA 4QPEA 5TFSL 2EADA 2ZX9A 2B4CL 3QDMB 2FJFB 2I9LB 3P6EA 1QTPA 4KNQA 1N70A 3S97C 5JHLL 4BCXA 1E8ZA 5EU7E 4LSRL 1LDPL 3I9GH 4WI6A 1OSPO 1SLUA 4XVUC 1QACA 2BC3A 3TXAA 1WBYA 3F64A 4QRRE 4ZHDA 3LS5H 5ERWA 3UYRH 4XNUL 2Q2PA 1QSEA 2CKNA 1PDKA 4NO0B 3SGJC 3ZSSA 1Y0LA 5M95B 4HDIB 3QRLA 1RJZB 3VI4F 2FJUB 5LJDA 5FCUH 3QQ4A 2EYSA 4PY7A 3RA7H 3MUHL 1KZWA 3OAYK 4FFYL 5D7IB 3K5RA 1CE6A 1XF4A 3G6DL 3UPRB 1AR2A 4DO5A 4OH2A 4E9LA 1MOEA 1EVTC 2CK2A 2J8UA 1UD8A 2ITFA 2OP4H 4XMLH 1F4XL 3HWGA 1E28B 2RTGB 1IGTA 5D2LA 4KMLB 1UEYA 3VG4A 2YJQA 1B6DA 4FL4B 5BMFL 1JI1A 4GY4A 2XFXB 4Z7UB 4YHOH 1VWQB 3EHBC 4YHLL 2X4MA 1BQRA 1UWFA 3KPOA 3T2QA 1BSYA 1BJ8A 1O5DT 1DBAL 2FJGB 2X88A 4F8PA 4OCRL 1FCCA 2P49B 1FLTX 2GTWA 1N59A 1ZGLA 4NKOB 4LEOA 4O5LL 2O1AA 4N3UA 4XVUD 4OV5A 2UZYA 1J8HD 4E68A 5E8PB 3MVFA 4YDJA 2RTAA 1M71A 4DGUA 1BJ1H 1G7JB 2J57A 1FRGL 4K3EH 3LKPA 1PKQE 2IH3A 4AUJA 3EJUA 3MJ8A 1M7DB 1JV5A 2QVTA 2EVJA 5DXWA 7PCYA 3OPUA 5C0NC 1LUQA 3D50A 4KXBA 3A6CH 5B3JF 5GS1A 2VRKA 4X6FA 2NW3B 2FSEA 1K4DB 4G6FB 3KJ4C 5BO1L 3RB7A 5LAPA 4J7RA 4F3FA 1ADWA 2IPTL 5I2IA 2EDWA 4P9HL 4HIQA 3VG9C 3RDSA 1DQKA 3KYMB 1NPUA 3ORJA 4HWBA 5DHVH 1TQWA 3FONA 3MBEB 3RWHA 2OL7A 1XL6A 1KJVB 3BVDB 3EHBD 4WI0A 1W0WA 1BZDA 1V3KA 2J88L 2XXGA 4MJ6A 1TJIL 3RTQA 4DKTA 4ZJ0A 3K71B 4M3JA 1TTFA 2CIIA 2NTFB 2KHAA 1MFEH 2XKUA 2F6AA 1I1AA 3K2IA 4N0RA 2QOSC 1VZHA 2KLTA 4TUJB 4ORSA 2HJKB 4CILA 2ZNWA 4ZXBA 3QFJE 3DX7B 4QWWC 1W6FA 5CLWA 1FNGB 5T1MB 1SF3A 3R18A 5C09A 3T65A 4O3XB 4OMWA 4M62H 2MCAA 3UTTE 5CD5C 5EZJB 4DCQA 2BNRA 4NUJA 3S9DB 3WKMH 3WN5A 4E9RA 5C0ND 2LLGA 1AKPA 4CPIA 5B39G 1HHJB 1T7VA 1U8QB 2IXQB 4KK8C 3EBWA 1MFVA 1B3JA 4JM2C 4QYAA 1FFPA 1QVOB 4GQZA 2OJZL 4TSCL 5E2WH 4WW2C 1E6OL 1WFMA 3A4EA 4Z7QE 1E5ZA 5D8JH 1DZKA 4HH9B 4GAAA 4CDFA 3F8UB 1AGFB 1I3GL 1LO4L 2BCKA 2QPFA 4JB9H 3Q34A 3KXFB 2BY3A 2HFEA 4PJFA 4WNQB 2ITDB 3VRIA 3HZKB 3GI8L 1QBMH 3NZ8B 1XH3A 4YXLH 1CZ8L 3U7WH 1V3MA 2WLLB 2WN3A 2I5YL 3BD5A 4JFPA 3IJEA 4PVBA 4Q14A 1P5UA 3ARWA 5DZVA 5L4MA 3LQZA 4YDVA 2DJSA 1BLRA 2NY5L 2CJSA 5CGYC 1A6UL 1SYSA 2LFOA 4QWWD 5ETUB 1BXAA 1T5WA 5EOCH 5D7JB 4FFVC 3B3BA 4WW1B 4WV1C 1D9KA 4IS6A 1FZKA 4MS6A 3DX6B 3F65A 5CD5D 4C8XA 3CIAA 1KCSL 3G08A 2HT4D 2GSIB 4J4PA 3QUYB 1LO2H 2OZQA 4KK8D 4JM2D 2WLHA 1NJ9A 4JRXD 3NIFE 4P9MH 4XO5A 4QMEA 1R0AH 1T2XA 1LO3H 4QYOA 2A77H 1SUJA 2UY6B 2JKXA 1VADB 1XCXA 2VIRA 3DVFA 3HS0B 2X6CA 1QLRB 3PL6B 4IMLA 1UM5H 3RWFA 1HBPA 3ISYA 4H25A 1Z9SA 4L8DA 4RFOL 5BZXA 5JYLA 2WJ7A 1OEZW 5C07D 3RWGB 4DP6X 3DV4B 3WJLA 4GD9A 1UM6H 1J5OL 5HHOB 3IXTB 3OZKA 1A6TA 5IO7A 3ECVA 1GAFH 5IQ7L 3ZR6A 3FL7A 1VZIA 4PRAB 3CVDA 3V10A 1BA9A 4XCEB 3B9VA 4JFQA 5J5EA 1G6RL 3UYPB 3RZCA 2OCJA 2VC2H 1TYJA 1EJOH 4WVRA 3O2YA 3LS4L 2E7HA 3P77A 4KAQL 1ES0A 5CGYD 3RE0A 4EBQH 3T3PE 5GRUL 4RGOL 4WSJA 3JTSB 1NCHA 4FFVD 1M7XA 3QZMA 3FT4A 4MXVF 4PWHA 4RAHA 3AY4C 1XF2B 3P9MB 4JRXE 4OKAA 2OX5A 5H2BB 4NJAL 5KIDA 1RHFA 4JPVH 2DQCL 2ILLA 4HPOL 2IANB 3WUZA 1GRWA 4UT9L 4N2BA 4P57B 1G0XA 3STLA 1SRFA 1G6RB 1F4WH 4QJ3B 4TL4A 1KXTA 1UJ3A 3EUUA 1PZBA 3GQFA 1H5BC 3F04A 4IGBC 4MS8D 4J1UA 5C07E 1CVSC 1YY9D 2YKLH 1O8VA 3P3TA 4NJ9H 1J9SA 1MOYA 3QHTC 2XG4B 5SX5K 1A1OB 4IBYA 3V4VA 4NP4H 2IMMA 3MRBB 3IETB 5KSVB 2FHFA 2P7TA 4JKMA 3MG5A 1WZ1H 1PLAA 5LBSH 4GQPH 5BXFA 3BE1L 4MAUH 4P5SA 4YO0A 1BLNA 1NAKH 3MV01 4LRNL 3ZRFC 4KOBA 2WC7A 5LJKA 4JE0A 1FN4B 4LPVA 3S88L 4XN5A 1PS3A 3II2A 1HHIB 4B95C 4BCYA 1XCAA 5HBSA 1I31A 2A8GA 3DRTB 5F9OL 4I9WD 3ZDZE 4HOXA 4UOQA 1QI4A 5HHMD 4M5TA 1X5IA 4M5YH 4EUPG 1S78C 1YNKL 3JV6B 1GGYA 2YPVH 2C3VA 1S9YA 2H2PC 2N7BA 5GISL 1DL7H 1EX0A 3MV7D 3EOAA 4DP1X 2ZP0T 4ZFGH 2Y7QA 2A9DA 5HDBB 4PP1C 1JNJA 3EDKA 4I3GA 3KR3L 4JMNA 4GQ9H 3INUH 1ADQH 3GRWL 4IGBD 2VM3A 3CQRA 5A2IH 5AUMA 2LFEA 1UXSB 2WSKA 5HHVL 2VDRL 3ZQ9A 3V6BR 2JN3A 3NUKA 1FENA 2RQ0A 3BKMH 3DVNA 1TZIA 3OWEA 1IAMA 2MIZA 3PGDA 2OVAA 3PWVA 2R56H 2E7LA 4RX4A 5DUJA 3GMMB 1W5RA 1JZ2A 2HN7A 1KDIA 4PJ5D 3C8DA 2YD5A 4I9WE 4Y4FC 3K8LA 5E00A 4L0ZA 4U1NA 4HGKC 5HHME 3OVUB 2Z1KA 3TWYA 1K85A 4GO8A 1B4MA 1X5LA 2VQ4A 4Y4HC 3GXUB 5HHPA 2VDRB 3L4WA 3QI9A 4OCYL 4QRQB 1NC4A 1NOAA 4N9GB 4FQCL 1IC5L 3KLSA 1F6AA 1FTPA 5FYLH 3IU3A 4PJGA 3BS2A 2E46A 1VRSA 1XR8A 4UINH 1CG9A 3OD9A 2ADGA 4EQ3A 4R96B 2H2PD 2JTDA 2X1WL 4NNXB 2JF1A 1M2VA 4OIFA 4OM1L 3O0RL 3SO3C 3NSCA 4PP1D 1X9QA 1D5XB 2R0ZL 3BMVA 3O3UN 2LBAA 2XZAL 4ZFQA 4DUVA 1B0IA 3DBXB 2M4LA 5F9WC 3FQRB 4JR9L 2P44B 3I75B 4NYRA 5IB5A 4NUGH 4OF6A 3TFBA 5L7XH 4Q52A 5FYKH 4PJ5E 1S7WB 1RJLA 2VW7A 2Z7WA 2E0PA 3IJSB 1MUJA 3P11L 5EA0H 2G2NA 3TBYB 3TO2B 3WO3B 1PYWB 4XVJL 3CDZA 1NGQH 5JLZA 5C6TH 3OJ2C 1UOVA 5I18L 5JMOC 3ASNB 1JWUA 2BS5A 4Y4FD 5AKSA 1RUMH 3WY2A 5KSAA 3K4ZA 2AT0X 5FR3A 3SGKA 1KN4H 4Y4HD 4GAYA 3HPJB 5CJBA 3X11B 1URIA 3RPKA 4DP5X 1QUNA 2I5ZO 4BDVA 2VXTL 2YFNA 3ATAA 1CXKA 2EIBA 3QRGH 1KPVA 1KIQB 2Q76B 4PBWD 3VRJA 4TTGA 1JGEA 3HKFA 1SDYA 3OGOE 3D3VB 2RTMA 4X8CA 5T3XE 2AC0A 4GUOA 1VGKB 2IC2A 5BCAA 1FG9C 2DJMA 2FK9A 2WUCL 4PYHA 3IT8D 4ELDA 3BAJA 3A67H 3MUGB 4FCAA 5EZLB 5IBTL 5SWQB 1SRGA 1PKOA 2H6PA 5T3ZH 4JUTA 3ZMNA 4F27A 1U8KB 3QW9A 3ULAB 1GCFA 2P52A 4OIIL 1K6QH 4EEEA 3K3LA 3FOLB 1XWVA 4UCFA 3N6YA 3STKA 3UC2A 2ZUQB 2QKSA 1A8ZA 2ZSWB 1DE4B 4URTB 2CIKB 3VFPA 2DLFL 4IB7A 1GGCL 1DUYB 1FL3A 4ZX6A 1DFBL 4AQ8A 5LAXB 3IXAA 3KS0H 2FNWA 3BDRA 1KCVL 1UH4A 2D7NA 1SY2A 2X45A 3RDJA 3G6JB 4WTZA 1ZWIB 43CAB 4BXVA 4DP4X 5GS0L 1CLOL 3CC5A 1OGAB 3G9AB 3QIUB 4OJFH 5A6MA 5EU6B 3RURA 1G7MB 3DHPA 1G9EA 2C9QA 4ISVA 1NLBH 1KFFA 4JRFA 4JNJA 1K8DB 1EJ6A 4BZ2L 1ND0A 2CRIA 4PY8I 3MRGA 4XPFH 1XGYL 4AK1A 1XCQA 1RLWA 1U3HC 3V4PH 4BGFA 2O93L 3NSDA 4HUUA 5KTEH 4YHPA 1DSFH 1IAKA 3PWJB 4MSWB 4J3UA 1BZ8A 2AEWA 4IIQB 3SPVB 5IMKA 3LXBA 4BK5A 1UXMA 3US1A 2BY2A 2FR3A 1OW0C 4LCIL 5D5MF 1KELL 2VR7A 2W0FB 1SWTA 1KCUL 5I73B 3DROA 4KHTL 2WCGA 1SEQL 4PJEF 1CT8B 4R7VA 1VA9A 4ODTH 1JCKA 4AI7A 5CF3A 1HAUA 1P7KB 2VWEC 3NN8A 1MHCB 1RY7B 1UYWH 3EDEA 4LLYB 3RVUC 5C08D 1GTFA 1T1WA 3UP1A 2H45A 1KEML 4H8VA 3KWTA 2A9MH 1VYGA 1NIBA 4X5QA 4ALAL 4PB0H 2CG9X 4A04A 3N55A 2E86A 4JS7A 3V0HA 4EVNB 2FR4A 3ARYA 3QG6B 3SZIA 4Z8FH 1II4E 1YEJL 2NUTB 3UEQA 1PW3A 3SD5A 2AFNA 1WFUA 4A7GF 3GSNH 2B4CC 3DO7A 3FUNA 4Q7DA 1F4YL 3WYQA 5F7DB 1UD5A 2VLLB 5HCCC 5BOJA 1IUZA 4JG5A 1HEJC 1JHTA 4EOWH 2Q2EB 4HIPA 3BKYL 4PS4H 1U3HD 2H9GA 2BSSB 2C3WA 2P8PA 4YVUA 1W91A 1SXSA 2Y2TA 3X1NA 4NM8L 5MENA 1MPAL 3D85A 3OKYA 3D30A 4G8IA 4CPEA 4GB9A 4I3SL 1AGDA 3WNNA 4XO4A 3LQMA 4YPGA 4FL4C 2ZOUA 3RUGA 2H1XA 2P5WA 3GS4A 4GNWA 4MD5B 4V11A 2AXFB 1GCYA 3I84A 3QDMD 4N0YL 3AAZA 3R8BB 4Z78B 4UIMB 1MHEB 4QNIA 3JT0A 4JQXA 4LLMB 4WJKB 4NRZB 3RVUD 5IW6A 1WWBX 2GTZB 3PYCA 5F96L 3EJPA 3T6WA 2ZCKH 1I9IH 3V4UH 3GBML 2EP6A 4LB8A 4OLZH 5GGTL 1SYVB 4X2UA 5DJ0A 4I9XA 4XCCH 4APQD 5AVUB 4F2MB 5CBEA 1AZNA 5H9NA 5IFHH 1AR1B 1A9EB 1OE3A 4NO0D 5SWSD 4DPCX 2CMRL 1F8TH 2GITB 1I7TB 2BC4A 1FSKB 1N8ZB 1VFAB 3IGAB 3VFNB 3KGTA 4CU7A 2ZXCA 4NZTH 4DERA 4YSQA 2NDGA 3ULVD 1JZ8A 1PBOA 4ZH6A 5HZQA 3BAEL 1F2QA 4XVOA 5AOMA 1QTYT 1GGIH 1EEUA 3OV6A 3KGUA 1OAKL 1AHMA 2HLFC 4H40A 2AV1A 4CMHC 4EZMA 1V7ML 2NNCA 3QDME 1BFVH 1B0OA 4P5TC 2UZPA 5D71H 5I30H 1OZUA 5HGHA 3WFDL 2FR2A 2VWEE 5MERB 2Y22A 4KT5A 4HZ1A 4L4VB 4LBAA 4ZK8A 4G8AC 2HA1A 3CVHH 2V8LA 2A73A 1ZNKA 1KGJA 4H26A 4PU2A 5AD0A 1A8JH 1KIRB 1DO6A 4PRIB 4HPBA 4M9OA 1SHMA 4WI4A 1KGCD 2DD8L 3SAOA 4YSCA 2MKLC 3FYIB 4JY6A 4JDVA 5DJZA 7TAAA 1PJWA 1ETA1 1JTOA 12E8L 4GJSA 5LGYA 3WTUA 5FA4B 4DP7X 4XMZA 3WD5H 3WELA 5C2UB 1PLGL 2YQBA 3UG4A 1ACDA 1A6WH 1MLBB 1NIEA 2J72A 5D7IE 2C9VA 2YD6A 3DHUA 5CUSH 5CYBA 4YE4H 5IMLA 3BZEA 4OLVL 5ABAA 5CFHA 2Y3NA 3IRPX 4E36A 1XL4A 3UBXA 5I1DB 4WIQA 2DYPB 2IPUK 4GG8A 4Y2DA 4LPXA 2EE0A 3NVQA 2HKDA 1RUQH 1J9RA 1R5WA 2QPUA 3F7VA 5GZNA 4BZYA 1KGUA 1NQBA 1TXLA 3BAXA 4WKZB 1Q1JL 3AQYA 1Q0YL 2GJZA 2WOBA 4U3HA 3B34A 4YVNA 4YPJA 4MJJA 4G6FD 3OKKB 1RIVH 3AKMA 2HLFD 1VLXA 4Z7UE 3AU0A 3H2QA 2QPEB 1U8PA 1QSFA 1PZ5A 1K4CB 4P5TD 2Q6WB 4NKMA 1KGCE 1EXUA 2OTUA 2OZ4H 3MX0B 4Y0GA 5HYQB 4DETA 1IQDB 5IV2A 4U1MA 3K8MA 1FL5A 4UILL 2EDYA 2NNXA 4GKOA 2VW4A 4AIZB 1JZ3A 2LLLA 5AJBA 2G4EA 4LHQB 4E9TA 5F3HA 3BT0A 1YNLL 4E41A 4TULH 3MLXL 1B4RA 4Z76B 4LSVL 2EDMA 3LIZA 3SGDH 2Y6SC 4IBVA 3HWFA 2J6WA 1QI3A 3TEUA 4F7EB 4B96A 3FTGA 2AT5X 1T21A 4LL4A 2SEBB 3P40A 4RVBA 5CR1A 2EKJA 4KMQA 1JSYA 1ICNA 2YAFA 4FG6C 1WV7T 4UQIM 4Y2NA 4S2SB 4PRHA 3QDJA 5D7JC 2BSRB 3D5OF 1KGYE 3QWOA 4OM0H 5DD6A 1BGXH 5TDPA 1UWGL 2X4QB 1IW2A 4U6XA 5ICZA 5DS1A 2CWRA 2OJEB 4R0LB 3QXWA 2NSQA 3Q5TA 4JKPH 4IQHA 4PS7A 4KRMB 3QUYC 3QNYA 3WGUB 5B38A 3VW3H 5A1AA 2AJUH 2LOEA 4TF4A 5TPWH 1HQQA 3EBKA 1G4RA 4LNRA 1LQBC 2NY5C 3GO1H 3ILEA 4P2AA 3KDMB 3HS0C 1DYZA 5IF0A 2BS71 3N40P 1ZHBA 4ZMOA 3VH8A 2I07B 4XPBH 1DJWA 1KWKA 2CBMA 4JY4A 4LXFA 2FEJA 3KXFD 3BWZA 1CFTA 1DZBA 2VLRB 3UEUA 3REVA 4ZAKB 2DQFA 1LIBA 3ZUNC 3IDMB 3WYPA 5H9LA 3T3MB 1PAZA 1JGLL 4Z7IA 2WXKA 5JPNB 2Y6SD 1E90A 2A6DA 1OPOA 3AXHA 3KFFA 3LKQA 3PF2A 4KX8A 5EC1A 5L8LB 2YMXH 3MDJA 4FG6D 2FGSA 1A6ZB 5D7JD 5C0IA 3IFLL 4JO3H 3BD4A 3CFTA 2IG2L 4ZS7L 1H91A 1N5YH 3H2WA 3OF6D 5AZEL 3CWGA 3L3JA 3DI3B 1YWDA 2K23A 4L3EB 3QUYD 1WA0X 2ZONA 3EYFA 1GX8A 3LY6A 3FCSB 1OB1B 4L4JA 3KXFE 3WIFB 1KB5H 1MAMH 3S60A 4OJAA 5FHBH 3TT1L 1OY3B 1F3JB 3KPLA 4MB4A 4HWZA 4AT6B 3PP3H 4Z6JA 3SZ6A 5I1IL 4A8ZA 5TK4A 4G8EB 1SDAB 4NNPL 2H3NB 5HHOD 4AQEA 1T03L 1QFUH 1T1ZA 4O4YL 2NX5B 2W9DL 5JHMA 1MQ8A 3B7RL 4R5VA 2FSDA 1RSYA 3N5AA 4APQA 2IJ0C 1FFTB 4ODUB 1KQXA 2P24B 4D6BA 1D5ZA 3OQ3B 2V3EA 2R15A 3ZQ3A 4U1GC 4KH2A 4J5VA 3DX8B 3CPUA 5FWRA 4BQCA 1JBHA 3KQ0A 2HKFL 3D51A 2Z7UA 4XMUA 1GXAA 1E2VA 3HNSH 2FHCA 5F1SA 3BEWB 2WLKA 3HC0A 2J1WA 5ISZA 4OZFB 1T0NA 2DY2A 3AROA 2IAND 3WNOA 3MNZB 1AD9B 2WXGA 1UZ2X 4LCYA 4WGVB 3JWDH 1LO0H 2X2IA 3HFML 2DQEH 2NY0B 1U41A 3MRIB 2JIXA 1OARH 4YDIL 3X3FH 4YCHA 3EGSB 2CXGA 3D0LA 4P23B 2G2PA 1AVDA 3LKOA 3A6BH 5FUOL 3RAJL 3MXVL 1EHLL 1DJXA 5HHOE 2QGCA 1Z66A 4TNFA 4HFWA 5K39B 3ARBD 1XH2A 4GS7B 4FQ1H 4A7TA 1S7TB 4FTVB 4MCMA 4XCYA 1L7TH 3VX1A 1GZPB 5EUOF 2I25N 3VFTB 1QHQA 5DURD 3UO8B 1E9QB 3T4YA 3IK2A 2BPBA 2O30A 4MZRA 2B08A 1T0PB 3JV4B 2MQGA 1ZLWH 1VCBC 1UGNA 2PWEA 1IKFH 2JU8A 3GMPA 1U8IB 3LZFL 4EXKA 3VMOA 3O3EA 4IRZH 2BRRH 5ILTL 4F7MB 4JFZH 5HTDA 3N91A 1YEGH 3LXAA 1I7RA 5D48A 5J6GA 4FNLL 5LG6A 3DX9A 4Q9RL 4BWTA 4KQ3L 3FO2B 4ZD3L 3V5HA 3QRFM 3VACA 4Z0BH 4HHWA 4ZW8A 1AQBA 5INCA 2Z34A 4U1HA 1MIML 1LVEA 4AVJA 4WJG3 3X14B 1AZRA 1H8SA 3WFCH 2VXVH 1KTCA 3ENEA 2PYEB 5I76B 2GTLO 1L6PA 1CF8L 2RTFB 1N0XH 1MRFH 1OSPH 1FAKT 5L2JB 5L6YL 1WUNT 5K9QG 3VXSB 3KWWB 3JXAA 2AQRA 2YRBA 1DQQA 1G7NA 5HY9A 2M83A 5DCCA 4Y1AA 2YD3A 4MASA 3RL2A 4UOW0 3VHMA 1A6VL 1P69B 3CVIH 4ZS6C 3SE6A 1NC2A 1BXVA 3RL1A 5FM8A 2D0GA 1SMAA 3CGTA 3E3QC 4ODXB 1XF3A 3O6FA 4EQAC 2FLMA 1DJSA 4F7PB 3HR5A 3WU1A 3U4BL 1HQRA 1MCEA 1GS6X 3MRCB 4NM4H 4FG4A 4UOW1 2DQ6A 5HWZA 2FQDA 1RZIA 3SKUD 3C5JA 3FXIC 1KTJA 2BSCA 3WAKA 3T2XA 5HDBE 4ZHHA 3D9AH 3FFCA 4G1MA 1RIHH 4X9IA 3FF7A 5D2LF 1LE9B 2JQZA 4NN5C 3QHZL 4N2AA 4DK6A 1A25A 5G5DA 5T5FA 4XXDA 3GXPA 5GGRY 5DUBB 2EDHA 5J4MA 2LB6A 3IU4L 1UHVA 3RY6A 4A63A 4PBXA 5I26A 1EMTH 1TEYA 2AK1L 4PCTA 2F19H 2F1BA 1LIEA 2ZUQC 4ZTPH 3ZDYF 3EJSA 1OE2A 3CFKA 4JM0A 5HDWA 2BNUB 5EMYA 5F7MC 2WINA 3WS6A 3TBWB 1VPRA 4ZS6D 2HT3C 1T7YA 1YEIH 1FV1A 5DC0A 5F7WC 4OZ4B 2JKSA 2JMRA 3LCYA 5ALCH 3DX1A 3BLKA 1AQKL 3H6JA 2CR0A 4QXUH 1QNIA 2DQIL 1A0QH 5AVRB 3QIUC 1P1ZA 4OF3A 2R1WA 4DPBX 3U0WL 1JERA 1XKIA 2VLKB 4EFGA 4FXGB 4XNQB 1LD9B 1BBJB 3VVWA 2DIJA 2ED6A 2N1KA 2Z93B 5FXCH 1ZOXA 3VG0L 3LIUA 1U8NA 1VAHA 1VCAA 1JF1A 3DVGB 1SN5A 3ZMRA 4GH7A 1ZRYA 3ZUCA 3K91A 3D3VD 4X98A 3FUHA 1W72L 2MM3A 2ZXGA 3ZHLA 4JFYB 4BRVA 5IQMA 1RU9L 4YN3A 3T2OA 4AYDC 1CLZL 3JVGC 4CSTA 5GS0C 4IIQC 15C8L 4H8UA 4IMOA 5B27A 1ZMYA 2A6KA 2NY6C 3BSZL 2KPNA 2IZAA 3U36A 4I60A 1KF9B 5E8OB 3RDMA 3W3BA 4ZDHA 5KVDL 3E3QE 2VJ8A 1X5GA 3AADB 4IKLA 1SLXA 3M17B 3MYJA 4PB9H 1LK3L 2E4TA 3P4NA 3IFPA 3L5HA 2ENYA 1W72B 1NQNA 2W0LA 2HT3D 3WBDA 5I19L 1U0XA 1JJXA 1QLFB 1RH8A 3DSFL 2Y36H 3ELQA 4J3VA 3WJDA 4PJ7B 2G9KA 4GW1A 4NO2B 1ORQB 4NQQA 4TUKL 1USZA 5BRQA 5I24A 4UF7C 2GCYB 5HPMB 3ROLB 2YBRB 4KGJA 4AIEA 5EF1A 1OGAD 3L5WA 3QIUD 4LSTH 5EU6D 2I60H 1TJMA 4QHUB 3D3VE 3TN0B 1AZVA 4Z7WF 3MC0A 4QRTB 1ZA6B 1SM3L 5GPRA 3ZL2A 5BRPA 3ISRA 4I18B 2R69A 4L48A 3UPAA 3ZR5A 3O45A 4HCIA 1BZEA 1P7QA 1EEQA 4L37A 3MA9L 3IBEA 3LJ3A 4KX7A 1W8EA 4P3CL 4R26L 3KPSA 1W8NA 4NWTL 4BELD 2RTHB 5FKPA 4ALAC 1BAGA 1Q9KB 4KKNA 5T1KB 3ARBA 3DX4A 4ZO7A 3SDXB 5CN1A 4F1ZA 2BVYA 2WTRA 2NY6D 3CSYA 3BZFA 2Y2WA 3O8XD 2DQHH 4AG4L 2VZ3A 2V3FA 3RDXA 1MH5B 3MO1A 2RB8A 5AB1A 3V6OE 4KITB 4BINA 4N20A 4N8CH 2BOCA 3G6JE 3B5TA 4UV4L 4B3VA 1OGAE 2Q7YB 4P59H 3N43B 2VL5B 3F9DA 2V33A 2YD8A 5EU6E 4MNQB 3GI9L 3Q2NA 4O2CB 2OTWB 4WAFA 4UV7L 5C71A 5HD8C 3S35X 1JYVA 3UGXA 2GUYA 2WIIB 2AZUA 5E5RB 4PTUA 5FO9A 5GSVA 4LDLB 1UVQB 5AB9A 5JR1H 3D4RA 1AR1C 2AF2A 2YBGA 3TIEA 2Z8WC 1RFDH 3F7YA 5F0JB 1FGNH 1NSNH 4S1QH 1T22B 3FUFA 5JXAL 4PJ8B 2J8HA 4A37A 3HHMA 2XVBA 5I74B 4KZEL 4FBRA 1J48A 1YYLH 4U8UM 4MMXA 2YAOA 5CLYA 5IW1A 2H6UA 1DP0A 1TETL 4L1SA 4QCIB 1BBDL 5CMAA 3MUZ1 5J89A 4NGHH 4DN3L 4YDNA 4A2EA 5IB3A 2ENQA 5H8DA 3K2KA 1A4AA 2VSKB 1AHWB 4H20L 2XTLA 3APXA 2R2HA 4JRYA 4F8TA 3KLKA 5DQDL 4UANA 1PG7H 4OTXH 1CC3A 4N0CC 3TBSA 2HB0A 2ADJB 4HK3N 1IT9L 4XNYH 3WIHH 4DWHA 3IDIB 5IW3A 3RDTB 3UO1L 1VWJB 4W9LC 5EV7A 3MJ9L 1QW9A 2O5YL 5ESAA 4RMUA 1S46A 1NUFA 3FN3A 3BVNA 1SY1A 4JHAH 5HD8D 1FVEB 3IVKA 1KXVC 5AW4B 3UZEA 3QZWA 4OSUH 5SX4I 4KDVA 5C3IA 4KUZH 3QEGL 5EN2B 3DIFB 4UOZA 2DB8A 4D0BB 1AR1D 1QBLH 1SREA 4NO5B 4AOFA 3EADA 5E8NB 4Y8AA 4ZGUA 1W8OA 3IJHB 2AJYH 4Z7VF 5EIIG 2X32A 1IBGL 1E9OA 2NZ9C 2OYLA 3W9EA 2V5MA 3O11B 2APVA 2H32B 3FO0L 2Z31B 1Z9LA 5H8TA 1OVZA 2WZAA 4KKAC 2O5ZH 2WVVA 3S3PA 3BVVA 2XUWA 2X9YA 4OGXH 5I71B 2EIEA 1GZQB 4OJYA 3ARDA 1NAML 1GC1C 2AK4A 3K2UL 4L4VD 1E8XA 2ICWB 3K46A 2VQ1A 3S5YA 3T6XA 4BE5A 2Q1EA 4UQCA 2HWZH 4OCSL 1TVBA 2MCPH 1MCOH 2CHDA 3E3CA 2PI3O 1GGBL 4XTRC 4B7IA 2OJ1A 2GTLM 1N64H 2EYRA 1MI5B 4PRID 2CLRA 3HHRB 3ZZLA 4RGMB 4X4ME 2X05A 2V9RA