3P02A

Crystal structure of a protein of unknown function (bacova_00267) from bacteroides ovatus at 1.55 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
314
structure length
308
Chain Sequence
WTDEQFKQLISFKTQPGGWGVTDVHVRYANSAKYTYNLPVVSGTDDRLVSFSLRDDTLDILNFEKFGNRPELYFRELPQKYYSFPKELTIPAGQSHALLPIEFSLDGLDDSQKWALPLKVCEDNGTYAVNPRKYYRTAVLRPILFNEFSGRFSGSSLLGTMAGESDIKFSSTEIKLNVVTDSIVFFYAGQRTEDYEDRINYKVFLQFTGDKVDSKKDLYKMKIWAENEKLKFNSYSTPTYKVSSEMDATKTYLKHTYIVISDIDFDFVDYTSVPNYEIEYNMKGGLSVSRDLDTRKPDEDQGSDSKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a protein of unknown function (BACOVA_00267) from Bacteroides ovatus at 1.55 A resolution
rcsb
source organism Bacteroides ovatus
total genus 78
structure length 308
sequence length 314
ec nomenclature
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14274 DUF4361 Domain of unknown function (DUF4361)
A PF16343 DUF4973 Domain of unknown function (DUF4973)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.440 Mainly Beta Beta Barrel Lipocalin Lipocalin 3p02A02
2.60.40.1740 Mainly Beta Sandwich Immunoglobulin-like hypothetical protein (bacova_03559) 3p02A01
3SOTA 4QNIA 3NQKA 4DQAA 3POHA 3P02A 3N91A
chains in the Genus database with same CATH superfamily
1WZMA 4QJ5B 3HFFA 1EO7A 1GCYA 1TTRA 1XCAA 4BK5C 1HINL 3M07A 4WEBL 2C5DC 2KS0A 4KXZI 4M6MH 5D2NA 3U1SH 3RE5A 3VI4F 4U1NB 3UERA 2XWCA 2O5ZL 5C71A 1A5FL 1TYEB 1NCAL 1PZUB 1JVLA 4P5TA 4P3DB 2BSSA 1GYUA 2Q39A 2MPAH 4GIAA 3SGJC 3ARBB 3NAAL 4DZBB 4DO4A 4NIYE 5C9KA 1NGZA 2M2DA 5IQOA 1BSOA 4APXA 2WEXA 4U3SA 4C56A 3TPKA 5GGRY 3PPTA 3A4DA 5IVOA 5JQ6H 3GUTB 1VWQB 2WWMD 4AGMA 3T8MA 5ICZB 1WLHA 1AP2B 2YA1A 2R1YB 4NXSA 4UU9B 2P48B 3ASOB 4UOJA 4LRIA 3UG3A 4N8VB 3NK3A 1Z66A 4HXAL 5FIEA 1MXGA 4WUUA 4AV5A 5DWPA 2KTDA 4QXGH 2YXVA 5G2NA 3TIEA 1MHEB 2YPKB 3ARBC 4KXCA 3VG4A 1LO3H 4PY8I 2A73B 5HDQH 1ET8A 3S36H 4BFBD 3ZE2B 3HTYA 1KY6A 3QG6B 5KS9E 1AMXA 4RMQA 3MA9H 4QAEA 2BSCA 4JPVL 1TEFA 2JF1A 3ECBB 2EDFA 2VZOA 3GHPA 3MREA 1BXVA 3MRRA 4FNPA 4HOXA 2GTWA 1T7ZA 2OX5B 3L2MA 1XAUA 2RTEB 3VXRD 4OI8A 3MX0B 2N01B 1SRGA 5IHUL 3EBAA 3HOLA 2XWEA 4Z7UB 2POAA 4OQTL 3U0PB 1KCUL 2IZFB 2CM5A 2QVTA 1E5AA 4YPJA 5E8PA 3DK0A 3VXMD 4DP1X 3QKGA 1NCDH 5E08L 1ND0A 3VD2A 4H7VA 3PWJA 4KKLC 4Y4KA 4MA3B 4O9SA 1QZNA 5I15H 3IA8A 4K19A 3ZO9A 5KSBE 3G6JA 2AJSH 4OM0H 1IM9A 4MAYD 3VI3B 5CEXA 5BRPA 1SLVA 2QR0A 3MLVL 2X41A 3LHAA 1Z0NA 3ILPB 4F7CB 4DZ8B 1P7HL 4LCIL 3F5WA 5C2UB 4N0UA 3L3HA 2RALA 4G6AC 4XX1G 2C9SA 4A1HA 1V3MA 5HGHA 3KYMA 5BQDA 1FTPA 1PLBA 4UQCA 5JQHC 2QPEB 1OY3B 1DVZA 1OCRB 1B8EA 2ZCZA 5G4MA 2UY6B 4ELME 3ELZA 1XIWB 3F7RA 2ACPX 4BHUA 1AGBA 2OAAA 2DMGA 4Z7VE 1UFUA 2AXGA 4L37A 5AEAA 1I1AA 2WLHA 4LCYA 3ZYIA 2WNGA 5I1CH 4XMPL 3STLB 2R1WB 5HHQA 3BRNA 3LXUX 4JUTA 1SY2A 5DYFA 4D94A 4BFFA 1FCGA 3LEVL 5KG9B 4A8ZA 5F7AA 5JHDA 3DJ9A 3LKRA 1JZGA 4V1DB 3FU3A 3OWEA 1NKRA 3U1QA 4MJIB 3VRLE 4W9LC 3QXVA 5DTFB 3LH8A 4J3UA 1YNTF 5DWUH 2VDKH 4ZW7A 4AZRA 1XIWC 1HI6A 3FZUD 1IC1A 1EK3A 5IHZA 2AJYH 4XODA 5HCEC 4R83A 4JFZH 4Z78B 4F93B 5DGQA 2RTRB 4NN5B 3DOHA 2ARJQ 2GY5A 1FIGL 2CKBB 3KPQA 1FE8L 1SVZA 3ATAA 4ZJ9A 3JV6B 3KW8A 3P0YH 3D1MC 5CMAA 3GQFA 4QWWD 3JVGC 2XG4A 3QYCA 4V2CB 3V4PA 3QDMA 4GSUA 4QRTB 3IETA 1R5WB 1FN4A 3MLWH 5FWRA 2AEWA 3BPNB 5GGVH 3GXTA 1FDQA 2WYHA 4X98B 5DD0L 2PKDA 3X12A 2EUVA 1TZGH 5TF1L 4LCUA 4YBQC 5T1KB 3V4VL 5LBSL 1INEL 2A99A 2BHFA 4AM0Q 3W0WA 3SKMA 4XB7A 4FBVA 1NTDA 2JKRM 1RCYA 3QI9B 3T0WA 2WAQA 3RBSA 4Y1AA 1KXTA 1MFUA 2YEVB 4QNPE 4KO9A 3NJIA 4HUKB 2C4XA 4DKFH 2HZQA 1DSFH 4PJGA 3PXLA 2Y1VA 3QDAA 1KWKA 1AD9B 3BWUC 2YPVL 3BVDB 3BPNC 1BD2B 4NLHA 4UYPA 2W2BA 5T3XH 4GNKB 5CIPH 2TSAA 1YMMA 4QYPA 2O5YL 1UB5B 3K8MA 2CA3A 3HK1A 3VNZA 1Z9OA 3OKDB 4X6CA 3ZVVA 4KKZA 4I48A 3N06B 1Y6NR 2EH8L 3QI9C 5D2NB 5JUEH 3EHBB 1VEPA 5HI4C 4Y9CA 1ZIAA 2JFCA 3CU7A 5LJEA 1NLDL 3L8QA 4B7IA 4QY8A 4KUZL 4GSDL 1U3HB 4OLXH 2CBMA 4OGXL 1TTBA 4UDUA 4A2FA 4J6RH 1U8HA 1U42A 4OCSL 1YNKL 3KM2A 4S1DD 1R6VA 1FH2A 2FJGA 3PHOB 3JYBA 3VSVA 2DDQH 3MODH 2BS9A 4NHUB 4MCYA 5INDB 1ERXA 4APXB 4KFMA 3ZZ1A 1AQBA 1QY0A 2CKBL 1PKOA 4YHKL 1Q0EA 3EFDH 4KJPD 4P2OD 1F0LA 2FT6A 2GCYB 5ESAB 4TULH 3BZEA 2O61B 2CBPA 1ZY9A 2ADYA 1A7OL 3IJ7A 4AENA 3WKYA 4JO4L 5D2NC 3TT3H 3EHBC 3F65A 3LRKA 2VDRB 3TWCL 3W11D 1U3HC 2RN4A 1FJ1A 5T3ZD 4YOKA 1E4HA 1R0AL 2HN7A 4ZPVA 3TIEB 3NFSH 5DO2C 3VFNA 3THML 2WBJA 4G6KH 2MTPA 1T0VA 3WY2A 4NI3A 1N6VA 2A2UA 1RK0B 1JXDA 1JZ2A 3QUZD 3MRBB 1GOGA 3ZR6A 1XO8A 3DARA 4JHQA 2OR8A 2KZWA 5DR5L 3MREB 3TZVD 3KVDD 3UTQB 4XPHL 2Q8AH 3U46B 2GTWB 4L8CA 4B97A 1K2DB 4Z7WA 5KVFE 1PFOA 3WOVA 4KK5D 5AW0B 2XVBA 2XZCL 1MVYA 3NJJA 4JFED 3SKNB 3O4LB 3I75A 5E8PB 4QRFA 2BDNL 3BX7C 4P9ML 4A7SA 1DQJB 2EDEA 1ND0B 4NUJB 3GMPA 3X1BA 4Y4KB 5EZIH 2XN2A 3NBNA 3F6JA 4WFED 2KDYA 5KSAC 1R5VA 3U4AA 1EZVX 1JGIA 1FBIH 4PSQA 4OBRA 1Y1DA 2DV6A 4IBYA 3T77B 3BY0A 1PG7X 3QRLA 1CIDA 4HS8H 3D4ZA 4A60A 4HHWA 3MRNB 2BP3A 1AKJD 2OP4L 4EKXA 5FO9A 1A1NA 4GMSH 5DHVH 1QA9A 3MZTA 3L1OL 1B4TA 1A1MB 3SDCA 1OD7A 3RTQB 2ZSVA 3POHA 4B9PA 3F00A 1CBSA 5DQJA 3QRGL 5HHXH 5T5FH 4QCIB 2BO0A 2HT3D 3F7YB 4AEIL 2FX7H 1BJ7A 2K1MA 4G7YH 3HC2A 3GBLA 3I3DA 1AJ7L 4Y4KC 2IJ0C 1GKAB 2HP4A 1CFVH 1MG2C 1NCBH 4PV8B 5H37G 1F1DA 1ZTXH 1ZNHA 3BRGC 4AG4H 4KXDA 2NW2A 3O3BA 3NH7L 4XPFH 4GKCA 1VPOL 2AXGB 4L37B 3PHQA 1N4XL 2CLRB 2WZ0A 3GPSA 4H8PA 3N41B 2BVOA 4L8DA 4N0CD 5CWSB 3CSFA 1INDL 3RL2B 2HZRA 2A1WH 3RTQC 3GFUA 2D7OA 2WCGA 1O9VA 2WLLB 5DZOA 3CH1A 1XH1A 4HEPG 8PAZA 4NLJA 3UEWA 2BFGA 4NDMB 2Z3FA 3HUJF 4HKJB 3D0AA 2NT1A 4I87A 4PS8A 5BO1H 1SWAA 4QXGL 2A38A 2ARWA 3WJCA 2IFBA 2E6QA 4NZRH 4E9YA 1HI6B 5L8NA 1FO0H 1U3YA 5DZ9A 2YLHA 3EH5B 3D52A 3LNGA 5HDQL 2MQ0A 4FJZA 1NBZA 1EXUA 1U0QA 4WEUD 5C0AB 3SE3A 4JKKA 3W39A 3I74A 5D1ZI 3HC4H 3ZMEA 1YY9C 1G1CA 4PJIF 3ZTJH 3MO1B 2VDKB 3QJUB 1PY0A 4IAXA 1UWXK 3WTSA 4XBGB 5FCSH 2XG4B 1ZEAH 3QDMB 3HBZA 3WNIA 3IETB 1BOYA 2UY7B 2R0WH 1FN4B 1A4JA 4MD5A 4OZHE 1NCDL 5BRZE 1S7SA 5HD8C 2G0KA 2CM4A 2LLNA 3U4BH 3ELXA 3X12B 5I15L 2OPCA 2AJSL 5DC2A 5HJBA 1LNUB 1THCA 2YD0A 4LPVA 1MUPA 2D0HA 1FFOA 1Z6JT 2NTSP 5DLML 2OZ4H 2DTSA 2ILLA 3D0VB 3QXDB 4FXTA 5KSBA 1V27A 4ZOCA 4R8WH 1G7JB 5CJXC 2W2AA 2A9NL 3FFCB 3RPBA 5C0JB 3CWKA 3WLBB 2WBWB 4YSOA 1TEYA 4JLRB 4WFFD 5EU4A 5DRXB 3VTTA 2Z91B 1AXIB 2TAAA 1PD6A 2AERT 4PGDA 1XGYL 4BE5A 5FM5O 1BECA 2DJSA 4X8CA 3JS1A 3VFRA 1ZT7B 3K80A 5GIRA 4QHLB 4X6CB 1KBKA 3FKUS 4JM2D 1O1VA 2AJUH 2GG1A 2P7TA 4J4PD 3VFTB 4L3ED 4I48B 1FVEB 3HN5A 2AL0X 5LDUA 4K2UH 1QFWL 3T1DA 1OEZW 4PJEF 5FAAA 4WTXA 5I1CL 2ZONA 4UDUB 4YCHA 4ELMA 4FMVA 2DM5A 4OGZA 1ECYA 5I16B 4GBXB 4WY7H 2OY7A 3LNHA 4Z7VA 3M1OA 3CFKA 2FJGB 1BSQA 2GBUA 3TN0D 5HCDC 1AS6A 4NT6A 5FA3A 5I0WA 3U7WL 4PLOB 3US9A 3ARGC 1WQVT 3BVVA 4AQAA 3BZEB 4YWGH 2K70A 2VDKL 3H1ZA 2VZ1A 2VT0A 4ZODA 3ARFB 3EO9H 3KM1A 4AENB 3P69A 2AJYL 3D0LA 3ZDYB 2QVFB 3T71A 4JFZL 4NBXB 4IRZH 3D2UD 4K23L 5PCYA 2BLFA 4HH8A 4AIEA 5DUPL 1XTLA 4GBXC 1PEZA 3OZLA 1LE5B 1D6VH 4BCYA 1QMUA 3LS4H 3QULB 2WBJB 4XC1H 1RP9A 2EIDA 5HBSA 2X4OA 3V7AG 4LVNB 2L4OA 2HX8A 4YHZH 4K3EH 4Z0BH 2ZKYA 2HNXA 4U0RB 3GXIA 2R2BA 3MLWL 3QP3A 5FGSA 1J7VR 3ARFC 1TKWA 4O3XB 2ADJB 3IVKA 3PDDA 3GK8H 4PM1A 4IEFA 3V5KB 4Z7WB 1GH7A 3NIGB 4B5EA 3FYFA 4FFZH 5IT2L 1RXKA 2J6EH 1OAKH 3RAJH 4FQBB 1H3PH 4AIXA 2Z92B 2WQ8A 5DJZA 3B2VL 2YD8A 2GBAA 2WBJC 1M2OA 4OTXL 1KT5A 2Z4QB 4XB8A 2XBDA 4LEOB 3WE6A 4LVNC 1TO4A 3FUJA 2VN7A 3VFPA 1DSFL 3MUZ1 3PAZA 1BG9A 1TVBA 1R5VB 4HS3A 2JKLA 2X38A 4U0RC 3RL1A 5IBUB 1J9QA 4OLVH 1JDCA 4QOKB 1NAMH 5F3HB 5ETUA 3NPOA 3SPVB 4NFCA 1V5JA 1QNZH 1QA9B 3HC0B 4LMQE 1K5WA 2BZCA 1R75A 1SFHA 5CLXA 5TK2A 5IGXL 2ZSVB 1QABE 3QWNA 4E5XG 3WLWC 3BQUA 3SE6A 1SHXA 2QQNL 1N0LB 3GJFB 4Z7OE 4HCRH 4NO0D 5E6RB 4J6RL 2D4DA 1W80A 2ZOLB 1A9VA 4E9RA 4GAFB 2F53E 4AVIA 1L6ZA 4XXCA 3U82B 2Z7YA 2NW2B 1XGZA 1WFIA 3U83A 3O3BB 3BKMH 1U18A 3RU8H 4C4KO 3BE1H 4F9PA 1CFTA 2P8PA 4TNVK 3CD4A 4W81A 1YP6A 1S3RA 2C1PB 3DX9A 2YAEA 3VD1A 2EH7H 1OGTA 3RZWA 5I1AB 1G9MC 4FQLL 1CE6A 5DMIL 1EAJA 5T1MA 1RZJH 5F89B 4QEGA 3H6JA 3RGVD 2DM7A 2FGWL 4W9EC 1OXYA 3AWFA 4ONHA 2QSQA 4FG6C 2XQYG 1MRDH 5J5EA 2WAHA 3GS4A 4CPHA 5A2IH 8CGTA 3WJFA 1DUYB 4LHUD 2CO4A 2J8HA 2YD5A 3S88L 1BWWA 1NBZB 1VACB 3W39B 1MM9A 3TPUA 3NABL 4LEEA 3VA6A 1IJ8A 2WGXA 4TVPD 4CMHB 3ABLB 4ZHCA 3C8KA 4XVTH 5MEQA 3ETBJ 3LH9A 4IB7A 2G9HB 1XH3B 3T0BA 3BDBA 4S1RH 5FXCH 5IJKA 3UTTE 4DJMA 2IH3B 4JHVA 3DX7B 4XXWA 2E47A 1QSEB 4YE4L 1RAMA 1E5UI 1DVTA 5FO7A 4BX5B 2OL8O 3MUUA 4IS6A 1G9ML 1UOWA 5EZIL 4RSVA 1CB4A 1QG5A 1FBIL 2Y5EA 1DLHA 4S0TD 4CMHC 4YLCA 1FFOB 1E6OL 4HS8L 4JR9L 1YUPA 1JF1B 3UPCA 5IY5B 2F2HA 2X55A 3BISA 4YDJA 4XNDA 5KSBB 2R9HD 4CPFA 4GMSL 5EDBA 4ZDHB 4PWKA 2OZQA 1FFTB 1RJCA 2AZAA 3ZDWA 1HESA 3MC0A 3H42H 3TEWA 5CD3A 2FX7L 4XMCA 4XP9H 5EU4B 3AG1B 1XGTA 2PXYA 4G7YL 1HL9A 4I18C 5HGDA 1T1WB 1MWAH 3D9WA 3T4AA 5KBDA 4PJXF 4NC1E 3VFRB 1TVDA 4ZFQA 2MHDA 1QW9A 1MJ8H 4ODVL 2GIYA 3BKYH 1KF9B 4DO5A 1GTFA 1GGYA 1PSKH 1G7QB 4XPFL 1S7WA 3LKQA 4NN6B 2P5EE 3HZMA 4PJ6A 1QTPA 1BQRA 5FAZA 2RACA 1RIVL 4NKOA 3QIBD 4GRWE 4DQAA 3LRMA 5I0DA 4ZS7H 5EOCJ 4XO4A 1T1XA 1VWRB 2Y9RT 4FQHA 1MEXL 4Z7VB 3T04D 2NX5D 1R9FA 1IGCL 2D0GA 4LVOB 3INUH 2BXZA 1DSYA 3N43B 3MRDA 3VFUA 1GT5A 4LLYB 2NR6A 3DOSA 4FA6A 2WC7A 3A6BH 1O6TA 4MTMA 4M6OL 3MRGB 2CUIA 1C08A 3VGDA 4PTTB 4AQAB 2R56A 3CSTA 2UZXA 1T3FA 3DX6A 3CDGB 3TJHC 5KYXB 3DROA 4NN6C 2CHNA 3ROOA 5E7BA 4UTAH 4N68A 4GW1A 4MQXC 4Y2OB 4ZOBA 3FHQA 4LLVB 1ACDA 1HAUA 3D6GA 4A2GA 4G83A 5CJQL 2WKLA 1EFXA 3O3UN 3KPSE 5F7HA 1IU1A 1KNOA 5EO1B 3Q1SH 4PG2A 4PW9A 1F90H 2LU5A 3C60B 3DXAD 2IXQA 3HS9A 3T0VA 1JVKA 3G08A 3QIUD 4UQ2B 1HCFX 4XMZA 1L9OA 3H0TA 4KGLA 1U8NB 4JJ5A 4DERA 1EXGA 1TLMA 3IVKB 1LP9B 1VENA 1U8IB 1E50A 3S5LB 1CGUA 3C2SA 2VC2H 2OXGA 3HB3D 4LKXA 4XT1C 2VLRD 3RGHA 4OZHA 2AS5M 5BRZA 5LGHL 4PRPB 1L0QA 4K9EC 4PRBA 3DRQA 1MNNA 2OZ4L 4PYGA 1YY8B 1JNHA 1ZV5A 3WI9A 2ZWLT 5J89A 3NCYS 3GRGA 4PLJC 3C60C 5I6MA 1A2YA 2IH9A 1OT2A 3MBXH 1TVBB 3QEQB 4HS3B 4TUOA 4J3SA 4NBZB 5HHOD 5LBSH 3K6SB 3ULUE 1SUHA 5JZ7D 3L4YA 4U05A 4YFRA 4ZS6C 5L9DH 1JF5A 2F5AH 4HIQA 5A2FA 1J9RA 4CGTA 1AQHA 2YZ8A 1KT7A 2VGLM 1WFJA 3G5YB 2XX0A 4PPTA 4X4XB 5BVPH 2WN2A 4JRYD 4AT6B 1WIOA 3MRQA 3JSQA 4N90E 3WEXA 4AQEB 3VVVA 1QNIA 5IJCC 1KEML 2H4EA 1XSKA 2ZWNA 2AAAA 2ZNWA 4GIPD 2X2IA 4WI0B 2MJIA 4MSWB 1A4CA 2O5XH 5AOMA 2CDFA 4K9EL 4FTVB 1KFFA 2P8PB 3DI3B 4B5ZA 1E4JA 4WWOA 1XGPA 4YWGL 4LSDA 1NANH 4OCRH 5EU5A 4LAQH 3NR3A 3ECQA 5AAPA 5C86A 5I6NA 5HA0A 3RDTA 5JW4Q 2G2PA 5LGKA 2E0PA 5AL8A 4HF5H 3RPKA 4BWUA 2ZUXA 3GMRA 1D6VL 3EH4B 1STSB 2EICA 4I5BA 3CUPA 3IKKA 5EF3A 4P46A 1U21A 4CPHB 2V7NB 3FR5A 2WJ7A 4NAMA 1AE6H 3A23A 4EUPH 4MQ7B 1RUPL 2ZP9A 4MXQC 3TPUB 2EIEA 4I3RH 1X5YA 3ABZA 2FWOB 1EUUA 4NO3B 3T0DA 3C8KB 5HHNB 5MEQB 1M57B 2OJ1A 1FRGH 3L13A 4ZH6A 3VWJD 4FFZL 1R3HB 2PCXA 2VDPB 3NCEB 4KT5A 1WIUA 1M6OA 4I1RA 4JZJA 4W9GC 3RAJL 1CLYL 2IDTA 5CN2A 3RDUA 4E0RB 4LSSL 4JDZA 2OMVA 3R1GH 2FO4B 5FO7B 4IS6B 2FX8L 2G7BA 4F3FA 4OFPA 2G9KA 1W72B 3VD3A 3IU4H 5CNHA 4WFGD 5DI8A 2HH0H 3EH1A 1DLHB 2AQQA 3HG1E 3AW5A 5MEOA 3ARQA 1IO4C 1FH5H 5EB9A 2V9RA 1WWCA 3GSXA 3JWOH 3MI6A 1EJ8A 3TXAA 5IJKC 3GSWA 3DHUA 3FT3A 4Y16D 5DQDH 3JWNC 5AKRA 1O5PA 5CD3B 3K8KA 3FULA 4YHYB 3PQYE 5L3YA 4R7NB 4FOMA 5AVUB 5HGDB 3Q1EA 1J0ZA 4HCRL 1C5DB 4L4TE 3T2OA 4B3EA 1NFKA 3RZCD 3DPBB 1IBYA 4P5MA 4PWEA 1KMGA 3RB5A 1ETZB 5E6UB 3SOBH 4DPBX 5C09E 3LKQB 3QXAB 3RU8L 2A4EA 2DQFA 3HN8A 4G1MA 4XNUH 3T6VA 2R69L 1A9BA 3ZSSA 4ERSH 2F53A 2R29H 5IROC 2AJ3B 3KXFD 4DUWA 1WUBA 1T1XB 4BZ2L 4X4YA 3KBPA 2FIKA 2KTSA 1SHMA 4YHYC 2J1XA 1S44A 2IGFH 5HDWA 3DOSB 1G85A 4F33B 1B4RA 1UD4A 4HP5A 2FHCA 3FTWA 5AOKA 3C5ZB 3UJTH 2WXPA 5C7XH 3RWIA 1RI8A 2ED9A 3NIDF 5CLYA 2YMXL 2VDPL 3M46A 3MRKA 5E8OA 4U1IA 4HJ0D 4QF1A 4DH2A 3BH8B 2EDQA 4GW1B 4HJGA 4K94C 4OB5H 2JJTA 2K8QA 1CF8H 2FWSA 3EYQC 3LZPA 5HHMD 5AAMA 1CXHA 5MENB 1I9EA 5GGTA 1OT4A 3ISWA 4A1RA 1W72L 1R19A 3X3FH 1I7RA 3UAJD 3GDCA 1G87A 3M7OA 4GKZB 3VHHA 1AGDA 1LEKA 3GMMB 2NR6C 1AQMA 1G74A 4W70A 1QR1A 1MJUH 1PY4A 2GTLM 1G7IA 3C5ZC 4OCWH 4O3ZA 5FGCE 3FC8A 5IKCA 3G08B 5EDXA 5B7EA 4XNYL 1PX8A 1ZRYA 3H0TB 4GKSB 3RHWF 1WFOA 5I5MA 2VMJA 1GKEA 4JJ5B 1OTSD 3UTTA 4EIUA 1QPPA 2FZ3A 2BFVL 5D7IB 1B0GB 5BRZB 3CZNA 1JGVH 2GQHA 2NXZB 1JNHB 4M7JH 1PAMA 4LLDA 2OSLA 1L7IH 2H0EA 2MIZA 1NIFA 1RPQA 1G6RH 2HJFB 1DDHB 4TUOB 5GZND 3CFEA 1NOFA 3VRIB 3MGTA 4G8AC 1EXHA 3OR6B 2OMXB 3KPOA 3OKOA 3FUKA 5C0CE 4U1KB 1IKNA 1D5BA 2KH2B 3UABA 4M7MA 1KTBA 2HX7A 2LW3A 1ICNA 4MWFA 3HZYB 4FQ2H 4NPYA 3BKYL 5B3JE 4FQCH 4TQIA 1HAWA 4PTUA 1B2YA 2NXZC 1OP5K 3C2AL 3ECVA 3H9HA 1IT9H 4G6JH 4XAWH 3P3UA 1FYHB 2VLMD 5HDBF 3HI1A 3LRLA 1QTYT 2BJMH 1NFDB 2EZ0C 2QSCH 5HXMA 2X4RB 4PVNA 3FQWA 4O58L 2PPAA 4NLIA 1KB5B 2CDFB 3A6BL 1GX8A 1SY0A 1MKFA 2C9XA 5ADOH 5D1ZD 3MV8D 4IABA 1NDGA 2H8PB 3B3BA 5IW1A 4ICXA 1SLWA 4LCWB 2BS71 3OSVA 5EG6C 1HYSC 2LAGB 3GI8L 2X9WA 3DRTA 5DD6A 4ZG1A 2IZCB 3H8NA 4JFPA 1HMSA 3NZHL 2QZQA 4O00A 5A16B 4DAGH 3CUPB 1TMQA 4P46B 3TIDB 4B9YA 2I69A 4TKHA 1V05A 3A0OA 3QCTH 4WU7B 3V8OA 1HJBC 3KPSA 3MR9A 4MNQE 2OF9A 1F58L 2D73A 4RAHA 5EU6E 5F1OB 3ZL2A 5J0BA 3MLSH 5HYFA 4HEME 4PJAF 1DEEB 3IDJA 4ZXBD 3O3EB 3NCJH 3KDMB 2IWEA 2WCPA 4H8UA 2OCFD 3PGDB 5E9DE 4N8UA 4GEJA 2JWYA 3LQZB 4JCMA 5IQNA 4FXGA 3HBQA 4P46C 1FDLH 3KJ6L 3OZ9H 3ALXA 4PJ5D 5JLZB 1GTNA 3ZSTA 1L7TL 5KSVA 5ABDE 2ZX5A 5CE4A 3MBXL 4G9FD 3GSNA 5EC2B 5DI8B 3T3PF 3X17A 2Y6SC 1LO0H 1KC5H 2OTUB 5MEOB 3B2MA 1J5HA 2DKMA 3KCPB 4FS0A 1ONQA 5KVEE 4R4BB 3IXTB 3EYUH 2I7OA 4LEXL 3QWOA 2F5AL 2VXVL 3T0AA 4GUPB 4WEMB 2L67A 3RDXA 5SV4A 3TFBA 3GSWB 1OIOA 3DV4A 3GMNA 1CI5A 2M1KA 5DS1A 3HE6D 1OEEA 4FQ1L 5CGYD 1KB5L 2N93A 3RVTD 4YH6A 3WZQA 5BVPL 5FKPB 3HBGA 1KJ2A 1TUPA 4H88H 1J05B 2RTFB 1A7QH 4GRLD 4Z95H 1WD8A 2I25N 4R0LA 2AGJH 1TJHH 4ODTH 4P5MB 4GD9A 3QG7H 3CC5A 5I6LA 5E8DH 3EBKA 1G9NH 4Z7OB 4PH8A 2J55A 2DQFB 1N0SA 4Y5VA 4O49A 1J8KA 3VXUA 1PZ2A 4WJ5A 4IGBD 3Q5OA 2K3HA 4CC4A 4FFWD 4H0GA 4JL2A 1PZCA 4HWZA 4YSSA 1BQHB 3EDEA 4FULA 1ZDQA 3TBSA 4TUJB 1J8RA 2FIKB 3UP6A 4X4YB 3KGUA 4XOCA 3AWGA 4XNZB 5CSZB 1RJZB 5AQ0A 1L5GB 3AT8A 4MMXA 3IMTA 4NCDA 3RIAK 1Y52X 2KZ1B 4U3CA 5D1QB 1P84J 4NNXA 1AE6L 4PJCE 1EIOA 4IQHA 1VGEH 4P07A 3ZTCC 2V8LA 1BHGA 3C8DA 5HJGA 1AD0B 2HLAA 1JXJA 2BOCA 5FK9A 4Z3EA 5AB0A 1AGDB 1LEKB 1GX3A 3O6KL 1QR1B 4U1MB 5HZ6A 1R4XA 4XNZC 1GT4A 2OSXA 5JOPE 3H9SB 1GC1H 3QPXH 5D1QC 3VYOA 4M4RB 4QXTA 4IBTA 3T3ME 5I6PA 3PWPD 3UTTB 4G8FB 1CK0H 3IU4L 2RTGB 2FTAA 2HH0L 5L8JB 5AAMC 3KPNA 2Y6TE 3UMTA 1GT3A 4A7UA 3CFCH 2UXFA 1BM3H 3GO1H 4KFZC 2OSLB 1FLTX 1A4AA 4OZFG 5EN2A 5G4NA 4PRIB 3X3GH 5DQDL 2EO1A 3BLBA 3HG1A 4NQCB 1THAA 2MTAA 4Y19E 2HRLA 5GRVK 4OI7A 3MGTB 3KPOB 3E3QC 3OKOB 4N1CA 1JGLH 3D4RA 4N8PA 4P5KA 4A2EA 3BKJL 1D5BB 3DGGA 1ZS8A 1YEHL 4JO1H 4KI5C 3HAEA 1OALA 3D3VB 1T5KA 1OPBA 3EO0B 4M7LH 3N42F 9PCYA 3PQYA 2EXWD 1PLCA 1F4YH 3BOVA 3BVNA 1AVAA 4PTUB 3H9HB 5D7SH 3EFOA 3UMNA 2DQEL 5FYKD 4C83A 1LO4H 4XMTA 4ERSL 1F00I 1SJEA 1A14H 3NRQA 3MVSA 5AYUL 1B2WL 2EDDA 1HXYB 4W68A 5HHVL 5C09A 4ETQA 5DCCA 2L5PA 1TTGA 1HJCA 2CG9X 3FQWB 1HC1A 2AVIA 4QRRB 2F8OA 4GRWB 2IGFL 4JHUA 3O11A 4LPCA 4NQEE 1TVHA 1JPST 1P4BL 3V6OE 3K91A 3B7UX 1S9YA 4NM4H 1DN0A 4MNHA 5I1GH 1ZV2A 4IHOA 4LF3A 5IW1B 1SOSA 1WAAF 3IDNB 1YC7A 4J23A 5EIIB 4A39A 1BFTA 5JHAA 2LA7A 2WB1A 3CMOH 4NC1C 5DD6B 3X14A 5FECA 3K3QA 2OULB 2AEPL 1J8HD 4KOCA 1WCQA 5HYJE 6CGTA 1VWHB 3CVIH 2R23A 4OCXL 2MCAA 1XGQB 1NICA 2HKHL 3ARED 3U36B 3MJ7B 1MFEL 2WGNB 4AGNA 4OCWL 3MG5A 1HQPA 1QPXA 3QB7C 4MJHA 4B3VA 3EJZD 3WFCH 1QEWA 3GSVB 2WUBH 3WJLA 3C9NB 2ARJA 1OP4A 2YO3A 3LZNA 1DFXA 2EVIA 5A3IC 3IM1A 3AFLA 4ZAKA 4BFNA 3MJ6A 4KV5E 2DIBA 3V0FA 4Y5XA 1KYUA 1L7IL 5BYPA 3ISRA 2K7QA 1DQTA 2APFA 1KL4A 1IGIH 1VYFA 2R0KH 2P8LA 1KLUA 2YAOA 1EI5A 2HPOA 3FTVA 4FXKA 3BAYA 1GOFA 1BGXH 4XMEA 4GFTB 2BWIA 3UTSD 2IPTH 3OJDA 3QWOB 2VZSA 4HJTA 4AM0A 2YSTA 2CBOA 2BX5A 2VYRE 4XBEL 5KZCB 1P6AB 1KIPB 5FKAA 3LNEA 5IQ7H 5T3XE 1ZLUH 1CGYA 2R4SH 3L4TA 5C0CA 4Q6IA 4U1HA 3V0DA 4OZGE 1IT9L 1S5HB 3WKPA 3BT2H 4Z5RA 2Z8WC 4GXVL 4RIRA 4Q4IA 5BOZG 3CX5K 5CJ8A 4FBOA 1GAFH 4FA7B 5LJHA 2FT7A 1AGCB 1H3GA 3H7BB 4FLQA 2FECI 2VXTH 2X4PA 3NEXA 3CFIC 3I6SA 3VXUB 2H32H 3SAOA 1YEFH 2G3MA 1WFTA 1MHHA 2NXYD 2ZAHA 2E86A 4AH2A 4GAYB 4HWZB 1D9KA 2BNRD 1WF5A 4PJFB 1RZIB 2HXAA 2UV3A 3OD3A 1AQ8A 4IOIB 4ODHH 4G7QB 1QWHA 1KGIA 4GGTA 2DLHA 1J88A 2YD2A 2GIXA 5F1SA 3GAQA 3SDXE 4NKDB 1VWMB 4OFYD 4W4NA 3K6NA 4HZ1A 1WPCA 4TNWK 4B9KC 4A7GF 4D0DA 4OS0A 5DMKB 1VFOA 4B0MM 2RTTA 4JFDB 1ZANH 1ET7A 4UB0H 3ZE0E 1FNGA 1NCWH 1OBPA 2W1NA 3K6DA 1I4FA 1LWRA 3MLSL 2OV0A 3EOBB 2HLAB 4RMTA 1WHPA 3C6SB 1NOLA 3EXLA 3NCJL 4LOEA 3AUMO 2BH0A 5HYSA 5LHDA 4MNQA 3QDJE 4ZT1A 4WHIA 5EU6A 2ADGB 3BXNB 2X40A 3MJWA 4HEMA 3WKML 4TXVB 3CHXA 4MQSB 1P6WA 1LO5B 3BWZA 5IV2B 2JIXA 1L9PA 3RX9A 2Q10A 2A5BA 5E9DA 4ALAH 4CUCA 5I19H 3MRIA 2FB4H 1MW2A 1KN4H 2GYSA 2HVKA 4AYFA 4HKBA 5CLTA 3KPNB 3PNWB 5DJXB 3L3OB 1CLZH 3S35H 3EYUL 4JJOA 2Q20A 4PU2A 3V6BR 1SREA 2RCTA 1BM7A 5FX3A 4IU3A 3Q06A 3WZNA 2DTML 5C07D 4JN2A 4XCYB 4H88L 4A38A 1O7VA 3BSZH 4P2QE 4P5KB 1JCVA 1A6WH 1UURA 1XSIA 5KTEL 3ZW1A 2YMSA 4L9LA 1TJHL 1DJYA 1ZLWK 4GSRA 1XSJA 3HAEB 3HRPA 1AZNA 2HJKB 1SY3A 1JGUL 5ITBH 4JQIH 4TSCH 1RZ8A 3IDIA 1FAIH 3PQYB 4UILH 2UZPA 1ILUA 1L9MA 3FTGB 5F1IA 4Y5DA 5JPNA 2O93L 3L3OC 1UT1A 4EAEA 3TEXA 3UBGA 1ZTXE 1BFOB 3G04B 4DKTA 3DTXB 3EYFB 2O62A 2ICWB 1J11A 4OMWA 1A0QH 4LP5A 4ABQA 1VWPB 5D5MB 1JPTL 1RY7B 1SGKA 4LLWA 4PCSA 1U91A 5FHBH 1FV1B 4JGUA 1UJ3A 2HT2C 3TYGL 2BNUA 4Z3TA 2VXQA 2RTPB 4LF3B 1HBPA 1FNEA 4IHOB 5DVNA 2GC7C 1F6LL 4N2OA 4E42A 4O3YA 3BZDA 4MA1B 2V8MA 2YC1A 1YEIH 2CD0A 4DN4H 1JZHA 3TEYA 1VGEL 4BUHA 2PYFA 2FH6A 3CFDA 4UT6A 4YDNA 4XO5A 4J3OG 1GS8A 3I2CH 3T6XA 4Z28A 4OM1L 3ZRFC 2I26N 4R26L 4HJEA 4JRFA 3UBXB 1Q94A 4PJCA 1F1GA 1B90A 3X2QB 2PCPA 1M71A 2ADFH 2WP3T 4RGND 4L8BA 2Q7YB 5I5RA 1DZPA 5FCUH 2L04A 3TH4T 7FABL 3QPXL 4UM9A 4O2EA 4E68A 2QQLL 3DMMA 5EFIB 4MA1C 3QH3B 2PF6A 3CXHJ 1VF5C 2YLKA 3KWWA 3KPRE 1O9WA 2NQDA 4XN7A 5FDYA 1A4BA 1NKGA 2C9VA 3GXFA 1A3ZA 3B8SA 1I7TB 4YS4A 1HNFA 4YJZL 2HJLA 4L2LA 3VQ2C 4PVBA 4HDIA 2IFFH 4M5TA 4Y5XB 1TJXA 3P24A 2FHLA 5E5LA 1FNSH 4WUKH 4XNMA 2V9QA 5T3ZH 2AV7A 1KLUB 2P8LB 3IJ8A 43C9A 1WBIA 4FXKB 1OW0C 3GEFA 4NWUH 1SWUA 2WXNA 3WJLC 4JHWL 1XMEB 3P3SA 4HJIA 5LDSA 3OLDA 4Y19A 4LLMB 2AQNA 3NESA 1HHHB 5FKAB 1HH6B 1T03H 1MQ8A 5ID0A 4UT9H 4Y59A 4AWJC 5JXEA 4U8UN 4U1HB 1LDPL 5D7SL 1WJ3A 4I4WA 3V5HB 1SWCA 1LO4L 3FW5A 1O7DE 4Y5XC 5FWQA 3B37A 2BVQA 2IDUA 4Z5RB 1CR9L 2PLTA 4AC4A 4FGIB 1E2VA 2A6JA 4K3JH 1S7UA 4RIRB 3O2WH 4UM8B 4XPGH 2PPFA 4CVZA 4JKNA 4CSZA 4FXKC 4QXUL 2TRHA 4GRJA 5EO0A 1ZVSA 5EBGA 3ZTNL 2P49B 1MW1A 2X4PB 3HTLX 1N18A 4G80A 2WWMC 4QYAA 3LKNB 3OXRA 4FKKA 3ES6A 3WGVB 1MHHB 3VXRB 4AH2B 4LHQB 1U3NA 5D7EA 5FUOH 3VGFA 2DBLH 4NQEA 4X9FA 1WZ1H 3CMOL 4EQAC 3EG9A 1XF2A 2KPWA 3HKFA 3V6OA 1ZLDA 3E8UL 4RDBA 5GZOA 3IDUA 3NP1A 1RIHL 5K67A 1HK6A 1NGYA 1OTTC 2H32B 3L9YA 3A4EA 3NIFF 5GRZA 1DBJH 2RHEA 1U2YA 5EOQH 2EDYA 1MRFL 3BMVA 4D0DB 1FVDB 4WJG3 5HYJA 3FB7B 1WCBA 2WKOF 5DJ0A 1IJNA 3ME0A 3QDGD 1FNGB 2M26A 3FUNA 4NYLA 1I4FB 1A47A 2QMKA 1A6UH 2WUBL 1EALA 1X7QA 4F15B 2VAJA 1Z7JA 1HN2A 2EABA 4YHLL 5GGQH 1KGXA 4XWGH 1RUQH 2HKAA 2WTRA 4FFYH 3T0EA 5B8CA 4O4UA 1ZD6A 4CSSA 3FCSB 2P28B 4FI8A 3TX4A 2WVUA 4OD2B 5IUCA 3BUQA 5IQLA 2W0FA 1KCBA 4L4VE 3IMVA 5IEKA 1KG0A 4F15C 1B56A 4GGRA 1QRNE 5CAYB 1BVLB 3VB9A 3IAQA 3L1EA 4IYKA 3HPLA 4DK6A 1QFTA 4YSTA 1BM5A 3II3A 4YVNA 1A2DA 1O8VA 2YA0A 4DEPC 4PRHA 2PYEE 2DWEB 4PUBH 2X9XA 3QIWA 1LEGA 2OL7A 2W38A 4L9LB 3H4FA 5CIPA 5B5FA 2ZUTA 1GAFL 2I9TA 4OZGA 3IDMA 3TVMA 3LTWA 3IDIB 4Y0QA 1K6QH 4W9KC 4XGZB 5E99L 2E27L 1L9RA 3GIVB 3OX8B 2E75C 2VXTL 4YFEA 5AL0A 1WFMA 3LB6D 2HVBA 5SWSE 1YEFL 1J1PH 4ZFZA 4NNSA 4L3AA 4XP1H 5D8JL 3MBTA 1UACL 2Y36H 3BVUA 1SQ2N 1NMAH 4HIJB 3P6CA 1XD1A 5E8NB 1QTSA 1EO8L 1XF3A 4XO3A 3FZUC 4L9LC 1QO3A 5D9SA 1KT2A 4J6IA 3D97A 2DF3A 1FNEB 3NP3A 3VQ1C 3MUHL 1GPOL 4E42B 4KK9C 3U0WH 2CJSA 1XF4B 4HAFA 3FA8A 4WRLA 3SDXA 4UB0L 3CFDB 2VNCA 3SBQA 4NJAH 4AGQA 5IHHA 2A4CA 2I60L 5DSCB 5JDSB 1MFCH 2VR6A 5I0ZA 1N43A 4QWWC 4QZTA 3AS1A 2B1HH 1M71B 4E9SA 1HY2A 1S8DA 4MDIA 4L8BB 5CZVL 1SWKA 3DSNA 3FT0A 4EZJA 3KFGA 4P8QA 3RNKB 4EXKA 3W5NA 4RNRB 1KXHA 3CMPA 4RMBA 1E27A 1SDDA 3GBMH 3IMBA 3QDJA 1BZQK 5A3ID 5IO7A 1E02A 1IC0A 1AGFA 1KN4L 1ANUA 1F2QA 1GGTA 2R83A 1DSWA 3S4SA 3IBEA 3RNQA 1QLFA 4G43B 3S35L 3D96A 2Q5BA 3GTNA 4QO1B 3LY6A 1DVFB 1YUHA 5B38G 1OGSA 4PS4L 5K68A 1S5IL 4HC1A 3SCMD 4GEIA 3BCFA 1HXMB 4GMTL 5FF6B 1NP4A 4HAGA 4H2CA 3SDAD 4ENZA 4QHUA 5MERA 5AOJA 4UMGA 32C2B 1U8QA 4JQIL 3HWEA 3LH2L 4HJ1A 4P2QA 5DHVA 4S0HA 3PDGA 1IFRA 1XD0A 3UZEC 2RQEA 5AB9A 1T89A 2VXSL 4B96A 4ZNCD 1YWCA 1AANA 1U92B 4ZW8A 5T5FA 4ICWA 5LWYL 1P9MA 1DVFC 2XWBB 4HKXA 4WZ9A 4S1DC 3B9KA 1LK3L 1P0SE 1OEKA 1E28B 3P73A 4RSYA 2B9AA 3FB6B 4Q58C 3JWDH 4UT6L 3UL4A 3QFJB 2JOZA 1G4MA 4O2CA 2XN1A 4G72B 5A2JH 3L3KA 5C0DB 3GIZL 5F6BA 1PKQE 1NUNB 2DAVA 3SYOA 3S37H 1O5DT 4G80B 3DX4A 1LCWA 5AKTA 2RAMA 2TRYA 3OXRB 4NQSB 3ES6B 4MCZA 3ZE1E 3N9GH 5I8EA 1YEIL 1L3NA 5EBMB 4HK0A 4AK2A 2EILB 5AVTB 5F58A 4N8CL 5AW2B 4WNQB 1RJYA 4XP4H 3OTTA 4MMZA 3QEUA 3RBGA 5ICXA 4QD2E 4ZUSA 1E9OA 3EOAB 3TBWA 3TOPA 4XO9A 4BHUI 1OAJA 3S26A 2YXWA 1FO0A 3GXUB 3EDKA 4KX9A 4WNSA 4P0DA 2PETA 3LN4A 3WIHH 4G42B 1QW8A 1JHLL 5F1NB 4NYLB 1DEDA 3FUFA 3NFNA 2FHFA 4KZ0A 4N0RA 1WVZA 4KK5C 4MB1A 2XIIA 4Z0XA 1SM3L 3PECA 1W0WA 4O4YL 5ITFB 3SBPA 3V6OC 1E43A 1LIFA 1G7LB 4BE6A 4TMPA 1AR1D 1IAIL 5D55A 1RU9L 2VZVA 3V8CA 2AV1A 4ZMTA 4NV8A 2WTRB 1VDGA 4BQCA 4IBAA 1K9TA 3T0EB 2K6WA 5JA8B 3KPRA 4KKAC 5EBLB 5B8CB 5DJ8A 3B6SB 4UV7H 4X99A 3ASWA 3OHXA 3PNRB 3O19A 5AVXB 1OP3K 2XZAH 4G1EB 1U2HA 1VCBC 5T3ZL 5BXFA 3LHPH 3VG7A 2QZ5A 5F7LB 2YJLA 3VQLA 5K9KA 2W0FB 1DVYA 2GY7B 3MYJA 2R0LL 2D3LA 4UINH 5KVMC 2DL2A 3SKJL 1JERA 3E9UA 4UDTA 4ZO7A 3HPLB 2IQAA 3RVWD 4FA8A 1CDCA 1QFUL 4UT9L 3OAUH 4ZZKA 4YDIH 2A77L 3QFDA 2BT9A 4TVPH 5DJAB 3T0EC 1X8UA 5B8CC 4PRHB 4K3JL 4J27A 5D7KD 3O2WL 5L8IA 1T0MB 3QIWB 1NFAA 3N1PC 3P6EA 4XPGL 5GSVB 4DPCX 1HZHH 1A66A 3C5SA 2FJUB 3RJQB 3TVMB 2GSIB 4ZBJA 3MBEB 1Y53X 2GI7A 3GLDA 1OSPL 4M48L 3V0AC 2X0UA 3ZU8A 5D1XE 3PGCA 4YPGA 4ZQTA 4FL4B 3AXLB 4X9YA 1F3JA 1JNLH 1GMEA 3BFOA 4PWJA 4R4NC 4XVUC 4ZFZB 2QVMA 3QUMB 2FR4B 1WZ1L 4FQIL 3BP4B 2R2EB 5SWZB 3BJLA 1C5CH 4KXZH 3ESMA 3DWTA 3QIWC 4KPHH 3MRPA 4C8XA 4JDEB 1QO3B 2IPUG 3GSUB 2P8GA 2WSPA 1U33A 2J88H 5E7FA 1ACYH 3TVMC 4R2GD 1TO5A 3MBEC 1G1OA 4EI6A 4XN2A 4O2FB 1WGOA 5AALA 5F72S 4TTDC 1UATA 1VB9A 4KVNH 3BIAX 1J8SA 4I6SA 1IIIA 1FWXA 5DJDA 2UUDK 1NCCL 4FL4C 3FIDA 2QGDA 4IRZA 3QBTB 1U95A 2LFEA 1IAMA 5F7BA 3L7EB 3IMWA 1FE3A 4HWNA 1A6UL 1DBKH 2QGBA 2IAMB 3OJ2C 3GHBH 4QQ1A 4M7KL 1MZYA 4XX1E 3FN9A 1DL7L 4WO4D 1GA2A 1S8DB 2EDKA 1P7KA 4MDIB 5IRWA 4F8QA 5GGQL 2UZ2A 2F8VA 2FBJL 4XWGL 4H25A 3WN5A 4CV7A 3D50A 4PJBE 1WK0A 1H6UA 1RBPA 2WO4A 2E56A 1RSFA 3IKCB 4LEBA 4C57C 4EE2A 1SDDB 2WYTA 4NEHB 3MRCA 4JM2B 4NKIH 5I82A 2YUWA 4K7PX 4YHIA 1AGFB 1JWSA 1RUAL 2BSZA 4JE4B 3M1BB 5BUPA 3PHAA 2L7QA 4P2AA 5JHMA 1JPFA 2J6EA 3QCVH 2IAMC 5I71B 1D3CA 1IX2A 1JZIA 2MHAB 2YQBA 3VXSB 4WFUA 4NQUA 5DXWA 4QPEA 1G43A 5DFAA 1WG3A 5E2TL 3I02A 3TN0B 2EKSA 2P5WD 5AUMA 3MROB 4L4VA 1I8AA 2QO6A 3LKOA 1JXFA 4NKMB 4UNTA 5EU6B 5IVXE 1TSHA 5LAXB 2Z35A 1V7MH 3R0NA 1F4HA 4PUBL 1HVXA 4JM2C 4QHUB 5MERB 3SPHA 1NC2A 3WTVA 4UTBH 1NAMA 3QUML 4S1QH 1MCBA 2Q76A 1KQXA 3UP1A 2XXGA 1KZXA 3ZL4H 4I88A 5C3IA 5I71C 4ILDA 2PYEA 2Q2EB 5E56A 1N7MH 2V17H 1KBGL 1SWDA 3QJQB 1FFNB 4HKXB 1X9UA 4HISA 1YC8A 3B9KB 3TN0C 1J1PL 8FABA 4AZPA 1UXLA 3P73B 3KE0A 2Y36L 3LV3B 5AW4B 2E7HA 1QBLH 4BSJA 2V2TB 2A9BA 3F12A 3RWJA 2XBZA 4O2CB 3SPCA 3I6LE 5SWSA 5KEZA 5G5DA 2EP6A 2ZX8A 2F9BT 4I7ZC 4OIBA 2VDNB 1MHCA 2RTOB 2ESVE 2GABA 4F91B 4XAKE 1OB0A 1T89C 4HK0B 2P4AB 1S46A 3UGUA 5C8JB 2QDVA 4NJAL 5IW6A 3QPKA 3LYRA 3B9KC 1IQDA 3W9DB 1PDKA 3CMGA 1IBBA 1HFUA 1RURL 4U7SA 4AYEC 4PRAA 4DGYH 5KYWB 5CR8A 5ICXB 4DKEH 3PABB 4H0IA 3JT2A 2WN3A 4FFTA 4Z27A 1PLGL 4OD1H 4YE0A 4ADGA 3SE8L 3V7MA 5D6CA 5KBKA 3RIFK 3D18B 5LXGL 3MLZH 4DQOH 3O2YA 1CL7I 3VXOB 1IV8A 5HVHB 3FW6A 3NFNB 2J7LA 3DYPA 3GBML 4GG8A 5TDPB 4HC1L 5I66B 3JWDC 4BYHA 2OJZL 5LKEA 2BNQE 2H26A 5DVOA 3WNLA 1TQVA 4NSKA 2YZ1A 4WFHE 1N59A 3LPWA 2AT5X 4RESB 2YEZB 3QORD 2HVJA 4DK3A 2F1AA 3KPRB 1QHOA 4S2SA 5HJ3B 3LIZA 5CP7B 2ENSA 3W3BA 3NRFA 3CFBB 3OKLB 1XQ4A 4KJQD 1ERNA 2ZCHH 1BF8A 1SXNA 5HVHC 3DVGA 5D6DC 4EFGA 4LOUC 3MYJB 4C4KT 2GJ6D 1RK1B 3LQAC 4EZLA 5LCVH 2FS7A 4YIQA 4QHPA 2A5CA 3KHQA 1JK8A 3QFDB 1MAMH 1MFAL 5IF0B 1Y55X 4OT1H 1YPZE 1E00A 1VWOB 4P5RA 3O41B 4FD0A 3C5SB 4TQEH 1J0JA 3JWDL 4M5YH 2VSKB 3FA9A 1BBDL 1K72A 4Q89A 2WZPA 4KAQL 4E41E 1NC4A 2CM6A 4EI5A 1AC0A 2BSED 3PGCB 3CN3A 5C0ND 3S37L 1RV6X 1NPJA 3CDCA 4H20H 2VTFA 1F3JB 2A0AA 4DPAX 1NIAA 3N9GL 4Z7QB 2AMUA 4N0YH 1PKQA 3GDBA 3RLSA 1WEJL 4KTEH 2VMEA 4YHMH 1J5CA 2KW1A 1U8OA 3MRPB 1BQLH 4L48A 1AOZA 4XHQA 1FFPB 4E9TA 1QLEB 2G2NA 3NN8B 1DQLH 5FA4A 1LE9B 1WIPA 5DA0B 4JGNA 3WYPA 3FRPG 3O45A 2G30A 4U3XA 3QXWA 3UTZA 4L1BA 5E2VH 3RQ3A 4Y4FA 3CC1A 5FYJD 1MI5E 2CDEB 3ZDXF 1MCOH 2UWEF 1PG7L 5CKAA 3GKWH 3OJYC 1OHZA 1AXSB 2GJZA 2H6PA 4KI1A 1QACA 1MCLA 4B41A 1CGXA 1YVLA 4B60A 2P24A 3TO2A 4WV1A 1B9ZA 1FZMB 2ZQKA 3E8VA 4YXKH 2CAMA 4X6BB 4H1LH 2XZAL 3MKGA 3NTCL 4YHIB 5GGRA 4CADA 4NAJA 2CLZB 1LO2H 3PXHA 5JORA 5GHWL 2BC4A 2GAZB 3B2KA 3HEIB 2IV9A 4LASL 1F5WA 4BIKA 2FCBA 2OSWA 3UYRL 2NX5B 5DD1L 4PJDF 3D7PA 2DIEA 4MBOA 2EKSB 2AJVL 1JN6A 5B4MC 2ZCLL 3IE4A 4GDAA 3OAUL 4CSPA 4PR5B 2J44A 2IEPA 4NRZA 1JVOA 2C1OA 1ZRUA 4FNUA 2NNCA 2Z35B 3E80A 2XWJA 4GO8A 5JPMB 1ETJA 1XV8A 3RWEA 3MLUH 2Q76B 3T2PA 2JKSA 2WXRA 2EYSA 4XP5L 5JOEA 5IB2B 2PW2A 4KOBA 1VPRA 2VFCA 5EUOE 5F96H 1QY2A 3HE7D 4ZX5A 4KBPA 3TFKD 1CLOH 4JKPH 4QXVA 3MNZA 3T08A 1F1AA 4M6NH 4ZZFA 4AEEA 1TTFA 1PNCA 1SN0A 1U0XA 1BIIA 2ZWSA 5EOTB 3RDJA 1S9VA 4JFQA 3E9TA 1OGPA 5K9JH 4OF8A 3RWJB 1C5CL 1RIUH 5GRUL 4IMLA 4AMKH 5JPMC 3OJMB 1FAKT 1N2RB 1E6JH 2VR9A 2TSBA 3BLGA 1ACYL 4IB6A 5B3NA 1MFMA 4M4PA 2Y7MA 4IKKA 5JXAH 2VLRB 3GRWA 4P4RA 5IJDC 2IG2H 1KTDA 1ZIBA 2DQGH 3HG4A 1OM3H 2ZUYA 5IW6B 4V1DD 1H8SA 3VI4E 3O3AA 4MJID 1DBKL 4PRAB 2DIAA 5A6LA 2WZ6A 3DOIA 5HZ8A 1CICD 2VWEE 3UAAA 3O9WB 4XPAL 2HWZH 1GIGL 4LNRA 4D9LL 3UADA 2NUTA 4EUPA 1IC7L 1PAZA 2IO5A 1TJIH 2XJKA 5C6WH 2JTYA 3GTVA 5CEZD 4YBQD 3QQ4A 3K71A 1SVCP 2FUTA 4HMCA 2VXUH 4F1SA 2HRPH 1E2TA 2AH7X 4FNTA 1FG9C 1CJYA 3ZMRA 1QP1A 1S7QA 5D72L 4L29A 2JB5H 4PJBA 3ZTEA 4JRYB 4TQ2A 2VH5H 3OB0K 3K8LA 4HXBH 4N2HA 1N59B 5BS0D 2VDQB 1I8LA 2LTQB 4WDIA 5FGRA 3ZE2F 3O9WC 4AZOA 4ZSOE 4DGIL 4X8JB 4RFEB 4KUCD 4DOHE 2OK0H 4AV4A 2IZKA 5JZ7C 1D5IL 1WICA 3LEYL 3DVGB 3IJHA 2NCMA 2H3NA 3FOLA 3CN1A 4Z7UF 5SX5K 5B1BB 1TEGA 4QRSA 3D69A 5IW3A 4YSCA 1QASA 4HPHA 5IVXA 3Q2CA 2RCSH 2HTLC 3P6HA 1A7BA 2LTQC 1N7ML 5AD0A 1JK8B 1EAQA 3BGMA 4JFYA 2ZXWB 1AYOA 3VI3F 2EIKB 5KSUB 3HFMH 1KB9K 3MMEA 4RLDA 3WEOA 4A1YA 2X0WA 3P2TA 2X2UA 1QBLL 2J56A 4MCNA 1K5NA 4HUVB 4TQHA 3D25A 1UWEH 1DANT 3WL9B 3M17A 1YHPA 3IRZA 3I3EA 3EHBD 2ITEA 5EWIH 5EZ2A 3VDCA 1UXMA 4ORZC 3HR6A 4TJZA 3VE0B 4P2YA 3RFZB 3HCVA 4AJWA 2R29A 1CT8A 3U9WA 1EGJH 4P5TD 3VWJB 5KYUA 3EXJA 1KIRB 1K8DA 1NCNA 3NJHA 5ESVA 1PKQB 2L7UA 2WQUA 4B95C 1KIUA 4WNJA 1U8OB 2AKRB 1NUDA 1V10A 2ESVA 1AVEA 1UH2A 3NSFA 4BDVB 1ZA6A 3L7FA 4C56D 3T8VA 2P46B 5J12B 1KEGL 2W07B 2BSDA 4X5WA 2O6DA 4RZCB 2VDQL 3OLGA 4LXFA 4H0LC 1QZ1A 5I17B 2X45A 3MLZL 4Y4FB 4NPKA 1EPAA 4J8RA 3X1NA 4KK6D 3OE3A 1G9HA 3V6FA 1IW2A 3TBVA 4WUUD 3NMEA 1KIQB 4RA3A 3VWJC 43CAB 3AACA 2YSSB 5H8TA 1DJXA 2B4CH 2H6PB 1PQZA 4PJHE 5DJ2A 1SWOA 4CRPA 1CXLA 2R0ZL 2R73A 3RIKA 2P24B 3SZJA 2BZ7A 4GKNA 2WOYA 4NQXA 1TXKA 4XWOC 3WJJA 5LG6A 2MQCA 3OQ3B 5J12C 3EDFA 1G5WA 1LDSA 5F7WC 4X83A 1JSYA 2BNQA 2B08A 4ON1A 2OY1O 4JY5L 5IEHA 4Y1TA 5GGRB 2IH8A 4PJ9A 4MYPA 4Y4FC 3SYAA 3SGDH 2JLLA 3RJOA 5JORB 2A9AA 1QHQA 2BC4B 3O4LD 4HOMA 3GM8A 3L6FA 5CCHE 2AT6X 1JI1A 2Y1AA 1Y6KR 4MIRA 3RPIB 2IPKB 2X4TA 1NCIA 3BWUF 4WQOA 3QUXA 4K4KA 3FEPA 4Y4KD 3EYCA 4YXLH 5CJBA 3APCA 1W9XA 1GY1A 2YQ2A 1G6RA 4NRZB 2C1OB 2RTHB 1IM9D 2DM3A 1MAML 1MVUB 1SVBA 3EOTL 3GS7A 4MD4B 3G5VB 2F58H 3RWEB 1LICA 3FMGL 3MJ8A 4FEIA 3WIFA 5ILTH 2R1XB 4DW2H 5DD5H 5E70A 4Y2DA 2XRAH 1I78A 4M5YL 2WM0A 4OU3A 4XPTH 6TAAA 4GP4B 1LEIA 3NCWA 5HHMB 1YPZA 2MNJB 5E94B 3UOAB 3QQ2A 1J1XL 1P1ZB 1ZWIA 2RJMA 3WD5H 4H20L 2Q3AA 1G7HA 1P4LA 1BZ7A 2FNWA 2JTDA 3PJLA 3HG5A 4IK6A 2VB5A 1M1XA 1CXKA 1IJ9A 4K8RH 1BIIB 1RH8A 4E41A 4EOWH 1S9VB 4JFQB 1U8KA 2CXGA 1UUSA 3D05A 1M56B 4PI0A 1I1YA 1GGBH 1EJFA 4AW4A 1X8OA 2DJMA 5DT1H 1LK2A 4NNYB 2ZSCA 1EEYA 2BS5A 1BVNP 2QFRA 1TIUA 2XPGA 4TLKA 3SLJA 3FT1A 1E3ZA 1YY9D 5GS3A 2OFRX 3CGTA 4QMEA 4N3TA 3T65B 5E2VL 3U9PH 4ADIA 3ZK0A 4CC0A 5JHDD 5DEZA 2WNWA 1TDQA 2BSBA 4IJTA 3F05A 2ZOUA 3O3AB 4CKQA 2YK1H 2JELH 3DVIA 1NA8A 1JGDB 2R7EB 3GKWL 2BVUA 1DBML 1QD0A 2JU8A 4X8XA 1NDJA 2N7BA 4CPIA 1MI5A 1XEDA 4HJJH 5FYKH 3U2IA 1MX7A 3B9DA 3BFWA 1Q38A 4OIIL 1W8EA 3VD5A 2NUTB 3G6AB 3KCWA 2X10A 3KG5A 1SN2A 5ESQA 3SDYL 1HMTA 1DQVA 3VX0A 3M88A 2OYMA 3SQBB 3MV11 4WWID 3GZKA 4LBAA 1KLFA 4PWGA 2WTPA 3STMX 1I05A 5H37A 1Q0YH 4MAZA 4HIXH 5FDWB 5FYLE 3KYNB 3QWRA 1EMTL 2X3AA 2APTA 3QDMD 2DRUA 4WDIB 3IDYB 5JHLL 4NNTA 3OPUA 3RWCB 3ROLA 1AR2A 4LKPA 2HKFL 4A7TA 2VOTA 2FSEA 1MNUH 3K2KA 4JG9A 3L1FA 4BWWA 4EEEA 1AFVH 2IBZX 2M8XA 5D47A 2XQYK 3U03A 3CN4A 4BFKA 4HEPA 1UB6B 4ODUA 4QR7A 3SJVE 5C0BE 3FOLB 4NRYA 2X12A 3NJMA 4UMSA 3MFFA 4MXWL 1T6WA 3ECWA 3DSFH 3BSZE 1RXJA 5IVXB 5F96L 3FFCD 1QFVA 1HSBA 1CLOL 1I8LC 5AD0B 4D0CB 3IDYC 4JKPL 1QI4A 5I0VA 2CH8A 3MNVA 3N50A 4XPBH 5EC1A 1JYXA 3AU1A 4M6NL 3L5WA 3DUHA 1YMMD 4CJ0A 4LDCA 3FS9A 2W81C 2MO5A 4NPJA 3MMEB 5EUOA 5AW1B 4IW4C 1W0VB 2C3VB 2XA8L 2K45A 4JGJA 3KWTA 3IFNL 4MAUL 4HS6A 3M17B 4JFFE 3I17A 1WWAX 2F7OA 4TRPH 5M95B 1E6JL 3NRPA 1VWNB 2OMTB 3CCHA 3QJHA 1IAOB 4I3CA 4MDRA 1IC5L 1CT8B 4GBXD 5KYUB 1DJHA 2AJXH 1K8DB 5JXAL 2XTJE 5ESVB 2IG2L 1KV7A 2FJHA 4JPIA 1KIUB 4AMXA 2ITFA 1CDYA 2CK0L 4LMQI 1T8VA 4PJ5B 2FQEA 4L1NA 3L7FB 1S9XB 1S2PA 3N41F 4UOZA 5K9QG 2ENPA 2CBRA 1Q9LB 3PJSA 4X5WB 3ARFD 4HWEL 2QT6A 3ESNA 1EIIA 1EHLH 3BEWA 1U3ZA 3VI4A 3MTRA 2OBGA 2VMCA 1BPVA 5DEJA 5G4OA 5I76A 5JNYB 3DUUB 1NIEA 1E7VA 3FSZA 2J3SA 1IGTA 3DV6B 1S7VA 1OB1A 2WBJD 3JQOA 3HE6B 5TE4L 2CXKA 2VH5L 3IFLH 4GKNB 1BAGA 1Q9OB 2DI9A 3APMA 1F18A 3FQUA 1TITA 3M7FB 2C7UB 4GRLB 3HR5A 4NQXB 3TBCA 3HUJE 4FQJH 4BQ6A 4F2MA 3KYAA 4XCCL 4KH8A 2EDHA 1UWYA 1OF0A 5LQBL 3N1FC 3ZRCC 2H0PA 5E4OA 4OGYH 3DA0A 3LD8B 2Q87A 4YL4A 3VWKA 3WUZA 1YNLL 5KYNA 2RBLA 4IRSA 4ZSOA 4FZEL 1TZIA 3IDXL 4KQ3L 2D3VA 3SPJA 1Y7VA 4PJIE 3HE6C 2X4TB 5CGYC 3RVTC 4CILA 2HFTA 1Y0GA 3QUXB 4LSVH 2H41A 2COVD 1OCWL 1NMCB 1U36A 4GRLC 1XHHA 2W59A 1YEKH 3EH3B 3WJJC 4C47A 1GJWA 2XWRA 3BIKB 4F58L 3KYKH 2GB2A 4WAFA 4G71B 4XMVA 1BXAA 1VFAA 3FSAA 4XN4A 3CK0L 3CH8A 1SOQA 3HFML 1SOXA 4M62H 3C75A 4Y2DB 5DEGA 5CBEA 3SDCD 4XB3A 1UWEL 4HUNB 1C8PA 5IESL 3C78X 3HI5H 3ZKSD 2A7BA 3S7GA 2FJSA 4QRLA 4ZYKA 1X5KA 2D31A 4A6YH 4B6ZA 4BKLB 2JKJA 3MFGB 2K6YA 3QUXC 4FF9A 4JFEE 2BOLA 3Q8EA 1NMCC 1EGJL 4KTDH 4D0BA 5DHYA 4E41B 5GXBB 2WVSA 4FG6D 3KVQA 2CO6B 5JR1H 2A5UA 1ULVA 4TF4A 4UQBA 5K59F 2DLFL 1EEYB 4Y2DC 5KW9H 4M1DL 2Y0SA 2VJ0A 1G4RA 1DE4B 5IB4A 3TF4A 2JQZA 1HZLA 4P2RE 4N8VG 1A4KB 5ADPL 4PMFA 1TJMA 5AW8B 4IU2B 1S3KH 2X09A 2YGVA 3GXDA 3FDCA 4PJEE 1N70A 1I9JH 4O51B 1TQBB 2HMBA 3B1TA 3I85A 1SWTA 1CFSB 2B4CL 1IGJA 3ZBMA 1XMWA 1KUMA 3QUYB 3TYFB 1I8MB 1MI5B 2QDWA 2E8YA 3MA7A 1DZ0A 5DS8A 3ZDYF 4E5XA 4L8SA 5HY9A 2VO5A 5ESQB 5BPPA 2GK0A 1TFPA 4PJHA 3HS8A 4ZUUA 1J5OH 1QI5A 4FLSA 3BD4A 1WE5A 3FU0A 3WGUB 1HH9B 1ZHKA 3AY4A 2YRPA 1SRJA 2IQ9H 5EDCA 1ZXQA 1T1YA 3TF6A 2EXYD 3DIFB 1TQBC 2N4IA 1C1EL 1BX2B 1YNTA 3ZW2A 3FQNA 3HVDA 1QSED 1N0XH 2NLJA 4D9QE 1CDJA 5B10O 1KGWA 1OAQH 2AW2A 1ZHNA 3QUYC 2ENQA 4GAGL 3BAXA 4MB4A 5I1LA 2FSEB 2H9GA 3FNKA 2X6VA 2Q3ZA 3G5ZA 4Z7WF 3NIGF 2FD6H 2F8XC 4D9RE 1Q1JH 4HPOH 4NRYB 1KJMB 1ZVHA 4GG6B 3HMXH 2HYMA 3QRBA 2K0RA 3T2WA 2EXWC 2Q7AA 4DW2L 4MQTB 4WWKA 4KQ4H 2XQYA 2WO3B 4YBUA 1IKJA 2CCVA 4XPTL 2ATKB 4Y9EA 1QWNA 2IANB 4YHNA 4B55A 4XCEA 1HSBB 1IBGH 2X4NA 1W15A 1MXDA 1NPNA 2IBBA 5EC1B 1HTYA 3SLTA 2DOCA 3L5WB 1L6MA 4YCEA 4ZMZA 2IADA 1IRAY 3AREB 3BMWA 2J8UB 3B2LA 4YGVB 4YDVB 2VLKE 5DF0A 3C6LA 4BZ1H 1CN4A 3TJHD 2WQXA 1SXXA 3FA6A 1C7SA 1X6NA 4RFNB 4WGWB 3MV9E 3CHSA 2DB8A 1EANA 3CCHB 3CAFA 4BJ8A 3QJHB 4MQXD 4UIKL 5L4IA 1MCSA 5I30L 1FGNH 1Y18B 1D7DA 1X6LA 2J12B 3BP7B 1BOGA 4G11A 5IBLC 4BCXA 4Z76A 3U9PL 2PTTA 5BZDA 1GL4B 1M05A 3K81A 4NQDE 2FJHB 3HPJB 4W9CC 2VLLA 1IFCA 5DQ9A 4E9QA 2NY5H 5HTSA 4JMNA 5HI5D 3GGWA 2JJUA 3AREC 3ZRSA 1HILA 2Z9TA 4P59L 1ORSB 3PJSB 4XE5B 2BSRB 4OKVA 2Z4TA 1J1OL 3EJZC 4RFNC 2CUHA 1PBOA 2FHBA 5ES4B 3ECUA 3EIFA 5HBBA 1R17A 1UKTA 4L3EE 3MLTB 5I76B 2XVKA 1DJWA 3DC0A 3UTSB 2IGLA 2EUZA 5TFSL 3FF8A 3AXHA 1OWWA 3LJ3A 3Q05A 2WSDA 1Q0YL 5E00B 3L4ZA 3C60D 4HIXL 1DQDL 3UDWA 4U1SA 1FA4A 1J9CT 3ZY7A 1OVZA 3VFMA 4EQ2A 2ADIA 3I50H 4E9WA 4G7SB 4F2MB 1UVQB 5I8KL 2D2CC 1NM4A 2GTLO 2LT9A 5DZJA 3WIIL 2OQJB 1B3JA 4JAMA 4PB0H 3D9AH 4F27A 5HYSG 4I9WD 4KTYA 1RVFH 4G8EA 2JCWA 3IMSA 4NQTA 5I8OL 2ZKXA 1AFVL 1HYRC 1ZLVH 3NCYP 1N5YH 2VWEC 1N68A 2WPUA 4PLKD 1TZIB 3FFDA 4RUUA 2NYYD 2ETWA 4DP5X 2ZXEB 2NXYB 3DSFL 2BWQA 1KWGA 3MHZA 1SF5A 3SJVA 5C0BA 3VFSA 3VU2A 4PGZA 4PP1D 5EZOL 1UM5H 4TVUA 4XPBL 2W65B 3DIDA 1VFAB 1NQMA 1SWSA 4XXDB 2FGZA 3BSZA 3QEHA 4OI9A 1NEZG 4F7MB 3WFEH 4TM9A 3DNKA 5IVZB 3GSOB 3RDMA 4Z8FH 1S6NA 4AJ0A 1CC3A 4IDJH 4ARHA 3BQUD 4ODSH 4RRPA 5I24A 5BV7B 4Y0PA 2NXYC 5GISL 3CIQA 4HWBA 3CFJA 5EOCH 2A6IA 4NBYB 2VABB 3S3BB 4OEMA 2V5YA 2AJXL 4JFFA 4YXHL 4M3KB 4EN3A 1HNGA 5KYYA 2OMYB 3NCCB 1YEGH 3FF7A 2JCCF 3QCUL 3P9MB 4MXQD 1V7NH 4X6FA 5KAQG 1DJGA 1OTUC 4A6YB 2D9QB 2OMUB 2ZUVA 4ENED 4YDLB 4ZX6A 4HUUB 2ZCKH 5CLZA 2PPDA 2A74A 1X4XA 5GS0D 2XVLA 5BV7C 2ALLX 5FQ6E 2PCFA 2WQWA 3X11B 1Z9MA 3D08A 5I28A 3N43F 3F58H 3QO0A 2NTFB 1BZ9A 3MRHB 4LT7A 2HTKD 2GBVA 3CZFA 1KXVC 1K24A 1JBHA 2CHDA 3F2LA 4ZUVB 1QLRA 2IZIA 3CQQA 4L23A 1YEDA 3II1A 4QLRA 1SY6H 3MA7B 4E5XB 4YDBA 2JB6A 4YDLC 5ISZB 2GTFX 1SMAA 2VUYA 2GK0B 4FG4A 1VWCB 3ILEA 4PJHB 5F97E 4ZUUB 5J6HA 2IZLB 1HHKB 4TKWA 4OGYL 3SE9L 2ZSWB 3VXTA 2VISB 3HUJA 4U3HA 2EVHA 3HMWL 3KPPA 4F7PA 4WSGA 2JKNA 3NZ8A 3RRQA 3UBXI 1R3IL 4X80L 1X8NA 2AABL 2VRQA 4P2OA 1JZJA 4JN1H 2MCPH 3MN8A 3UZQA 1ZHNB 2QJDA 3BN9C 5CUSH 5DRZA 4RISH 4CKVX 4I0PA 5I1LB 3INOA 2K6ZA 1LP9F 1JPSH 1YEKL 4TSBH 5BV7L 3G5ZB 3MBWA 4AKOA 2P80D 4GAJH 4PJIA 3SIKA 4DCBA 4FMKA 1F11A 3APVA 2CBQA 4AYGA 3GNML 1N9MA 4XP6L 3CV5A 5EORH 2QMJA 4EN2A 4TVPE 4WWKB 5IROD 5L7XL 4LDLB 4TYUA 5FW8A 5HPMB 2EYRA 3S98A 2G8CO 3HHRB 4CU7A 4XCEB 3QUZA 5HVFB 4A6YL 4UAOB 4O3WA 1SLEB 1DJIA 2IALB 1LTXA 4KHXL 2EIMB 1MPAH 4H5SA 1J0YA 3O8XA 2BWDA 2BY0A 3TBYB 4HZLB 3HRZA 1UYOX 1TQWA 2MCMA 4XNAA 1AOHA 4JFEA 4K5LA 2PO6A 3KPMA 2F19L 4BFGA 5JR1L 4KWUA 1NMBH 4CGUB 2IF7A 5AVVB 5DVKA 5KW9L 1T83A 4AGOA 1YQVH 1BOGB 4HU2A 3ZO0A 5FQ8E 2HZHA 4PG9A 1SRIA 1Z3GH 1RUMH 4UAOC 1M05B 2WIMA 3QZOA 1OPGH 2NR6D 4BCSA 3B2HA 1CQKA 1VGKB 1LXMA 1S3KL 4KRMB 2HMIC 4YKOA 3MRMA 2WR6A 3D39E 4APQB 1H0DB 1AKJA 4G9DB 1VEMA 4DN3H 1HILB 4P2RA 4QRUA 5B22A 3SBWC 2FKGA 4F7EA 4ALOA 1WDAA 4M1GL 4DF9A 2EDNA 1A9EA 2F0CA 2I85A 4PJEA 4KKQA 2BP8A 4LIQH 3FB8B 4NRXA 1I8UA 5FOBA 3AG2B 4LQFH 3AB0B 1EFXD 2GJJA 1J5OL 3NG5A 4PREB 4Z2VA 3D4GA 3WAKA 4CBPA 2EIZA 4HT1H 3UPAA 5BNXD 3TO4B 3WJMB 1BAFL 2Y23A 2PPCA 3DIVA 1U6AL 4APQC 1K8IA 4OCYL 2KERA 1JHTB 4N86A 2MJWA 4YNYA 4WU5B 1MFBH 1CURA 3FT2A 1D5ZA 4FFYA 4HYTB 4JAMB 5LJYH 2CLVB 2XCMC 3I3BA 3L3DB 1XZWA 4FADA 3R06B 2E4TA 1RZKC 2OMWA 3AB0C 3OQRA 4XBMA 5BRZD 4PLNC 3GKZA 1SYSB 4HPOL 1CFQA 3C08H 3HMXL 3CBKB 1OAZH 3WBGA 3ARXA 3GSQA 3TO4C 1WZKA 1I3UA 2W80C 3M8OH 3MJ9H 3UDWC 3B2UD 2CIIB 2G3ZA 5HGBB 3O6LH 3SJVB 3V79C 1XGRB 2EZ0D 5C0BB 1G0XA 1UQSA 3BESR 2E3VA 2PUQT 3DXAE 4KZDH 4PGCA 3KH3A 2Y7QA 5GGVY 3QA3B 4YAQA 4OV5B 4BVMA 2VR7A 4ZFFA 1TTUA 3K2UL 4KJYA 5DC9B 3WELA 1OSZB 1ETB1 4Z9KB 3F6LA 2WVTA 1YA5A 1UOVA 1E3FA 2K78A 3KL5A 3MRFB 3SZHA 1NEPA 2MEJB 3Q48A 5CJOH 2VLJE 4N22A 1FGNL 1AYRA 2VLKA 4Q74A 2P42B 4XCNA 4L2YA 1M7XA 2AVFA 2BMKA 5BJTA 1I1RA 3MV9A 5LGYA 2XKNB 4C55A 4EN3B 5KYYB 3MRLB 1RZKL 2VDLB 2Y07H 5B39G 4QNIA 3W37A 4X6FB 3BUDA 5F0LB 1JXGA 3AJ7A 4FQQB 2EDOA 5HHOE 4MA8H 4B0MB 3CDZB 4GSXA 3RSWA 3EBHA 3K72A 5F7YC 2XXMB 4Y8DC 5LBVA 4NQDA 2A74B 1OAUH 1WWWX 1FZKB 1I9IH 4Y4HA 3ZQ9A 3RKPA 1MQKL 4Y88A 3RDTD 4DT2A 1P84K 5FO2A 4HIIB 1T5WB 3NQ9A 4K3DH 4DSYA 1NCGA 2E74C 2V3DA 1D7CA 3A21A 4P46D 1QLRB 4EN3C 3T2NH 2ZWZA 4UIMA 3SO5A 3MPCA 4QIRA 2YBRB 2IDSA 4HH9A 3RI5F 2XYCA 2JW1A 4LE8A 5KVDL 1MRCH 1AZUA 1G0DA 3WAJA 2Y6SD 4BX7A 3ZZVA 1ZLEA 2A74C 3NX2A 5AG8A 3D9AL 4LQZA 1TT6A 4YVBA 1USZA 3F7VA 1RVFL 3NIDE 3V52L 2OTWA 3KLKA 1N5YL 2PR4H 3KPPB 3SZKC 4CL7A 3NZ8B 1YEEH 1KZYA 4DP0X 5HYQB 4C59B 1RQ5A 4WBKA 2ZYSA 5DRZB 5DS2A 4I0PB 3QQ9C 4ZFXA 3FQTB 1CG9A 4XCFH 5AVWB 3S4SG 4KDVA 4M8QA 5IBUG 3D2UA 3KDPB 4FYTA 3C5JA 3O6MH 3CXDL 1CBVH 4HUWA 2LFOA 4PJIB 5D7IF 4UNVA 1T5XA 4BSVA 1NGPL 1WS8A 2V5MA 4EDXA 1ASQA 4LZVA 1MCPH 4G2AA 2OXHA 1ADQH 4Z8FL 1HMRA 3DGCR 3ARDA 1AIFB 3LB6C 4OSUH 4KKRA 5CXPA 3U7YH 4KNQA 4AYID 2X6AA 3P6FA 1MFDH 4I0PC 4LRNH 3O8XB 5EOCL 4DVRH 1BJ1H 3QNXA 5EZPA 4KO6A 3HRZB 3HOGA 2BZDA 3P4MB 3QNYA 2VN3A 3U6RB 1UCBL 3KPMB 2OL3A 4OUOA 1DZKA 4CN4A 3Q34A 2F53D 1STRB 4ZOEA 1Z9SB 2Y24A 1MUJB 1WFNA 2W0PA 5FHAL 1NFDF 2H3KA 2QKIA 1XWVA 5MP6L 5H9KA 1I7UA 4WKZB 3SGKC 5BW7C 5H2BB 1U8JA 1V3LA 5IBTH 5DUBB 3VTAA 4PRNA 3O8XC 4Q0XH 2J20A 3KBEA 1MWOA 2BS8A 3ILQC 3MRMB 3PLYA 5HDBE 2LU7A 5HJDA 5C6TH 1TOUA 1TZAA 1TCRB 1TVQA 3T2XA 1VZGA 4P2RB 5D1QD 4Z18A 1NIDA 1LYQA 4FMFA 1XGUA 1UEMA 3EOYG 4L5FL 1G9EA 5E03A 3SCMB 1A9EB 4EDWH 4IBSA 1YMHB 1WBZA 3M1CA 1XF5B 4NRXB 2W5PA 1A7RH 1T83C 1VADB 2GTZA 4R3SA 1CDHA 1PL3A 4IAWA 2VL5A 3MLRL 1QYGH 2D9CA 3WIHA 4X5XB 5I75B 4FG0A 4GJVA 2EIZB 2X4QA 5HWZA 1FL5B 3KXFE 1C8QA 1ZNLA 2J4WH 4LU5L 1UYWH 4CMMA 3QHZH 3UIZA 2G5BA 1DFBH 4PI2A 5EH1A 1H9VA 5E24E 1XL4A 4KKNA 4U33A 1IQWL 5CBAA 4JN1L 4OUUA 2MCPL 4XMLH 4YNYB 3S96A 1R47A 3ZTJG 4GGZA 3SCMC 4NUGL 2N1KA 4LLQB 3OR7A 4N26A 3UTTD 2BIIA 1KXQE 2BHUA 2V7HB 3QQNA 1WA1X 4KI5D 4I3SL 3RUGB 4WEBH 3NEOA 5I75C 1ZNDA 3V55A 4IOFC 1T4KB 1CFQB 4ZUTA 5C0EB 2O5ZH 3RHWK 3OV6A 1HU8A 4F37K 1QSFA 1NCAH 3GSQB 4Y9FA 2V5SA 2EEXA 4PRID 3HWFA 4YBPA 2AK1L 4P57A 4PJAE 4F7TA 4LHUA 4NQCD 2KZBA 3IGAA 3NAAH 1CMOA 1EZVY 3QR1A 2XKLA 5E4EB 1T22A 2E8ZA 2FO8A 2CALA 3ULAB 2YAQA 2Y1ZA 2Y7QB 5F7FA 4AX3A 1XTMA 4XOEA 2WSJA 2FNBA 4XNXH 4ZD3H 2VW4A 1SUJA 3T3PE 4FLHA 1CGVA 1CQYA 3APFA 2RA6A 4PJ7F 2FLJA 4PRDB 4HXAH 1X89A 1I3RB 5D7HA 2VLKB 1NQNA 1H3UA 3T6FA 4IB9A 4Y5YB 1JP5A 5E4EC 5IP4A 1VRSA 3QQ3B 2DWDA 3UYOD 1ZNGA 3Q43A 3JTTA 2DMBA 1U8LB 2VR8A 1BFVL 3OKEA 5IREA 1AY1L 4NB7A 3MLYL 2A3TA 3AVEA 2E76C 1YN7A 2YQGA 4ANKA 2COQA 2DYPB 5IHUH 1ZK9A 2XLLA 3D39A 4LIQL 4OQTH 3M45A 1KCUH 5DMGD 5D45A 2OY8A 5B21A 5I2IB 5FUCE 1MLBA 4Y5YC 1ZHLB 1FPTL 1N3NA 1U8PB 5HVWA 1N67A 5DZAA 5LLIC 5CO1A 2Q6WB 3B34A 3P54A 3PWVB 2AQPA 1YYLL 3QQDA 2CGRL 2QPSA 1N64L 4UIMB 1YIVA 4HH9B 1U58B 2Q2MA 5A6MA 3LPPA 2I5YH 3MLVH 4NZJA 3BS2A 1MFBL 3I6GA 5ALCH 4U31A 4W4OA 1NBVL 3CQRA 4GDZA 2EQDA 2IH1A 3X1GA 3MV8E 1IGYA 4EIGB 1HCVA 4JY4B 4LCIH 2OTWB 3OG6B 5DEFA 5CCGE 1S7TB 4QHMB 2MOGA 2GT9B 4YGZA 2X28A 1DVUA 1E8ZA 4GXUN 1UXWA 2WMPA 3M8OL 4PS7A 3VXPA 1SA8A 1DQQB 4ZTPL 2LU3A 5FYJH 1WAEA 2QO4A 4ML7B 4KI5F 2HPTA 2WPGA 1YWDA 2C9UA 2A9ML 1J0IA 1FC2D 1FVCB 4N7CA 2OTPA 2WLIA 3GZOA 4HHGA 5EZLB 4XMPH 4U7KA 1MAKA 3VH8A 4EDXB 1O9ZA 1A3YA 3WHE1 3WNJA 3RP1A 5DYOA 2GUOA 4UTBA 3LEVH 3MV01 3DXAA 1SJHB 1WT5C 2XI9A 4UANA 4X4KA 3ULUD 2FYVA 3SKUD 4UU3A 1IGFL 2Z8RA 4J2QA 4LOFA 5GS2D 1XCXA 1TZ8A 4JRLA 4XRCB 5J6SA 4ZUWB 1E9QA 3CVBA 1YUKB 4N90D 3AGWA 1EHXA 2VLJA 3P30L 3PGFH 5IB3A 1ZVYA 4G9FE 5DZNA 3FEKA 2OL3B 4IK7A 3PWNA 1FIGH 3VXUD 1X5IA 1AS8A 2AEIT 3RDSA 4MA8L 4FHJA 3BW9A 5IFJB 1FE8H 1KT3A 4YHPA 4QUOA 1LELA 1A25A 2HT4C 4PFEA 3BH9B 5DK3A 1IGMH 1JV2A 1U8JB 5TQ0L 3PS6A 2VJXA 3K2IA 1SLDB 2AF5A 5JDJA 2XVGA 4YVUA 5EU7E 3SE4A 3KEDA 1F8TL 2UZYA 2Y7OA 1IC4L 5DD0H 2P5WB 5I5IA 4GIOA 3US1A 2XTLA 4NFBA 5TF1H 5HAEA 2K62A 5D48A 1INEH 1T80A 2NCEA 3DHJA 4GI9A 4JFDD 5DJYA 3EGXB 5K9OB 1E4XI 4J3XA 5FB8A 5L6YL 3D06A 4DP4X 1MX8A 1B88A 2PWHA 2X89A 3RDOA 1H3TA 1FHGA 1ZHBA 1HEZB 3OKKA 4CDCA 1STPA 1C16B 3RTLA 1AAJA 2YPVH 1YEEL 3RKGA 3CXHK 4KMTL 3SN6N 3LZOA 4N0FB 2ZYRA 3DO7B 2WZAA 2O5YH 3KPLA 5J6GB 1NUFA 4N9GB 5ERWB 4YZFF 1VIWA 4F9LC 1MHPL 1Y07A 3L54A 2YD6A 3DJSA 3O6ML 5DHXB 2EH8H 2B1AH 5CZRA 1MDTA 3MLXH 3MYZA 1D5XB 4ZUTB 1NLDH 5F7DA 1E4KA 4KUZH 4ONFL 2XC8A 4WHTB 4O02B 4OGXH 5K93A 1QSFB 2Y3EA 2IDFA 4WKXA 5CFAA 1MCPL 4MXVF 1YNKH 3NJLA 5AW6B 4PB9L 5CEZH 5LCVA 2OL3L 2XN9B 2BY1A 1M7IB 2K4AA 3DK2A 4OJCA 3U7YL 2NUPA 5AFAA 2CKBH 1HT6A 4YHKH 4LRNL 1K3ZA 1KCVH 3SO3B 4J8QA 1A7OH 2CO7A 1XH2A 4JO4H 5HGAB 5F2FA 3WFHB 3PQYD 1JNJA 4G70B 2VCOA 3VFGH 4PY7A 4DVBA 1LWJA 1U2CA 4JM4H 3SGEH 1R0AH 2ZAIA 1Q9WA 1EEUA 3RILA 3TBTA 3THMH 5C09D 1T1ZA 4ZPTA 1SXZA 2DWDB 3SY0A 2BCKA 2NSQA 2FECL 5IBTL 6PCYA 1KGCD 3QORB 1KCKA 3SO3C 2BVPB 2APBA 5IR1A 1GZQB 5DR5H 2A6DB 3GPEA 3EFFA 4JFXB 5GGUB 3PYCA 4Q4EA 1MSPA 4Y16A 2SODB 2WYZA 4OZFB 4GW5B 4EDWL 1VFBB 5DJCA 3E6FA 3NCXA 3APDA 3G6DL 4JFTA 4PJFF 2Q9SA 3D39B 1TG8A 3MUGA 2MNUA 4OLEA 2BDNH 5INCA 4LPXA 3V9CA 3ZHFA 5FYKE 2LU4A 4WK0B 5HTEA 2CO1A 5T8IA 2WP3O 2E7LA 5A2LH 4CN6A 1U41A 4TSAH 3O2VL 3L16A 3QQDB 3QORC 5C0IA 4I0KA 1COBA 1HCYA 1H5BB 1R5IB 4O02L 4TLSA 1DBAL 1HXKA 3KXFA 5L8OA 3I6GB 1ADWA 4KJQC 1KJVB 2IH1B 4HGWB 3DDGA 2WVVB 1IGYB 3L1OH 1VKXB 4RAUA 2ZF8A 3QRGH 4AEIH 4Z7NE 1MZZA