2FRSA

Crystal structure of the f15w mutant of apo-cellular retinoic acid binding protein type ii at 1.51 angstroms resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
137
structure length
124
Chain Sequence
PNFSGNWKIIRSENWEELLKVLGVKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Cellular retinoic acid-binding protein 2
publication title The structure of Apo-wild-type cellular retinoic acid binding protein II at 1.4 A and its relationship to ligand binding and nuclear translocation.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 124
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2frsA00
5LJEA 1L6MA 1BWYA 1G85A 4QGXA 1O8VA 2P8GA 3PH5A 3AKMA 3O22A 1LFOA 4KIIA 3WXQA 1OBPA 1IFBA 2HZRA 3HWDA 3NPOA 1ZNHA 1U0XA 4LKPA 3WVMA 4ALOA 3FA7A 3FLLA 1YWCA 5HA1A 1KZXA 1VYGA 2ASNX 3IFBA 4TKJA 3ELXA 1MVGA 1TXLA 5LJBA 1PM1X 2QO4A 4RUNA 3FMZA 3STMX 2QOSC 1UZ2X 1MX8A 4XMDA 2MM3A 2KTDA 4ORYA 3VG5A 2WWPA 2AL0X 3CR6A 4EDEA 1BRQA 1A2DA 3UEXA 3I17A 1DF3A 3ZUOA 1LF7A 4AZMA 2FWVA 2WQ9A 4YGGA 4ALBA 3IA8A 1T8VA 3T1DA 3VG7A 1KGLA 2X45A 5DPQA 4XMHA 1PEEA 3VG4A 3WJGA 1PBOA 1CBSA 4ODDA 3FR2A 4OMWA 1SXXA 2W2AA 4N7CA 4YKMA 1ACDA 4BQUA 1QFTA 2NNQA 5H9KA 5D4AA 2FRSA 3B2LA 2OVEA 3B2JA 1DV9A 1KZWA 3S26A 3B2KA 5LKFA 2W2BA 4TLJA 1ZNDA 1ZNKA 4IMOA 1BEBA 1X89A 3BU1A 2A0AA 1EUOA 4YBUA 3PP6A 1X71A 4Y0QA 2KT4B 1KT4A 1OPAA 2ANSA 1DZKA 5D8JA 4A1YA 5HZ9A 1ZNEA 5LJCA 3C76X 5L8NA 1EW3A 2QO6A 3UEVA 3VG3A 1ICNA 5BVQA 1E06A 2AT5X 2K62A 3MVFA 4PSQA 1X8OA 1FELA 2AKQA 4WFUA 4YCEA 5KIDA 2AT3X 4R0BA 2AT8X 2QM9A 3BU9A 4ORRA 4Y0PA 1SY0A 1ICMA 4QYNA 5L8OA 5D47A 5EEDA 1DZMA 5F58A 3BY0A 3FENA 3ZQ3A 1ML7A 4OMXA 4D6AA 1ZNLA 5B29A 1TW4A 5HCCC 1ZRYA 5LKEA 4WFVA 1YWAA 3FEKA 3TF6A 3DSZA 1QG5A 3P6DA 4YKOA 1D3SA 4GKCA 1LIEA 2FT9A 2POAA 4TNNA 1X8QA 1HBPA 1QFVA 1ADLA 1I4UA 3KFFA 4OS8A 4EXZA 3SAOA 2ACOA 3WBGA 1SY2A 3P6CA 2R74A 4ZCBA 3JSQA 1G74A 1E00A 1KT3A 5C0NA 1QY1A 1DFVA 1E5PA 1QABE 1YWDA 2R56A 2RCTA 2CZTA 1BSYA 5KHPA 4LKTA 3RSWA 1NP1A 1SY1A 1IW2A 1A3YA 1X8UA 1JYDA 1SA8A 1N0SA 1FDQA 1GT3A 4ORXA 5D48A 4WBKA 3STNA 1GX9A 2AH7X 3U0DA 4HFOA 4ZFXA 1KOIA 4I3DA 4Y0RA 5HTDA 4YFPA 2Q39A 1GGLA 3O19A 3WJBA 5H8TA 3FA6A 4DQ4A 4IB7A 5EDBA 2G79A 4A1HA 1R0UA 5FENA 3VG2A 3ZUIA 5CE4A 2RCQA 4IAXA 4MVKA 4XMCA 1NGLA 2FLJA 1T68X 4NYQA 4YDBA 1O1VA 2QO5A 3L4RA 5F1EA 1QWDA 1E02A 2DM5A 2CM9A 3BDRA 1KT7A 5H9LA 4HPAA 3EBWA 3BSZE 4YGHA 1KT5A 1KQWA 3VG6A 3G7XA 1B8EA 3JS1A 3P6GA 5HZ8A 3PPTA 1BLRA 1LKEA 3TGAA 4TQ2A 1BJ7A 2R73A 3C78X 4NNTA 1YWBA 2LFOA 4QZTA 5IO6A 3D97A 4AZQA 1SY3A 1CBRA 3FIQA 4O9SA 3WJDA 2FS7A 3TZSA 1JYJA 1EQDA 4LZUA 1OBQA 2HMBA 3APUA 4BVMA 2Q4NA 3DTQA 3APWA 2OFMX 4RUUA 5F7GA 4ZJ0A 1YP7A 2XSTA 1OEJA 1YUPA 3HWGA 4GNYA 4N7DA 5HCEC 3WJCA 1VPRA 1DZJA 3C77X 2JU3A 5HZQA 2NNEA 2LB6A 2CM4A 5FFHA 4Y0SA 4ARHA 1S7DA 2W2FA 1S44A 3UEUA 1RBPA 1JZUA 1ALBA 1I05A 1RLBE 2O62A 1GKAB 1EALA 2WEXA 5DG4A 1GKAA 2FS6A 3UEWA 4ZHCA 4HPBA 2CBSA 2K23A 4AYHA 5JR8A 1X8PA 4QZUA 4QAEA 5LJDA 2ALLX 4UU3A 2YG2A 1HN2A 3K3LA 4XMGA 1BBPA 1HMTA 1FE3A 1GT4A 4CK4A 2L68A 1A57A 4I9RA 3P6EA 2JOZA 4ZHGA 2HYSA 4GE1A 1JJJA 4TKHA 1A18A 3FW4A 1HBQA 2WUTA 1JBHA 3OJYC 5H9NA 3NQ3A 1O1UA 2BLGA 2EU7X 3GAQA 5F6BA 1I06A 3U9PC 4ZGUA 4YMYA 2AMMX 4A8ZA 5HA0A 3KZAA 1ZNGA 1JJXA 3CMPA 5HBSA 3PH6A 4AW8A 3CWKA 1U18A 1B4MA 4A60A 1BSOA 3HWFA 2X46A 2LBVA 3RZYA 4IB6A 1KT6A 2MJIA 4NNSA 1EXSA 1B0OA 3D96A 2CBRA 4TKBA 4K19A 3NADA 4YFQA 3ELZA 4IMNA 1IKEA 1SXWA 1UREA 2LKKA 1S2PA 1I04A 1SXYA 5AQ6A 1AVGI 2XKLA 2A2GA 1Z24A 2RD7C 4NP1A 5EPQA 3NR3A 3FEPA 3MBTA 1IKJA 5FAZA 2RQ0A 3TGCA 4NLJA 1GT1A 1P6PA 1OBUA 4AZPA 1EIIA 3FR4A 5BVSA 2GC9A 4YGZA 1B56A 3FW5A 4QGWA 4IB9A 2NNDA 4OS0A 3NX1A 3WJEA 1PMPA 4ZHDA 3AKNA 3BS2A 2GTFX 3CBSA 2HNXA 3HK1A 5HTEA 4XMFA 1LNMA 1EIOA 1IFCA 5HAEA 2GJ5A 2JU7A 1QQSA 2HLVA 5EEEA 3B2IA 4I9SA 4YFRA 2HZQA 5H9AA 5HZ5A 5HCDC 1GT5A 1XKIA 3BX8A 1TOWA 3BX7A 1FENA 2AT6X 4I3CA 4LZVA 1OEKA 4YDAA 3TGBA 2N93A 1HMSA 5LJHA 5EDCA 5HWZA 5KICA 1CJ5A 4M6SA 3QKGA 2FR3A 1GM6A 1D2UA 4IBAA 4AZNA 3EYCA 1GX8A 2FTBA 1YP6A 4ORWA 3Q6LA 4YH0A 1T0VA 2A3FX 3CBCA 1MDCA 2WR6A 1TOUA 3KFIA 3D95A 3P6HA 5IO5A 1ERBA 1EPAA 5K06A 1G5WA 5BVTA 2NP1A 2ACPX 2MO5A 3FA8A 1NP4A 5HZ6A 5L8IA 1BRPA 4M7MA 2OZQA 3FR5A 1AB0A 3P6FA 1DC9A 1FEMA 4GNWA 4ZHHA 3KQ0A 3PECA 1HMRA 4MVLA 4UU2A 1GXAA 2LBAA 4HPCA 2JN3A 3NX2A 4QGVA 3BRNA 3KFGA 1MX7A 3HWEA 3BLGA 5EZ2A 1ERXA 2OFRX 1X8NA 4ZHFA 4IB8A 1FTPA 4ES7A 5IO7A 4YCHA 2AT0X 4EFGA 1LICA 3I0AA 1AQBA 2E4JA 4MVIA 4AZOA 2RA6A 1U17A 4IAWA 4QYPA 1JV4A 4NLIA 4ORUA 2WQAE 1AELA 2OVAA 5F6ZA 4ZH6A 2G78A 3FELA 4I3BA 2G7BA 1CBQA 2OVDA 1MUPA 4ZH9A 2Q9SA 3WJFA 3EM0A 2PY1A 3EBKA 2F73A 4ZR2A 2L5PA 3PEDA 3F8AA 1DZPA 4NYRA 1KQXA 3CQNA 2A2UA 4AZRA 1VYFA 2Q2PA 1TVQA 3FA9A 4D6BA 2IFBA 3KFHA 1BSQA 2JU8A 2CZUA 5D45A 1SXUA 2WSJA 2L67A 4GRJA 5LJGA 1IIUA 2WEWA 4EEJA 3CQRA 1CBIA 1G7NA 3APXA 1OEEA 5B27A 1LIDA 4GH7A 3U03A 1XCAA 1YIVA 3B2HA 3APVA 3EMMA 2A13A 1QY0A 4XMEA 5LJKA 3NP1A 4GETA 1QY2A 4ORSA 4HPDA 1LPJA 4BOEA 1KXOA 4OS3A 4YBPA 2FR2A 1BM5A 1OPBA 1LIFA 1CRBA 3STKA 1H91A 2Q2MA 2L9CA 4TJZA 3NQ9A 1EPBA 4DQ3A 3F9DA 3O2YA 1HQPA 1LIBA
chains in the Genus database with same CATH superfamily
4GGZA 5LJEA 1L6MA 1NBXA 4O49A 1BWYA 1G85A 4QGXA 1O8VA 2P8GA 1RXJA 3PH5A 3AKMA 2A5CA 3O22A 1LFOA 4KIIA 3WXQA 4C5PA 2Y3FA 1OBPA 1UYOX 1IFBA 2HZRA 3HWDA 3NPOA 1ZNHA 1U0XA 1W5RA 4LKPA 3WVMA 3WYPA 4ALOA 2RTOB 3FA7A 3FLLA 3FYFA 1YWCA 1JMXA 5HA1A 2AVIA 1SRIA 1KZXA 1VYGA 2ASNX 2MHDA 1VYOA 3IFBA 1SRHA 3ELXA 4O4OA 4TKJA 4JNJA 3VU1A 1MVGA 1TXLA 1WBIA 3AUMO 3HOLA 5LJBA 1PM1X 2QO4A 4RUNA 3FMZA 3STMX 2QOSC 4CSBA 1UZ2X 1K3BA 1MX8A 4XMDA 2MM3A 2ZAIA 2KTDA 4ORYA 1SWKA 3VG5A 2WWPA 2AL0X 3CR6A 4EDEA 1BRQA 1A2DA 3UEXA 3I17A 4MISA 4QRLA 1DF3A 3ZUOA 4BX7B 1LF7A 3EW2A 4AZMA 4BX7A 2FWVA 2WQ9A 4I6SA 3EC5A 3IA8A 1T8VA 2OVSA 4YGGA 3ZW1B 4ALBA 3T1DA 3VG7A 3ZW1A 3FDCA 4GJSA 3ZW2A 2A5BA 1KGLA 2Z4IA 1KL4A 1VWJB 3S60A 2X45A 5DPQA 1SWRA 4DCBA 4JO6A 4XMHA 3D9WA 5FQ6E 4CV7A 4GJVA 1PEEA 4IABA 1RXKA 3VG4A 3WJGA 1PBOA 3NBXX 4L1NA 1CBSA 4ODDA 2RTGB 3FR2A 4GUZA 4OMWA 1SXXA 2W2AA 4N7CA 4OELA 4YKMA 1ACDA 4BQUA 1QFTA 3CKGA 3OD9A 2NNQA 1SMPI 5H9KA 1MM9A 4KC7A 5D4AA 2FRSA 3B2LA 1WUBA 2OVEA 3B2JA 1DV9A 1KZWA 3S26A 3B2KA 5LKFA 2FHNX 2W2BA 4TLJA 1JJUA 1ZNDA 3VE2A 3ZI8A 1ZNKA 4IMOA 1BEBA 1VWCB 3LTWA 2JGSA 3S5XA 1X89A 1FJ1E 3BU1A 4QQ1A 2A0AA 1EUOA 3HPEA 4YBUA 3PP6A 1X71A 4Y0QA 2KT4B 1KT4A 1OPAA 2ANSA 1DZKA 1PBYA 5D8JA 4A1YA 1ZNEA 5HZ9A 5LJCA 1N43A 3C76X 4GK9A 1EW3A 2IZHB 3WZQA 5L8NA 1SWSA 2QO6A 3RDSA 2OL6O 3UEVA 2X55A 2KD2A 3D4RA 3P24A 3VG3A 1ICNA 5BVQA 3GE2A 1E06A 1SWPA 2AT5X 2K62A 2MF6A 1X8OA 1FELA 2AKQA 3MVFA 4PSQA 4WFUA 1KL3A 5KIDA 2AT3X 4R0BA 4U3QA 3P02A 2VDFA 2AT8X 2QM9A 3ZWEA 4HWMA 3BU9A 4ORRA 1SLEB 1SY0A 1ICMA 4QYNA 4Y0PA 4Y5DA 2UYWA 5D47A 1DZMA 5EEDA 1JQPA 1HQQA 5F58A 3BY0A 3FENA 3ZQ3A 2IZAA 1ML7A 4OMXA 4D6AA 4ML7B 1ZNLA 3S5VA 5B29A 1TW4A 1VWQB 5HCCC 1ZRYA 1SRGA 5LKEA 4WFVA 1YWAA 3T2XA 5K67A 3FEKA 2OYBO 3TF6A 3DSZA 1QG5A 2QMIA 1RXHA 3P6DA 1D3SA 4GKCA 4YKOA 1LIEA 3RDUA 2RTNB 2FT9A 2POAA 4TNNA 2IZLB 1X8QA 3AEHA 2JMBA 1HBPA 1QFVA 4FBRA 1ADLA 1I4UA 1LCZA 2RTCB 3JQOA 3KFFA 2IZKA 4OS8A 3VPJE 4EXZA 3SAOA 3MX7A 4KH8A 2ACOA 4GGRA 3WBGA 1SY2A 5AJCA 3P6CA 2R74A 4ZCBA 1VWHB 4EKVA 1VWKB 1Y55X 3JSQA 3MM0A 4L3RA 1G74A 1N9YA 1E00A 4OEMA 1KT3A 5C0NA 1QY1A 4NV8A 2VFCA 1DFVA 1E5PA 1QABE 1YWDA 2R56A 2RCTA 4O3XB 2CZTA 2FHLA 1BSYA 4O4SA 5KHPA 5F2BA 4LKTA 3RSWA 1NP1A 1SWEA 1SY1A 1IW2A 2X56A 1A3YA 1X8UA 1JYDA 1VWBB 4KT5A 2OY5O 1SA8A 1N0SA 1RSUB 1FDQA 1GT3A 1KFFA 4ORXA 2VFBA 5D48A 3LV4A 4WBKA 3STNA 1GX9A 2AH7X 3U0DA 4HFOA 4ZFXA 1KOIA 4U8UO 3PQUA 4I3DA 3RDOA 4Y0RA 5HTDA 4YFPA 2Q39A 3RDXA 5IXGA 1GGLA 3O19A 3WJBA 3WYQA 1EI5A 5CHKA 5H8TA 3FA6A 4DQ4A 4BX5B 4IB7A 5EDBA 4I60A 2RTAA 4BX5A 2G79A 4FBOA 4A1HA 1N9MA 1R0UA 2RTEB 4ON1A 5FENA 3RKGA 3VG2A 3ZUIA 1I78A 5CE4A 2RCQA 4IAXA 4MVKA 4XMCA 1NGLA 1VWPB 2FLJA 4MVEA 5CYBA 1T68X 3X00A 3PQSA 4NYQA 4BX6B 4YDBA 1O1VA 2PI3O 2QO5A 3L4RA 1QWDA 5F1EA 4BX6A 2Y32A 1E02A 2DM5A 2CM9A 2F09A 3BDRA 1KT7A 5H9LA 3ZW0B 4HPAA 1SWDA 3EBWA 3BSZE 4YGHA 2X4MA 1KT5A 1KQWA 3RE5A 2IZGB 3G7XA 1B8EA 2RTIB 1VWEB 3JS1A 5B11O 3P6GA 3VG6A 4CDCA 5HZ8A 3PPTA 1BLRA 1LKEA 3V8UA 3TGAA 3VHIA 4LQZA 1IJ8A 4TQ2A 1BJ7A 1VWRB 2R73A 3C78X 1YWBA 2LFOA 4I95A 4NNTA 4QZTA 3D97A 5IRUA 4IRWA 3ZW0A 4AZQA 1SY3A 1Y9TA 1CBRA 3FIQA 4Z28A 4O9SA 3N91A 2FS7A 5B10O 3WJDA 3TZSA 1JYJA 1EQDA 2G5LA 4LZUA 2OF8A 4ZGFA 1OBQA 2F01A 2HMBA 3APUA 3QQ2A 4BVMA 2Q4NA 4MIRA 4O3YA 3DTQA 3APWA 3PDFA 1VWOB 2OFMX 4RUUA 5F7GA 2HKDA 4JHQA 4ZJ0A 1YP7A 2XSTA 4O3ZA 4KC8A 1OEJA 4COTA 1YUPA 3HWGA 4GNYA 4N7DA 5HCEC 3WJCA 1VPRA 1DZJA 3C77X 2JU3A 5HZQA 2IZCB 3LHNA 2NNEA 2LB6A 1VWGB 2CM4A 2A8GA 4ID2A 5FFHA 2IZBA 4Y0SA 2Y3EA 1SWJA 1S7DA 4ARHA 2JW1A 2W2FA 1S44A 3UEUA 1RBPA 1JZUA 1ALBA 1I05A 1RLBE 2O62A 4YCEA 1GKAB 4GZVA 1VWDB 1VWNB 2OF9A 1EALA 2WEXA 5DG4A 1GKAA 2FS6A 3UEWA 4ZHCA 1SWNA 2C1QA 2RTMA 4HPBA 4Z2OA 2CBSA 2K23A 4AYHA 5JR8A 3FIDA 1X8PA 1LDOA 4QZUA 4QAEA 5LJDA 5AEOA 2ALLX 4UU3A 2IZIA 1K24A 2YG2A 2RTKA 1HN2A 1VWFB 3K3LA 4XMGA 1BBPA 1OSPO 1HMTA 4JGLA 1SWFA 1FE3A 1GT4A 4CK4A 2L68A 5B3MO 1STRB 1A57A 4I9RA 2X32A 3P6EA 3WZNA 2JOZA 4ZHGA 2ZSCA 2HYSA 3VGWA 4GE1A 3SLJA 1JJJA 1UYNX 2RTRB 2IZDB 1A18A 2RTLA 4TKHA 4QNIA 2FKJA 3VHMA 3FW4A 1HBQA 2WUTA 3SOTA 3OJYC 3H3IA 5H9NA 1JBHA 2AF5A 4O3WA 1VWAB 3RDMA 3NQ3A 1O1UA 2BLGA 2EU7X 3GAQA 5F6BA 1I06A 3U9PC 4ZGUA 4YMYA 2AMMX 3SLTA 4A8ZA 5HA0A 3KZAA 1ZNGA 2C4IA 2GTLO 2KW1A 2OFAA 3CMPA 3HTYA 5HBSA 3PH6A 1SWAA 2RTDB 1NDJA 3CWKA 1U18A 1AVDA 4AW8A 1B4MA 5JD2A 4A60A 1BSOA 3HWFA 2X46A 2LBVA 3RZYA 2IZFB 1KT6A 4IB6A 2MJIA 4NNSA 3EW1A 1VWMB 1EXSA 1B0OA 1VWLB 2BS5A 2CBRA 1LCWA 3D96A 3SZJA 2GTLM 3T6LA 1I9HA 2QOMA 4TKBA 4K19A 1N7YA 2IZJA 3NADA 4YFQA 5L3YA 2LA7A 2I5ZO 3ELZA 4IMNA 1IKEA 1SXWA 1UREA 2LKKA 5L8OA 1S2PA 2QCBA 1STSB 3HOEA 3KVNA 1I04A 1RAVA 1W4TA 1SXYA 5AQ6A 1AVGI 2XKLA 2A2GA 4NV7A 4BJ8A 1Z24A 2RD7C 4NP1A 3RE6A 5EPQA 3NR3A 4PJ2A 4OKAA 2MWHA 3VE1A 2RTBB 3FEPA 3MBTA 1IKJA 4GDAA 2RQ0A 5FAZA 3TGCA 4NLJA 1GT1A 4FGIB 1P6PA 1OBUA 2OY7A 4AZPA 1MOYA 1SREA 3T6FA 1EIIA 2OL8O 3FR4A 2GC9A 5BVSA 4YGZA 1B56A 3FW5A 4QGWA 4IB9A 2NNDA 2BT9A 3NX1A 4OS0A 1PMPA 3WJEA 4ZHDA 4U8UM 3AKNA 2OL7A 3BS2A 2GTFX 1SWUA 3CBSA 2HNXA 2RTJA 4GDZA 3HK1A 2DJFA 5IRAA 2ZAGA 1JIWI 5HTEA 4XMFA 1LNMA 4GD9A 1EIOA 2Z4HA 2OFBA 1IFCA 1LELA 5HAEA 2GJ5A 2JU7A 4GGTA 1QQSA 2FGSA 2HLVA 5EEEA 1HY2A 1W6FA 3B2IA 4I9SA 3RY1A 4YFRA 1JJXA 1SLFB 2HZQA 1LDQA 5H9AA 5HCDC 1SWQA 5HZ5A 1GT5A 1XKIA 4MEEA 3BX8A 1TOWA 3BX7A 1FENA 2AT6X 4I3CA 4LZVA 1LUQA 1OEKA 2BS6A 4YDAA 4YVBA 4Z6JA 3TGBA 2N93A 1HMSA 5LJHA 5EDCA 5HWZA 5KICA 1CJ5A 5AJBA 4M6SA 2X8SA 3QKGA 2FR3A 1GM6A 1D2UA 2BSZA 4IBAA 3RWXA 4AZNA 3EYCA 1GX8A 2FTBA 1YP6A 1DF8A 2BC3A 3SLOA 1Y53X 2G8CO 4ORWA 2X8FA 3Q6LA 4O4UA 1NC9A 4YH0A 1T0VA 1RSTB 2A3FX 2YMSA 1NQNA 1AVEA 3CBCA 1MDCA 2WR6A 1TOUA 2GH7A 3KFIA 3UAQA 5FQ8E 3D95A 3P6HA 4NW4A 3T2WA 1ERBA 5IO5A 1SWBA 1EPAA 3OBLA 4INNA 2CAMA 5BVTA 5K06A 4FQBB 4BBOA 1G5WA 2NP1A 2KTSA 2GTLN 2ACPX 1HXLA 2MO5A 1SLGB 3WZOA 1PTSA 3FA8A 1NP4A 4GU8A 4CPEA 5HZ6A 4CPFA 5L8IA 1HXZA 3CKFA 3NQKA 1STPA 4CPIA 1BRPA 2X34A 4M7MA 3WZPA 4CDEA 4Z27A 1MK5A 2OZQA 4Z2VA 3FR5A 3VHHA 1AB0A 2DJGA 1DC9A 1FEMA 3P6FA 4GNWA 3KQ0A 4ZHHA 3PECA 1HMRA 4MVLA 5CSEA 5B2AO 4UU2A 1GXAA 2BHVA 2LBAA 2JN3A 4HPCA 3NX2A 4QGVA 2C1SA 3BRNA 3KFGA 1MX7A 1SWLA 3BLGA 3HWEA 5EZ2A 1ERXA 3SZIA 2OFRX 5IO6A 4U8UN 1X8NA 2UZ2A 4ZHFA 1Y9LA 1FTPA 4IB8A 3SZHA 3Q34A 4ES7A 5IO7A 3OE3A 4YCHA 1SWHA 2AT0X 3ZZVA 1LICA 4EFGA 5BYPA 1SRFA 4U46A 3I0AA 3E3CA 1AQBA 2E4JA 2WPUA 4MVIA 4AZOA 2RA6A 1N4JA 1U17A 4IAWA 3RBYA 4QYPA 1JV4A 4BCSA 4NLIA 4ORUA 2WQAE 1AELA 2IZEB 2OVAA 5F6ZA 4CPHB 4ZH6A 3MG5A 2G78A 3FELA 4I3BA 4CPHA 2RTPB 2G7BA 1CBQA 2OVDA 1MUPA 4ZH9A 2Q9SA 3WJFA 3EM0A 4WHIA 1E2TA 1VWIB 5FQ7E 2PY1A 1MEPA 3EBKA 1SRJA 1Y52X 2F73A 4ZR2A 3RY2A 3F6ZB 2M4LA 5B5FA 4O4XA 2L5PA 3PEDA 3F8AA 1DZPA 1GX3A 5K68A 4NYRA 1KQXA 5IRWA 3CQNA 2A2UA 4AZRA 1VYFA 2Q2PA 1TVQA 3FA9A 4D6BA 4DNEA 1SWGA 2IFBA 2RN4A 1BSQA 2JU8A 2CZUA 3KFHA 5D45A 1SXUA 4BGFA 4Y59A 4Z2PA 2WSJA 1Y0GA 3RDQA 2L67A 4GRJA 5LJGA 1IIUA 2RTHB 2WEWA 4CDDA 4EEJA 3CQRA 1CBIA 1G7NA 3APXA 4CDFA 1OEEA 5B27A 1LIDA 4GH7A 3U03A 1SWTA 1XCAA 1NQMA 4FBVA 2I5VO 3PK2A 1YIVA 3B2HA 1JMZA 4EQAC 3APVA 3EMMA 1LCVA 1QY0A 2A13A 4U9CA 4XMEA 5LJKA 3NP1A 4GETA 5B5GA 1SLDB 1QY2A 4ORSA 1KL5A 4HPDA 1LPJA 4BOEA 1KXOA 4OS3A 2FKGA 4YBPA 2FR2A 1SWOA 1OPBA 2RTQB 1BM5A 1LIFA 1CRBA 4KCAA 1H91A 3STKA 2OY8A 2Q2MA 2L9CA 4TJZA 3NQ9A 1EPBA 3WOVA 2RTFB 2X8TA 2OY1O 4DQ3A 3F9DA 3O2YA 4B55A 1HQPA 1LIBA 1SWCA
chains in the Genus database with same CATH topology
5LJEA 1L6MA 4O49A 1BWYA 1G85A 4QGXA 1O8VA 2P8GA 3PH5A 3AKMA 3O22A 1LFOA 4KIIA 3WXQA 1OBPA 1IFBA 2HZRA 3HWDA 3NPOA 1ZNHA 1U0XA 4LKPA 3WVMA 4ALOA 3FA7A 3FLLA 3FYFA 1YWCA 5HA1A 1KZXA 1VYGA 2ASNX 2MHDA 3IFBA 4TKJA 3ELXA 4O4OA 3VU1A 1MVGA 1TXLA 3HOLA 5LJBA 1PM1X 2QO4A 4RUNA 3FMZA 3STMX 2QOSC 4CSBA 1UZ2X 1MX8A 4XMDA 2MM3A 2ZAIA 2KTDA 4ORYA 3VG5A 2WWPA 2AL0X 3CR6A 4EDEA 1BRQA 1A2DA 3UEXA 3I17A 4MISA 4QRLA 1DF3A 3ZUOA 1LF7A 4AZMA 2FWVA 2WQ9A 4I6SA 4YGGA 3IA8A 1T8VA 2OVSA 3ZW1B 4ALBA 3T1DA 3VG7A 3ZW1A 3ZW2A 1KGLA 2Z4IA 3S60A 2X45A 5DPQA 4XMHA 5FQ6E 4CV7A 1PEEA 4IABA 3VG4A 3WJGA 1PBOA 3NBXX 4L1NA 1CBSA 4ODDA 3FR2A 4OMWA 1SXXA 2W2AA 4N7CA 4YKMA 1ACDA 4BQUA 1QFTA 3OD9A 2NNQA 1SMPI 5H9KA 4KC7A 5D4AA 2FRSA 3B2LA 2OVEA 3B2JA 1DV9A 1KZWA 3S26A 3B2KA 5LKFA 2W2BA 4TLJA 1ZNDA 3VE2A 3ZI8A 1ZNKA 4IMOA 1BEBA 3S5XA 1X89A 3BU1A 4QQ1A 2A0AA 1EUOA 4YBUA 3PP6A 1X71A 4Y0QA 2KT4B 1KT4A 1OPAA 2ANSA 1DZKA 5D8JA 4A1YA 5HZ9A 1ZNEA 5LJCA 3C76X 4GK9A 5L8NA 1EW3A 2QO6A 3UEVA 2KD2A 3D4RA 3P24A 3VG3A 1ICNA 5BVQA 3GE2A 1E06A 2AT5X 2K62A 3MVFA 4PSQA 1X8OA 1FELA 2AKQA 4WFUA 4YCEA 5KIDA 2AT3X 4R0BA 4U3QA 3P02A 2AT8X 2QM9A 3ZWEA 4HWMA 3BU9A 4ORRA 4Y0PA 1SY0A 1ICMA 4QYNA 5L8OA 5D47A 5EEDA 1DZMA 5F58A 3BY0A 3FENA 3ZQ3A 1ML7A 4OMXA 4D6AA 4ML7B 1ZNLA 3S5VA 5B29A 1TW4A 5HCCC 1ZRYA 5LKEA 4WFVA 1YWAA 3FEKA 3TF6A 3DSZA 1QG5A 2QMIA 3P6DA 4YKOA 1D3SA 4GKCA 1LIEA 2FT9A 2POAA 4TNNA 1X8QA 2JMBA 1HBPA 1QFVA 4FBRA 1ADLA 1I4UA 3JQOA 3KFFA 4OS8A 3VPJE 4EXZA 3SAOA 3MX7A 4KH8A 2ACOA 3WBGA 1SY2A 5AJCA 3P6CA 2R74A 4ZCBA 3JSQA 4L3RA 1G74A 1E00A 1KT3A 5C0NA 1QY1A 1DFVA 1E5PA 1QABE 1YWDA 2R56A 2RCTA 4O3XB 2CZTA 4O4SA 1BSYA 5KHPA 4LKTA 3RSWA 1NP1A 1SY1A 1IW2A 1A3YA 1X8UA 1JYDA 4KT5A 1SA8A 1N0SA 1FDQA 1GT3A 4ORXA 5D48A 3LV4A 4WBKA 3STNA 1GX9A 2AH7X 3U0DA 4HFOA 4ZFXA 1KOIA 4U8UO 3PQUA 4I3DA 4Y0RA 5HTDA 4YFPA 2Q39A 1GGLA 3O19A 3WJBA 1EI5A 5H8TA 3FA6A 4DQ4A 4IB7A 5EDBA 2G79A 4FBOA 4A1HA 1R0UA 4ON1A 5FENA 3RKGA 3VG2A 3ZUIA 5CE4A 2RCQA 4IAXA 4MVKA 4XMCA 1NGLA 2FLJA 4MVEA 5CYBA 1T68X 3PQSA 4NYQA 4YDBA 1O1VA 2QO5A 3L4RA 5F1EA 1QWDA 1E02A 2DM5A 2CM9A 2F09A 3BDRA 1KT7A 5H9LA 4HPAA 3EBWA 3BSZE 4YGHA 1KT5A 1KQWA 3VG6A 3G7XA 1B8EA 3JS1A 3P6GA 5HZ8A 3PPTA 1BLRA 1LKEA 3V8UA 3TGAA 4LQZA 4TQ2A 1BJ7A 2R73A 3C78X 4I95A 1YWBA 2LFOA 4NNTA 4QZTA 3ZW0B 3D97A 4AZQA 3ZW0A 1SY3A 1Y9TA 1CBRA 3FIQA 4O9SA 3N91A 2FS7A 3WJDA 3TZSA 1JYJA 1EQDA 4LZUA 4ZGFA 1OBQA 2HMBA 3APUA 4BVMA 2Q4NA 4MIRA 4O3YA 3DTQA 3APWA 2OFMX 4RUUA 5F7GA 4ZJ0A 1YP7A 2XSTA 4O3ZA 4KC8A 1OEJA 4COTA 1YUPA 3HWGA 4GNYA 4N7DA 5HCEC 3WJCA 1VPRA 1DZJA 3C77X 2JU3A 5HZQA 3LHNA 2NNEA 2LB6A 2CM4A 4ID2A 5FFHA 4Y0SA 4ARHA 1S7DA 2JW1A 2W2FA 1S44A 3UEUA 1RBPA 1JZUA 1ALBA 1I05A 1RLBE 2O62A 1GKAB 4GZVA 1EALA 2WEXA 5DG4A 1GKAA 2FS6A 3UEWA 4ZHCA 4HPBA 2CBSA 2K23A 4AYHA 5JR8A 1X8PA 4QZUA 4QAEA 5LJDA 5AEOA 2ALLX 4UU3A 2YG2A 1HN2A 3K3LA 4XMGA 1BBPA 1HMTA 4JGLA 1FE3A 1GT4A 4CK4A 2L68A 1A57A 4I9RA 3P6EA 2JOZA 4ZHGA 2HYSA 4GE1A 1JJJA 4TKHA 1A18A 4QNIA 3FW4A 1HBQA 2WUTA 3SOTA 3OJYC 3H3IA 5H9NA 1JBHA 4O3WA 3NQ3A 1O1UA 2BLGA 2EU7X 3GAQA 5F6BA 1I06A 3U9PC 4ZGUA 4YMYA 2AMMX 4A8ZA 5HA0A 3KZAA 1ZNGA 2GTLO 3HTYA 2KW1A 3CMPA 5HBSA 1JJXA 3PH6A 4AW8A 3CWKA 1U18A 1B4MA 4A60A 1BSOA 3HWFA 2X46A 2LBVA 3RZYA 4IB6A 1KT6A 2MJIA 4NNSA 1EXSA 1B0OA 2BS5A 2CBRA 3D96A 2GTLM 4TKBA 4K19A 3NADA 4YFQA 2LA7A 3ELZA 4IMNA 1IKEA 1SXWA 1UREA 2LKKA 1S2PA 3HOEA 1I04A 1SXYA 5AQ6A 1AVGI 2XKLA 2A2GA 1Z24A 2RD7C 4NP1A 5EPQA 3NR3A 4PJ2A 2MWHA 3VE1A 3FEPA 3MBTA 1IKJA 5FAZA 2RQ0A 3TGCA 4NLJA 1GT1A 4FGIB 1P6PA 1OBUA 4AZPA 1EIIA 3FR4A 5BVSA 2GC9A 4YGZA 1B56A 3FW5A 4QGWA 4IB9A 2NNDA 2BT9A 3NX1A 4OS0A 1PMPA 3WJEA 4ZHDA 4U8UM 3AKNA 3BS2A 2GTFX 3CBSA 2HNXA 4GDZA 3HK1A 2ZAGA 1JIWI 5HTEA 4XMFA 1LNMA 1EIOA 2Z4HA 1IFCA 5HAEA 2GJ5A 2JU7A 1QQSA 2HLVA 5EEEA 3B2IA 4I9SA 4YFRA 2HZQA 5H9AA 5HZ5A 5HCDC 1GT5A 1XKIA 3BX8A 1TOWA 3BX7A 1FENA 2AT6X 4I3CA 4LZVA 1OEKA 2BS6A 4YDAA 3TGBA 2N93A 1HMSA 5LJHA 5EDCA 5HWZA 5KICA 1CJ5A 5AJBA 4M6SA 2X8SA 3QKGA 2FR3A 1GM6A 1D2UA 4IBAA 3RWXA 4AZNA 3EYCA 1GX8A 2FTBA 1YP6A 4ORWA 2X8FA 3Q6LA 4O4UA 4YH0A 1T0VA 2A3FX 2YMSA 3CBCA 1MDCA 2WR6A 1TOUA 3KFIA 3UAQA 5FQ8E 3D95A 3P6HA 4NW4A 5IO5A 1ERBA 1EPAA 3OBLA 4INNA 5BVTA 5K06A 1G5WA 4FQBB 2NP1A 2KTSA 2GTLN 2ACPX 2MO5A 3FA8A 1NP4A 4GU8A 5HZ6A 5L8IA 3NQKA 1BRPA 4M7MA 2OZQA 3FR5A 1AB0A 3P6FA 1DC9A 1FEMA 4GNWA 4ZHHA 3KQ0A 3PECA 1HMRA 4MVLA 4UU2A 1GXAA 2BHVA 2LBAA 2JN3A 4HPCA 3NX2A 4QGVA 3BRNA 3KFGA 1MX7A 3HWEA 3BLGA 5EZ2A 1ERXA 2OFRX 5IO6A 4U8UN 1X8NA 4ZHFA 1Y9LA 1FTPA 4IB8A 4ES7A 5IO7A 3OE3A 4YCHA 2AT0X 3ZZVA 4EFGA 1LICA 5BYPA 3I0AA 3E3CA 1AQBA 2E4JA 4MVIA 4AZOA 2RA6A 1U17A 3RBYA 4IAWA 4QYPA 1JV4A 4NLIA 4ORUA 2WQAE 1AELA 2OVAA 5F6ZA 4ZH6A 2G78A 3FELA 4I3BA 2G7BA 1CBQA 2OVDA 1MUPA 4ZH9A 2Q9SA 3WJFA 3EM0A 4WHIA 5FQ7E 2PY1A 3EBKA 2F73A 4ZR2A 3F6ZB 2M4LA 4O4XA 2L5PA 3PEDA 3F8AA 1DZPA 4NYRA 1KQXA 3CQNA 2A2UA 4AZRA 1VYFA 2Q2PA 1TVQA 3FA9A 4D6BA 2IFBA 2RN4A 1BSQA 2JU8A 2CZUA 3KFHA 5D45A 1SXUA 2WSJA 2L67A 4GRJA 5LJGA 1IIUA 2WEWA 4EEJA 3CQRA 1CBIA 1G7NA 3APXA 1OEEA 5B27A 1LIDA 4GH7A 3U03A 1XCAA 4FBVA 1YIVA 3B2HA 4EQAC 3APVA 3EMMA 2A13A 1QY0A 4U9CA 4XMEA 5LJKA 3NP1A 4GETA 1QY2A 4ORSA 4HPDA 1LPJA 4BOEA 1KXOA 4OS3A 4YBPA 2FR2A 1BM5A 1OPBA 1LIFA 1CRBA 4KCAA 1H91A 3STKA 2Q2MA 2L9CA 4TJZA 3NQ9A 1EPBA 3WOVA 2X8TA 4DQ3A 3F9DA 3O2YA 1HQPA 1LIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJE A;  1L6M A;  1BWY A;  1G85 A;  4QGX A;  1O8V A;  2P8G A;  3PH5 A;  3AKM A;  3O22 A;  1LFO A;  4KII A;  3WXQ A;  1OBP A;  1IFB A;  2HZR A;  3HWD A;  3NPO A;  1ZNH A;  1U0X A;  4LKP A;  3WVM A;  4ALO A;  3FA7 A;  3FLL A;  1YWC A;  5HA1 A;  1KZX A;  1VYG A;  2ASN X;  3IFB A;  4TKJ A;  3ELX A;  1MVG A;  1TXL A;  5LJB A;  1PM1 X;  2QO4 A;  4RUN A;  3FMZ A;  3STM X;  2QOS C;  1UZ2 X;  1MX8 A;  4XMD A;  2MM3 A;  2KTD A;  4ORY A;  3VG5 A;  2WWP A;  2AL0 X;  3CR6 A;  4EDE A;  1BRQ A;  1A2D A;  3UEX A;  3I17 A;  1DF3 A;  3ZUO A;  1LF7 A;  4AZM A;  2FWV A;  2WQ9 A;  4YGG A;  4ALB A;  3IA8 A;  1T8V A;  3T1D A;  3VG7 A;  1KGL A;  2X45 A;  5DPQ A;  4XMH A;  1PEE A;  3VG4 A;  3WJG A;  1PBO A;  1CBS A;  4ODD A;  3FR2 A;  4OMW A;  1SXX A;  2W2A A;  4N7C A;  4YKM A;  1ACD A;  4BQU A;  1QFT A;  2NNQ A;  5H9K A;  5D4A A;  2FRS A;  3B2L A;  2OVE A;  3B2J A;  1DV9 A;  1KZW A;  3S26 A;  3B2K A;  5LKF A;  2W2B A;  4TLJ A;  1ZND A;  1ZNK A;  4IMO A;  1BEB A;  1X89 A;  3BU1 A;  2A0A A;  1EUO A;  4YBU A;  3PP6 A;  1X71 A;  4Y0Q A;  2KT4 B;  1KT4 A;  1OPA A;  2ANS A;  1DZK A;  5D8J A;  4A1Y A;  5HZ9 A;  1ZNE A;  5LJC A;  3C76 X;  5L8N A;  1EW3 A;  2QO6 A;  3UEV A;  3VG3 A;  1ICN A;  5BVQ A;  1E06 A;  2AT5 X;  2K62 A;  3MVF A;  4PSQ A;  1X8O A;  1FEL A;  2AKQ A;  4WFU A;  4YCE A;  5KID A;  2AT3 X;  4R0B A;  2AT8 X;  2QM9 A;  3BU9 A;  4ORR A;  4Y0P A;  1SY0 A;  1ICM A;  4QYN A;  5L8O A;  5D47 A;  5EED A;  1DZM A;  5F58 A;  3BY0 A;  3FEN A;  3ZQ3 A;  1ML7 A;  4OMX A;  4D6A A;  1ZNL A;  5B29 A;  1TW4 A;  5HCC C;  1ZRY A;  5LKE A;  4WFV A;  1YWA A;  3FEK A;  3TF6 A;  3DSZ A;  1QG5 A;  3P6D A;  4YKO A;  1D3S A;  4GKC A;  1LIE A;  2FT9 A;  2POA A;  4TNN A;  1X8Q A;  1HBP A;  1QFV A;  1ADL A;  1I4U A;  3KFF A;  4OS8 A;  4EXZ A;  3SAO A;  2ACO A;  3WBG A;  1SY2 A;  3P6C A;  2R74 A;  4ZCB A;  3JSQ A;  1G74 A;  1E00 A;  1KT3 A;  5C0N A;  1QY1 A;  1DFV A;  1E5P A;  1QAB E;  1YWD A;  2R56 A;  2RCT A;  2CZT A;  1BSY A;  5KHP A;  4LKT A;  3RSW A;  1NP1 A;  1SY1 A;  1IW2 A;  1A3Y A;  1X8U A;  1JYD A;  1SA8 A;  1N0S A;  1FDQ A;  1GT3 A;  4ORX A;  5D48 A;  4WBK A;  3STN A;  1GX9 A;  2AH7 X;  3U0D A;  4HFO A;  4ZFX A;  1KOI A;  4I3D A;  4Y0R A;  5HTD A;  4YFP A;  2Q39 A;  1GGL A;  3O19 A;  3WJB A;  5H8T A;  3FA6 A;  4DQ4 A;  4IB7 A;  5EDB A;  2G79 A;  4A1H A;  1R0U A;  5FEN A;  3VG2 A;  3ZUI A;  5CE4 A;  2RCQ A;  4IAX A;  4MVK A;  4XMC A;  1NGL A;  2FLJ A;  1T68 X;  4NYQ A;  4YDB A;  1O1V A;  2QO5 A;  3L4R A;  5F1E A;  1QWD A;  1E02 A;  2DM5 A;  2CM9 A;  3BDR A;  1KT7 A;  5H9L A;  4HPA A;  3EBW A;  3BSZ E;  4YGH A;  1KT5 A;  1KQW A;  3VG6 A;  3G7X A;  1B8E A;  3JS1 A;  3P6G A;  5HZ8 A;  3PPT A;  1BLR A;  1LKE A;  3TGA A;  4TQ2 A;  1BJ7 A;  2R73 A;  3C78 X;  4NNT A;  1YWB A;  2LFO A;  4QZT A;  5IO6 A;  3D97 A;  4AZQ A;  1SY3 A;  1CBR A;  3FIQ A;  4O9S A;  3WJD A;  2FS7 A;  3TZS A;  1JYJ A;  1EQD A;  4LZU A;  1OBQ A;  2HMB A;  3APU A;  4BVM A;  2Q4N A;  3DTQ A;  3APW A;  2OFM X;  4RUU A;  5F7G A;  4ZJ0 A;  1YP7 A;  2XST A;  1OEJ A;  1YUP A;  3HWG A;  4GNY A;  4N7D A;  5HCE C;  3WJC A;  1VPR A;  1DZJ A;  3C77 X;  2JU3 A;  5HZQ A;  2NNE A;  2LB6 A;  2CM4 A;  5FFH A;  4Y0S A;  4ARH A;  1S7D A;  2W2F A;  1S44 A;  3UEU A;  1RBP A;  1JZU A;  1ALB A;  1I05 A;  1RLB E;  2O62 A;  1GKA B;  1EAL A;  2WEX A;  5DG4 A;  1GKA A;  2FS6 A;  3UEW A;  4ZHC A;  4HPB A;  2CBS A;  2K23 A;  4AYH A;  5JR8 A;  1X8P A;  4QZU A;  4QAE A;  5LJD A;  2ALL X;  4UU3 A;  2YG2 A;  1HN2 A;  3K3L A;  4XMG A;  1BBP A;  1HMT A;  1FE3 A;  1GT4 A;  4CK4 A;  2L68 A;  1A57 A;  4I9R A;  3P6E A;  2JOZ A;  4ZHG A;  2HYS A;  4GE1 A;  1JJJ A;  4TKH A;  1A18 A;  3FW4 A;  1HBQ A;  2WUT A;  1JBH A;  3OJY C;  5H9N A;  3NQ3 A;  1O1U A;  2BLG A;  2EU7 X;  3GAQ A;  5F6B A;  1I06 A;  3U9P C;  4ZGU A;  4YMY A;  2AMM X;  4A8Z A;  5HA0 A;  3KZA A;  1ZNG A;  1JJX A;  3CMP A;  5HBS A;  3PH6 A;  4AW8 A;  3CWK A;  1U18 A;  1B4M A;  4A60 A;  1BSO A;  3HWF A;  2X46 A;  2LBV A;  3RZY A;  4IB6 A;  1KT6 A;  2MJI A;  4NNS A;  1EXS A;  1B0O A;  3D96 A;  2CBR A;  4TKB A;  4K19 A;  3NAD A;  4YFQ A;  3ELZ A;  4IMN A;  1IKE A;  1SXW A;  1URE A;  2LKK A;  1S2P A;  1I04 A;  1SXY A;  5AQ6 A;  1AVG I;  2XKL A;  2A2G A;  1Z24 A;  2RD7 C;  4NP1 A;  5EPQ A;  3NR3 A;  3FEP A;  3MBT A;  1IKJ A;  5FAZ A;  2RQ0 A;  3TGC A;  4NLJ A;  1GT1 A;  1P6P A;  1OBU A;  4AZP A;  1EII A;  3FR4 A;  5BVS A;  2GC9 A;  4YGZ A;  1B56 A;  3FW5 A;  4QGW A;  4IB9 A;  2NND A;  4OS0 A;  3NX1 A;  3WJE A;  1PMP A;  4ZHD A;  3AKN A;  3BS2 A;  2GTF X;  3CBS A;  2HNX A;  3HK1 A;  5HTE A;  4XMF A;  1LNM A;  1EIO A;  1IFC A;  5HAE A;  2GJ5 A;  2JU7 A;  1QQS A;  2HLV A;  5EEE A;  3B2I A;  4I9S A;  4YFR A;  2HZQ A;  5H9A A;  5HZ5 A;  5HCD C;  1GT5 A;  1XKI A;  3BX8 A;  1TOW A;  3BX7 A;  1FEN A;  2AT6 X;  4I3C A;  4LZV A;  1OEK A;  4YDA A;  3TGB A;  2N93 A;  1HMS A;  5LJH A;  5EDC A;  5HWZ A;  5KIC A;  1CJ5 A;  4M6S A;  3QKG A;  2FR3 A;  1GM6 A;  1D2U A;  4IBA A;  4AZN A;  3EYC A;  1GX8 A;  2FTB A;  1YP6 A;  4ORW A;  3Q6L A;  4YH0 A;  1T0V A;  2A3F X;  3CBC A;  1MDC A;  2WR6 A;  1TOU A;  3KFI A;  3D95 A;  3P6H A;  5IO5 A;  1ERB A;  1EPA A;  5K06 A;  1G5W A;  5BVT A;  2NP1 A;  2ACP X;  2MO5 A;  3FA8 A;  1NP4 A;  5HZ6 A;  5L8I A;  1BRP A;  4M7M A;  2OZQ A;  3FR5 A;  1AB0 A;  3P6F A;  1DC9 A;  1FEM A;  4GNW A;  4ZHH A;  3KQ0 A;  3PEC A;  1HMR A;  4MVL A;  4UU2 A;  1GXA A;  2LBA A;  4HPC A;  2JN3 A;  3NX2 A;  4QGV A;  3BRN A;  3KFG A;  1MX7 A;  3HWE A;  3BLG A;  5EZ2 A;  1ERX A;  2OFR X;  1X8N A;  4ZHF A;  4IB8 A;  1FTP A;  4ES7 A;  5IO7 A;  4YCH A;  2AT0 X;  4EFG A;  1LIC A;  3I0A A;  1AQB A;  2E4J A;  4MVI A;  4AZO A;  2RA6 A;  1U17 A;  4IAW A;  4QYP A;  1JV4 A;  4NLI A;  4ORU A;  2WQA E;  1AEL A;  2OVA A;  5F6Z A;  4ZH6 A;  2G78 A;  3FEL A;  4I3B A;  2G7B A;  1CBQ A;  2OVD A;  1MUP A;  4ZH9 A;  2Q9S A;  3WJF A;  3EM0 A;  2PY1 A;  3EBK A;  2F73 A;  4ZR2 A;  2L5P A;  3PED A;  3F8A A;  1DZP A;  4NYR A;  1KQX A;  3CQN A;  2A2U A;  4AZR A;  1VYF A;  2Q2P A;  1TVQ A;  3FA9 A;  4D6B A;  2IFB A;  3KFH A;  1BSQ A;  2JU8 A;  2CZU A;  5D45 A;  1SXU A;  2WSJ A;  2L67 A;  4GRJ A;  5LJG A;  1IIU A;  2WEW A;  4EEJ A;  3CQR A;  1CBI A;  1G7N A;  3APX A;  1OEE A;  5B27 A;  1LID A;  4GH7 A;  3U03 A;  1XCA A;  1YIV A;  3B2H A;  3APV A;  3EMM A;  2A13 A;  1QY0 A;  4XME A;  5LJK A;  3NP1 A;  4GET A;  1QY2 A;  4ORS A;  4HPD A;  1LPJ A;  4BOE A;  1KXO A;  4OS3 A;  4YBP A;  2FR2 A;  1BM5 A;  1OPB A;  1LIF A;  1CRB A;  3STK A;  1H91 A;  2Q2M A;  2L9C A;  4TJZ A;  3NQ9 A;  1EPB A;  4DQ3 A;  3F9D A;  3O2Y A;  1HQP A;  1LIB A; 
#chains in the Genus database with same CATH topology
 4GGZ A;  5LJE A;  1L6M A;  1NBX A;  4O49 A;  1BWY A;  1G85 A;  4QGX A;  1O8V A;  2P8G A;  1RXJ A;  3PH5 A;  3AKM A;  2A5C A;  3O22 A;  1LFO A;  4KII A;  3WXQ A;  4C5P A;  2Y3F A;  1OBP A;  1UYO X;  1IFB A;  2HZR A;  3HWD A;  3NPO A;  1ZNH A;  1U0X A;  1W5R A;  4LKP A;  3WVM A;  3WYP A;  4ALO A;  2RTO B;  3FA7 A;  3FLL A;  3FYF A;  1YWC A;  1JMX A;  5HA1 A;  2AVI A;  1SRI A;  1KZX A;  1VYG A;  2ASN X;  2MHD A;  1VYO A;  3IFB A;  1SRH A;  3ELX A;  4O4O A;  4TKJ A;  4JNJ A;  3VU1 A;  1MVG A;  1TXL A;  1WBI A;  3AUM O;  3HOL A;  5LJB A;  1PM1 X;  2QO4 A;  4RUN A;  3FMZ A;  3STM X;  2QOS C;  4CSB A;  1UZ2 X;  1K3B A;  1MX8 A;  4XMD A;  2MM3 A;  2ZAI A;  2KTD A;  4ORY A;  1SWK A;  3VG5 A;  2WWP A;  2AL0 X;  3CR6 A;  4EDE A;  1BRQ A;  1A2D A;  3UEX A;  3I17 A;  4MIS A;  4QRL A;  1DF3 A;  3ZUO A;  4BX7 B;  1LF7 A;  3EW2 A;  4AZM A;  4BX7 A;  2FWV A;  2WQ9 A;  4I6S A;  3EC5 A;  3IA8 A;  1T8V A;  2OVS A;  4YGG A;  3ZW1 B;  4ALB A;  3T1D A;  3VG7 A;  3ZW1 A;  3FDC A;  4GJS A;  3ZW2 A;  2A5B A;  1KGL A;  2Z4I A;  1KL4 A;  1VWJ B;  3S60 A;  2X45 A;  5DPQ A;  1SWR A;  4DCB A;  4JO6 A;  4XMH A;  3D9W A;  5FQ6 E;  4CV7 A;  4GJV A;  1PEE A;  4IAB A;  1RXK A;  3VG4 A;  3WJG A;  1PBO A;  3NBX X;  4L1N A;  1CBS A;  4ODD A;  2RTG B;  3FR2 A;  4GUZ A;  4OMW A;  1SXX A;  2W2A A;  4N7C A;  4OEL A;  4YKM A;  1ACD A;  4BQU A;  1QFT A;  3CKG A;  3OD9 A;  2NNQ A;  1SMP I;  5H9K A;  1MM9 A;  4KC7 A;  5D4A A;  2FRS A;  3B2L A;  1WUB A;  2OVE A;  3B2J A;  1DV9 A;  1KZW A;  3S26 A;  3B2K A;  5LKF A;  2FHN X;  2W2B A;  4TLJ A;  1JJU A;  1ZND A;  3VE2 A;  3ZI8 A;  1ZNK A;  4IMO A;  1BEB A;  1VWC B;  3LTW A;  2JGS A;  3S5X A;  1X89 A;  1FJ1 E;  3BU1 A;  4QQ1 A;  2A0A A;  1EUO A;  3HPE A;  4YBU A;  3PP6 A;  1X71 A;  4Y0Q A;  2KT4 B;  1KT4 A;  1OPA A;  2ANS A;  1DZK A;  1PBY A;  5D8J A;  4A1Y A;  1ZNE A;  5HZ9 A;  5LJC A;  1N43 A;  3C76 X;  4GK9 A;  1EW3 A;  2IZH B;  3WZQ A;  5L8N A;  1SWS A;  2QO6 A;  3RDS A;  2OL6 O;  3UEV A;  2X55 A;  2KD2 A;  3D4R A;  3P24 A;  3VG3 A;  1ICN A;  5BVQ A;  3GE2 A;  1E06 A;  1SWP A;  2AT5 X;  2K62 A;  2MF6 A;  1X8O A;  1FEL A;  2AKQ A;  3MVF A;  4PSQ A;  4WFU A;  1KL3 A;  5KID A;  2AT3 X;  4R0B A;  4U3Q A;  3P02 A;  2VDF A;  2AT8 X;  2QM9 A;  3ZWE A;  4HWM A;  3BU9 A;  4ORR A;  1SLE B;  1SY0 A;  1ICM A;  4QYN A;  4Y0P A;  4Y5D A;  2UYW A;  5D47 A;  1DZM A;  5EED A;  1JQP A;  1HQQ A;  5F58 A;  3BY0 A;  3FEN A;  3ZQ3 A;  2IZA A;  1ML7 A;  4OMX A;  4D6A A;  4ML7 B;  1ZNL A;  3S5V A;  5B29 A;  1TW4 A;  1VWQ B;  5HCC C;  1ZRY A;  1SRG A;  5LKE A;  4WFV A;  1YWA A;  3T2X A;  5K67 A;  3FEK A;  2OYB O;  3TF6 A;  3DSZ A;  1QG5 A;  2QMI A;  1RXH A;  3P6D A;  1D3S A;  4GKC A;  4YKO A;  1LIE A;  3RDU A;  2RTN B;  2FT9 A;  2POA A;  4TNN A;  2IZL B;  1X8Q A;  3AEH A;  2JMB A;  1HBP A;  1QFV A;  4FBR A;  1ADL A;  1I4U A;  1LCZ A;  2RTC B;  3JQO A;  3KFF A;  2IZK A;  4OS8 A;  3VPJ E;  4EXZ A;  3SAO A;  3MX7 A;  4KH8 A;  2ACO A;  4GGR A;  3WBG A;  1SY2 A;  5AJC A;  3P6C A;  2R74 A;  4ZCB A;  1VWH B;  4EKV A;  1VWK B;  1Y55 X;  3JSQ A;  3MM0 A;  4L3R A;  1G74 A;  1N9Y A;  1E00 A;  4OEM A;  1KT3 A;  5C0N A;  1QY1 A;  4NV8 A;  2VFC A;  1DFV A;  1E5P A;  1QAB E;  1YWD A;  2R56 A;  2RCT A;  4O3X B;  2CZT A;  2FHL A;  1BSY A;  4O4S A;  5KHP A;  5F2B A;  4LKT A;  3RSW A;  1NP1 A;  1SWE A;  1SY1 A;  1IW2 A;  2X56 A;  1A3Y A;  1X8U A;  1JYD A;  1VWB B;  4KT5 A;  2OY5 O;  1SA8 A;  1N0S A;  1RSU B;  1FDQ A;  1GT3 A;  1KFF A;  4ORX A;  2VFB A;  5D48 A;  3LV4 A;  4WBK A;  3STN A;  1GX9 A;  2AH7 X;  3U0D A;  4HFO A;  4ZFX A;  1KOI A;  4U8U O;  3PQU A;  4I3D A;  3RDO A;  4Y0R A;  5HTD A;  4YFP A;  2Q39 A;  3RDX A;  5IXG A;  1GGL A;  3O19 A;  3WJB A;  3WYQ A;  1EI5 A;  5CHK A;  5H8T A;  3FA6 A;  4DQ4 A;  4BX5 B;  4IB7 A;  5EDB A;  4I60 A;  2RTA A;  4BX5 A;  2G79 A;  4FBO A;  4A1H A;  1N9M A;  1R0U A;  2RTE B;  4ON1 A;  5FEN A;  3RKG A;  3VG2 A;  3ZUI A;  1I78 A;  5CE4 A;  2RCQ A;  4IAX A;  4MVK A;  4XMC A;  1NGL A;  1VWP B;  2FLJ A;  4MVE A;  5CYB A;  1T68 X;  3X00 A;  3PQS A;  4NYQ A;  4BX6 B;  4YDB A;  1O1V A;  2PI3 O;  2QO5 A;  3L4R A;  1QWD A;  5F1E A;  4BX6 A;  2Y32 A;  1E02 A;  2DM5 A;  2CM9 A;  2F09 A;  3BDR A;  1KT7 A;  5H9L A;  3ZW0 B;  4HPA A;  1SWD A;  3EBW A;  3BSZ E;  4YGH A;  2X4M A;  1KT5 A;  1KQW A;  3RE5 A;  2IZG B;  3G7X A;  1B8E A;  2RTI B;  1VWE B;  3JS1 A;  5B11 O;  3P6G A;  3VG6 A;  4CDC A;  5HZ8 A;  3PPT A;  1BLR A;  1LKE A;  3V8U A;  3TGA A;  3VHI A;  4LQZ A;  1IJ8 A;  4TQ2 A;  1BJ7 A;  1VWR B;  2R73 A;  3C78 X;  1YWB A;  2LFO A;  4I95 A;  4NNT A;  4QZT A;  3D97 A;  5IRU A;  4IRW A;  3ZW0 A;  4AZQ A;  1SY3 A;  1Y9T A;  1CBR A;  3FIQ A;  4Z28 A;  4O9S A;  3N91 A;  2FS7 A;  5B10 O;  3WJD A;  3TZS A;  1JYJ A;  1EQD A;  2G5L A;  4LZU A;  2OF8 A;  4ZGF A;  1OBQ A;  2F01 A;  2HMB A;  3APU A;  3QQ2 A;  4BVM A;  2Q4N A;  4MIR A;  4O3Y A;  3DTQ A;  3APW A;  3PDF A;  1VWO B;  2OFM X;  4RUU A;  5F7G A;  2HKD A;  4JHQ A;  4ZJ0 A;  1YP7 A;  2XST A;  4O3Z A;  4KC8 A;  1OEJ A;  4COT A;  1YUP A;  3HWG A;  4GNY A;  4N7D A;  5HCE C;  3WJC A;  1VPR A;  1DZJ A;  3C77 X;  2JU3 A;  5HZQ A;  2IZC B;  3LHN A;  2NNE A;  2LB6 A;  1VWG B;  2CM4 A;  2A8G A;  4ID2 A;  5FFH A;  2IZB A;  4Y0S A;  2Y3E A;  1SWJ A;  1S7D A;  4ARH A;  2JW1 A;  2W2F A;  1S44 A;  3UEU A;  1RBP A;  1JZU A;  1ALB A;  1I05 A;  1RLB E;  2O62 A;  4YCE A;  1GKA B;  4GZV A;  1VWD B;  1VWN B;  2OF9 A;  1EAL A;  2WEX A;  5DG4 A;  1GKA A;  2FS6 A;  3UEW A;  4ZHC A;  1SWN A;  2C1Q A;  2RTM A;  4HPB A;  4Z2O A;  2CBS A;  2K23 A;  4AYH A;  5JR8 A;  3FID A;  1X8P A;  1LDO A;  4QZU A;  4QAE A;  5LJD A;  5AEO A;  2ALL X;  4UU3 A;  2IZI A;  1K24 A;  2YG2 A;  2RTK A;  1HN2 A;  1VWF B;  3K3L A;  4XMG A;  1BBP A;  1OSP O;  1HMT A;  4JGL A;  1SWF A;  1FE3 A;  1GT4 A;  4CK4 A;  2L68 A;  5B3M O;  1STR B;  1A57 A;  4I9R A;  2X32 A;  3P6E A;  3WZN A;  2JOZ A;  4ZHG A;  2ZSC A;  2HYS A;  3VGW A;  4GE1 A;  3SLJ A;  1JJJ A;  1UYN X;  2RTR B;  2IZD B;  1A18 A;  2RTL A;  4TKH A;  4QNI A;  2FKJ A;  3VHM A;  3FW4 A;  1HBQ A;  2WUT A;  3SOT A;  3OJY C;  3H3I A;  5H9N A;  1JBH A;  2AF5 A;  4O3W A;  1VWA B;  3RDM A;  3NQ3 A;  1O1U A;  2BLG A;  2EU7 X;  3GAQ A;  5F6B A;  1I06 A;  3U9P C;  4ZGU A;  4YMY A;  2AMM X;  3SLT A;  4A8Z A;  5HA0 A;  3KZA A;  1ZNG A;  2C4I A;  2GTL O;  2KW1 A;  2OFA A;  3CMP A;  3HTY A;  5HBS A;  3PH6 A;  1SWA A;  2RTD B;  1NDJ A;  3CWK A;  1U18 A;  1AVD A;  4AW8 A;  1B4M A;  5JD2 A;  4A60 A;  1BSO A;  3HWF A;  2X46 A;  2LBV A;  3RZY A;  2IZF B;  1KT6 A;  4IB6 A;  2MJI A;  4NNS A;  3EW1 A;  1VWM B;  1EXS A;  1B0O A;  1VWL B;  2BS5 A;  2CBR A;  1LCW A;  3D96 A;  3SZJ A;  2GTL M;  3T6L A;  1I9H A;  2QOM A;  4TKB A;  4K19 A;  1N7Y A;  2IZJ A;  3NAD A;  4YFQ A;  5L3Y A;  2LA7 A;  2I5Z O;  3ELZ A;  4IMN A;  1IKE A;  1SXW A;  1URE A;  2LKK A;  5L8O A;  1S2P A;  2QCB A;  1STS B;  3HOE A;  3KVN A;  1I04 A;  1RAV A;  1W4T A;  1SXY A;  5AQ6 A;  1AVG I;  2XKL A;  2A2G A;  4NV7 A;  4BJ8 A;  1Z24 A;  2RD7 C;  4NP1 A;  3RE6 A;  5EPQ A;  3NR3 A;  4PJ2 A;  4OKA A;  2MWH A;  3VE1 A;  2RTB B;  3FEP A;  3MBT A;  1IKJ A;  4GDA A;  2RQ0 A;  5FAZ A;  3TGC A;  4NLJ A;  1GT1 A;  4FGI B;  1P6P A;  1OBU A;  2OY7 A;  4AZP A;  1MOY A;  1SRE A;  3T6F A;  1EII A;  2OL8 O;  3FR4 A;  2GC9 A;  5BVS A;  4YGZ A;  1B56 A;  3FW5 A;  4QGW A;  4IB9 A;  2NND A;  2BT9 A;  3NX1 A;  4OS0 A;  1PMP A;  3WJE A;  4ZHD A;  4U8U M;  3AKN A;  2OL7 A;  3BS2 A;  2GTF X;  1SWU A;  3CBS A;  2HNX A;  2RTJ A;  4GDZ A;  3HK1 A;  2DJF A;  5IRA A;  2ZAG A;  1JIW I;  5HTE A;  4XMF A;  1LNM A;  4GD9 A;  1EIO A;  2Z4H A;  2OFB A;  1IFC A;  1LEL A;  5HAE A;  2GJ5 A;  2JU7 A;  4GGT A;  1QQS A;  2FGS A;  2HLV A;  5EEE A;  1HY2 A;  1W6F A;  3B2I A;  4I9S A;  3RY1 A;  4YFR A;  1JJX A;  1SLF B;  2HZQ A;  1LDQ A;  5H9A A;  5HCD C;  1SWQ A;  5HZ5 A;  1GT5 A;  1XKI A;  4MEE A;  3BX8 A;  1TOW A;  3BX7 A;  1FEN A;  2AT6 X;  4I3C A;  4LZV A;  1LUQ A;  1OEK A;  2BS6 A;  4YDA A;  4YVB A;  4Z6J A;  3TGB A;  2N93 A;  1HMS A;  5LJH A;  5EDC A;  5HWZ A;  5KIC A;  1CJ5 A;  5AJB A;  4M6S A;  2X8S A;  3QKG A;  2FR3 A;  1GM6 A;  1D2U A;  2BSZ A;  4IBA A;  3RWX A;  4AZN A;  3EYC A;  1GX8 A;  2FTB A;  1YP6 A;  1DF8 A;  2BC3 A;  3SLO A;  1Y53 X;  2G8C O;  4ORW A;  2X8F A;  3Q6L A;  4O4U A;  1NC9 A;  4YH0 A;  1T0V A;  1RST B;  2A3F X;  2YMS A;  1NQN A;  1AVE A;  3CBC A;  1MDC A;  2WR6 A;  1TOU A;  2GH7 A;  3KFI A;  3UAQ A;  5FQ8 E;  3D95 A;  3P6H A;  4NW4 A;  3T2W A;  1ERB A;  5IO5 A;  1SWB A;  1EPA A;  3OBL A;  4INN A;  2CAM A;  5BVT A;  5K06 A;  4FQB B;  4BBO A;  1G5W A;  2NP1 A;  2KTS A;  2GTL N;  2ACP X;  1HXL A;  2MO5 A;  1SLG B;  3WZO A;  1PTS A;  3FA8 A;  1NP4 A;  4GU8 A;  4CPE A;  5HZ6 A;  4CPF A;  5L8I A;  1HXZ A;  3CKF A;  3NQK A;  1STP A;  4CPI A;  1BRP A;  2X34 A;  4M7M A;  3WZP A;  4CDE A;  4Z27 A;  1MK5 A;  2OZQ A;  4Z2V A;  3FR5 A;  3VHH A;  1AB0 A;  2DJG A;  1DC9 A;  1FEM A;  3P6F A;  4GNW A;  3KQ0 A;  4ZHH A;  3PEC A;  1HMR A;  4MVL A;  5CSE A;  5B2A O;  4UU2 A;  1GXA A;  2BHV A;  2LBA A;  2JN3 A;  4HPC A;  3NX2 A;  4QGV A;  2C1S A;  3BRN A;  3KFG A;  1MX7 A;  1SWL A;  3BLG A;  3HWE A;  5EZ2 A;  1ERX A;  3SZI A;  2OFR X;  5IO6 A;  4U8U N;  1X8N A;  2UZ2 A;  4ZHF A;  1Y9L A;  1FTP A;  4IB8 A;  3SZH A;  3Q34 A;  4ES7 A;  5IO7 A;  3OE3 A;  4YCH A;  1SWH A;  2AT0 X;  3ZZV A;  1LIC A;  4EFG A;  5BYP A;  1SRF A;  4U46 A;  3I0A A;  3E3C A;  1AQB A;  2E4J A;  2WPU A;  4MVI A;  4AZO A;  2RA6 A;  1N4J A;  1U17 A;  4IAW A;  3RBY A;  4QYP A;  1JV4 A;  4BCS A;  4NLI A;  4ORU A;  2WQA E;  1AEL A;  2IZE B;  2OVA A;  5F6Z A;  4CPH B;  4ZH6 A;  3MG5 A;  2G78 A;  3FEL A;  4I3B A;  4CPH A;  2RTP B;  2G7B A;  1CBQ A;  2OVD A;  1MUP A;  4ZH9 A;  2Q9S A;  3WJF A;  3EM0 A;  4WHI A;  1E2T A;  1VWI B;  5FQ7 E;  2PY1 A;  1MEP A;  3EBK A;  1SRJ A;  1Y52 X;  2F73 A;  4ZR2 A;  3RY2 A;  3F6Z B;  2M4L A;  5B5F A;  4O4X A;  2L5P A;  3PED A;  3F8A A;  1DZP A;  1GX3 A;  5K68 A;  4NYR A;  1KQX A;  5IRW A;  3CQN A;  2A2U A;  4AZR A;  1VYF A;  2Q2P A;  1TVQ A;  3FA9 A;  4D6B A;  4DNE A;  1SWG A;  2IFB A;  2RN4 A;  1BSQ A;  2JU8 A;  2CZU A;  3KFH A;  5D45 A;  1SXU A;  4BGF A;  4Y59 A;  4Z2P A;  2WSJ A;  1Y0G A;  3RDQ A;  2L67 A;  4GRJ A;  5LJG A;  1IIU A;  2RTH B;  2WEW A;  4CDD A;  4EEJ A;  3CQR A;  1CBI A;  1G7N A;  3APX A;  4CDF A;  1OEE A;  5B27 A;  1LID A;  4GH7 A;  3U03 A;  1SWT A;  1XCA A;  1NQM A;  4FBV A;  2I5V O;  3PK2 A;  1YIV A;  3B2H A;  1JMZ A;  4EQA C;  3APV A;  3EMM A;  1LCV A;  1QY0 A;  2A13 A;  4U9C A;  4XME A;  5LJK A;  3NP1 A;  4GET A;  5B5G A;  1SLD B;  1QY2 A;  4ORS A;  1KL5 A;  4HPD A;  1LPJ A;  4BOE A;  1KXO A;  4OS3 A;  2FKG A;  4YBP A;  2FR2 A;  1SWO A;  1OPB A;  2RTQ B;  1BM5 A;  1LIF A;  1CRB A;  4KCA A;  1H91 A;  3STK A;  2OY8 A;  2Q2M A;  2L9C A;  4TJZ A;  3NQ9 A;  1EPB A;  3WOV A;  2RTF B;  2X8T A;  2OY1 O;  4DQ3 A;  3F9D A;  3O2Y A;  4B55 A;  1HQP A;  1LIB A;  1SWC A; 
#chains in the Genus database with same CATH homology
 5LJE A;  1L6M A;  4O49 A;  1BWY A;  1G85 A;  4QGX A;  1O8V A;  2P8G A;  3PH5 A;  3AKM A;  3O22 A;  1LFO A;  4KII A;  3WXQ A;  1OBP A;  1IFB A;  2HZR A;  3HWD A;  3NPO A;  1ZNH A;  1U0X A;  4LKP A;  3WVM A;  4ALO A;  3FA7 A;  3FLL A;  3FYF A;  1YWC A;  5HA1 A;  1KZX A;  1VYG A;  2ASN X;  2MHD A;  3IFB A;  4TKJ A;  3ELX A;  4O4O A;  3VU1 A;  1MVG A;  1TXL A;  3HOL A;  5LJB A;  1PM1 X;  2QO4 A;  4RUN A;  3FMZ A;  3STM X;  2QOS C;  4CSB A;  1UZ2 X;  1MX8 A;  4XMD A;  2MM3 A;  2ZAI A;  2KTD A;  4ORY A;  3VG5 A;  2WWP A;  2AL0 X;  3CR6 A;  4EDE A;  1BRQ A;  1A2D A;  3UEX A;  3I17 A;  4MIS A;  4QRL A;  1DF3 A;  3ZUO A;  1LF7 A;  4AZM A;  2FWV A;  2WQ9 A;  4I6S A;  4YGG A;  3IA8 A;  1T8V A;  2OVS A;  3ZW1 B;  4ALB A;  3T1D A;  3VG7 A;  3ZW1 A;  3ZW2 A;  1KGL A;  2Z4I A;  3S60 A;  2X45 A;  5DPQ A;  4XMH A;  5FQ6 E;  4CV7 A;  1PEE A;  4IAB A;  3VG4 A;  3WJG A;  1PBO A;  3NBX X;  4L1N A;  1CBS A;  4ODD A;  3FR2 A;  4OMW A;  1SXX A;  2W2A A;  4N7C A;  4YKM A;  1ACD A;  4BQU A;  1QFT A;  3OD9 A;  2NNQ A;  1SMP I;  5H9K A;  4KC7 A;  5D4A A;  2FRS A;  3B2L A;  2OVE A;  3B2J A;  1DV9 A;  1KZW A;  3S26 A;  3B2K A;  5LKF A;  2W2B A;  4TLJ A;  1ZND A;  3VE2 A;  3ZI8 A;  1ZNK A;  4IMO A;  1BEB A;  3S5X A;  1X89 A;  3BU1 A;  4QQ1 A;  2A0A A;  1EUO A;  4YBU A;  3PP6 A;  1X71 A;  4Y0Q A;  2KT4 B;  1KT4 A;  1OPA A;  2ANS A;  1DZK A;  5D8J A;  4A1Y A;  5HZ9 A;  1ZNE A;  5LJC A;  3C76 X;  4GK9 A;  5L8N A;  1EW3 A;  2QO6 A;  3UEV A;  2KD2 A;  3D4R A;  3P24 A;  3VG3 A;  1ICN A;  5BVQ A;  3GE2 A;  1E06 A;  2AT5 X;  2K62 A;  3MVF A;  4PSQ A;  1X8O A;  1FEL A;  2AKQ A;  4WFU A;  4YCE A;  5KID A;  2AT3 X;  4R0B A;  4U3Q A;  3P02 A;  2AT8 X;  2QM9 A;  3ZWE A;  4HWM A;  3BU9 A;  4ORR A;  4Y0P A;  1SY0 A;  1ICM A;  4QYN A;  5L8O A;  5D47 A;  5EED A;  1DZM A;  5F58 A;  3BY0 A;  3FEN A;  3ZQ3 A;  1ML7 A;  4OMX A;  4D6A A;  4ML7 B;  1ZNL A;  3S5V A;  5B29 A;  1TW4 A;  5HCC C;  1ZRY A;  5LKE A;  4WFV A;  1YWA A;  3FEK A;  3TF6 A;  3DSZ A;  1QG5 A;  2QMI A;  3P6D A;  4YKO A;  1D3S A;  4GKC A;  1LIE A;  2FT9 A;  2POA A;  4TNN A;  1X8Q A;  2JMB A;  1HBP A;  1QFV A;  4FBR A;  1ADL A;  1I4U A;  3JQO A;  3KFF A;  4OS8 A;  3VPJ E;  4EXZ A;  3SAO A;  3MX7 A;  4KH8 A;  2ACO A;  3WBG A;  1SY2 A;  5AJC A;  3P6C A;  2R74 A;  4ZCB A;  3JSQ A;  4L3R A;  1G74 A;  1E00 A;  1KT3 A;  5C0N A;  1QY1 A;  1DFV A;  1E5P A;  1QAB E;  1YWD A;  2R56 A;  2RCT A;  4O3X B;  2CZT A;  4O4S A;  1BSY A;  5KHP A;  4LKT A;  3RSW A;  1NP1 A;  1SY1 A;  1IW2 A;  1A3Y A;  1X8U A;  1JYD A;  4KT5 A;  1SA8 A;  1N0S A;  1FDQ A;  1GT3 A;  4ORX A;  5D48 A;  3LV4 A;  4WBK A;  3STN A;  1GX9 A;  2AH7 X;  3U0D A;  4HFO A;  4ZFX A;  1KOI A;  4U8U O;  3PQU A;  4I3D A;  4Y0R A;  5HTD A;  4YFP A;  2Q39 A;  1GGL A;  3O19 A;  3WJB A;  1EI5 A;  5H8T A;  3FA6 A;  4DQ4 A;  4IB7 A;  5EDB A;  2G79 A;  4FBO A;  4A1H A;  1R0U A;  4ON1 A;  5FEN A;  3RKG A;  3VG2 A;  3ZUI A;  5CE4 A;  2RCQ A;  4IAX A;  4MVK A;  4XMC A;  1NGL A;  2FLJ A;  4MVE A;  5CYB A;  1T68 X;  3PQS A;  4NYQ A;  4YDB A;  1O1V A;  2QO5 A;  3L4R A;  5F1E A;  1QWD A;  1E02 A;  2DM5 A;  2CM9 A;  2F09 A;  3BDR A;  1KT7 A;  5H9L A;  4HPA A;  3EBW A;  3BSZ E;  4YGH A;  1KT5 A;  1KQW A;  3VG6 A;  3G7X A;  1B8E A;  3JS1 A;  3P6G A;  5HZ8 A;  3PPT A;  1BLR A;  1LKE A;  3V8U A;  3TGA A;  4LQZ A;  4TQ2 A;  1BJ7 A;  2R73 A;  3C78 X;  4I95 A;  1YWB A;  2LFO A;  4NNT A;  4QZT A;  3ZW0 B;  3D97 A;  4AZQ A;  3ZW0 A;  1SY3 A;  1Y9T A;  1CBR A;  3FIQ A;  4O9S A;  3N91 A;  2FS7 A;  3WJD A;  3TZS A;  1JYJ A;  1EQD A;  4LZU A;  4ZGF A;  1OBQ A;  2HMB A;  3APU A;  4BVM A;  2Q4N A;  4MIR A;  4O3Y A;  3DTQ A;  3APW A;  2OFM X;  4RUU A;  5F7G A;  4ZJ0 A;  1YP7 A;  2XST A;  4O3Z A;  4KC8 A;  1OEJ A;  4COT A;  1YUP A;  3HWG A;  4GNY A;  4N7D A;  5HCE C;  3WJC A;  1VPR A;  1DZJ A;  3C77 X;  2JU3 A;  5HZQ A;  3LHN A;  2NNE A;  2LB6 A;  2CM4 A;  4ID2 A;  5FFH A;  4Y0S A;  4ARH A;  1S7D A;  2JW1 A;  2W2F A;  1S44 A;  3UEU A;  1RBP A;  1JZU A;  1ALB A;  1I05 A;  1RLB E;  2O62 A;  1GKA B;  4GZV A;  1EAL A;  2WEX A;  5DG4 A;  1GKA A;  2FS6 A;  3UEW A;  4ZHC A;  4HPB A;  2CBS A;  2K23 A;  4AYH A;  5JR8 A;  1X8P A;  4QZU A;  4QAE A;  5LJD A;  5AEO A;  2ALL X;  4UU3 A;  2YG2 A;  1HN2 A;  3K3L A;  4XMG A;  1BBP A;  1HMT A;  4JGL A;  1FE3 A;  1GT4 A;  4CK4 A;  2L68 A;  1A57 A;  4I9R A;  3P6E A;  2JOZ A;  4ZHG A;  2HYS A;  4GE1 A;  1JJJ A;  4TKH A;  1A18 A;  4QNI A;  3FW4 A;  1HBQ A;  2WUT A;  3SOT A;  3OJY C;  3H3I A;  5H9N A;  1JBH A;  4O3W A;  3NQ3 A;  1O1U A;  2BLG A;  2EU7 X;  3GAQ A;  5F6B A;  1I06 A;  3U9P C;  4ZGU A;  4YMY A;  2AMM X;  4A8Z A;  5HA0 A;  3KZA A;  1ZNG A;  2GTL O;  3HTY A;  2KW1 A;  3CMP A;  5HBS A;  1JJX A;  3PH6 A;  4AW8 A;  3CWK A;  1U18 A;  1B4M A;  4A60 A;  1BSO A;  3HWF A;  2X46 A;  2LBV A;  3RZY A;  4IB6 A;  1KT6 A;  2MJI A;  4NNS A;  1EXS A;  1B0O A;  2BS5 A;  2CBR A;  3D96 A;  2GTL M;  4TKB A;  4K19 A;  3NAD A;  4YFQ A;  2LA7 A;  3ELZ A;  4IMN A;  1IKE A;  1SXW A;  1URE A;  2LKK A;  1S2P A;  3HOE A;  1I04 A;  1SXY A;  5AQ6 A;  1AVG I;  2XKL A;  2A2G A;  1Z24 A;  2RD7 C;  4NP1 A;  5EPQ A;  3NR3 A;  4PJ2 A;  2MWH A;  3VE1 A;  3FEP A;  3MBT A;  1IKJ A;  5FAZ A;  2RQ0 A;  3TGC A;  4NLJ A;  1GT1 A;  4FGI B;  1P6P A;  1OBU A;  4AZP A;  1EII A;  3FR4 A;  5BVS A;  2GC9 A;  4YGZ A;  1B56 A;  3FW5 A;  4QGW A;  4IB9 A;  2NND A;  2BT9 A;  3NX1 A;  4OS0 A;  1PMP A;  3WJE A;  4ZHD A;  4U8U M;  3AKN A;  3BS2 A;  2GTF X;  3CBS A;  2HNX A;  4GDZ A;  3HK1 A;  2ZAG A;  1JIW I;  5HTE A;  4XMF A;  1LNM A;  1EIO A;  2Z4H A;  1IFC A;  5HAE A;  2GJ5 A;  2JU7 A;  1QQS A;  2HLV A;  5EEE A;  3B2I A;  4I9S A;  4YFR A;  2HZQ A;  5H9A A;  5HZ5 A;  5HCD C;  1GT5 A;  1XKI A;  3BX8 A;  1TOW A;  3BX7 A;  1FEN A;  2AT6 X;  4I3C A;  4LZV A;  1OEK A;  2BS6 A;  4YDA A;  3TGB A;  2N93 A;  1HMS A;  5LJH A;  5EDC A;  5HWZ A;  5KIC A;  1CJ5 A;  5AJB A;  4M6S A;  2X8S A;  3QKG A;  2FR3 A;  1GM6 A;  1D2U A;  4IBA A;  3RWX A;  4AZN A;  3EYC A;  1GX8 A;  2FTB A;  1YP6 A;  4ORW A;  2X8F A;  3Q6L A;  4O4U A;  4YH0 A;  1T0V A;  2A3F X;  2YMS A;  3CBC A;  1MDC A;  2WR6 A;  1TOU A;  3KFI A;  3UAQ A;  5FQ8 E;  3D95 A;  3P6H A;  4NW4 A;  5IO5 A;  1ERB A;  1EPA A;  3OBL A;  4INN A;  5BVT A;  5K06 A;  1G5W A;  4FQB B;  2NP1 A;  2KTS A;  2GTL N;  2ACP X;  2MO5 A;  3FA8 A;  1NP4 A;  4GU8 A;  5HZ6 A;  5L8I A;  3NQK A;  1BRP A;  4M7M A;  2OZQ A;  3FR5 A;  1AB0 A;  3P6F A;  1DC9 A;  1FEM A;  4GNW A;  4ZHH A;  3KQ0 A;  3PEC A;  1HMR A;  4MVL A;  4UU2 A;  1GXA A;  2BHV A;  2LBA A;  2JN3 A;  4HPC A;  3NX2 A;  4QGV A;  3BRN A;  3KFG A;  1MX7 A;  3HWE A;  3BLG A;  5EZ2 A;  1ERX A;  2OFR X;  5IO6 A;  4U8U N;  1X8N A;  4ZHF A;  1Y9L A;  1FTP A;  4IB8 A;  4ES7 A;  5IO7 A;  3OE3 A;  4YCH A;  2AT0 X;  3ZZV A;  4EFG A;  1LIC A;  5BYP A;  3I0A A;  3E3C A;  1AQB A;  2E4J A;  4MVI A;  4AZO A;  2RA6 A;  1U17 A;  3RBY A;  4IAW A;  4QYP A;  1JV4 A;  4NLI A;  4ORU A;  2WQA E;  1AEL A;  2OVA A;  5F6Z A;  4ZH6 A;  2G78 A;  3FEL A;  4I3B A;  2G7B A;  1CBQ A;  2OVD A;  1MUP A;  4ZH9 A;  2Q9S A;  3WJF A;  3EM0 A;  4WHI A;  5FQ7 E;  2PY1 A;  3EBK A;  2F73 A;  4ZR2 A;  3F6Z B;  2M4L A;  4O4X A;  2L5P A;  3PED A;  3F8A A;  1DZP A;  4NYR A;  1KQX A;  3CQN A;  2A2U A;  4AZR A;  1VYF A;  2Q2P A;  1TVQ A;  3FA9 A;  4D6B A;  2IFB A;  2RN4 A;  1BSQ A;  2JU8 A;  2CZU A;  3KFH A;  5D45 A;  1SXU A;  2WSJ A;  2L67 A;  4GRJ A;  5LJG A;  1IIU A;  2WEW A;  4EEJ A;  3CQR A;  1CBI A;  1G7N A;  3APX A;  1OEE A;  5B27 A;  1LID A;  4GH7 A;  3U03 A;  1XCA A;  4FBV A;  1YIV A;  3B2H A;  4EQA C;  3APV A;  3EMM A;  2A13 A;  1QY0 A;  4U9C A;  4XME A;  5LJK A;  3NP1 A;  4GET A;  1QY2 A;  4ORS A;  4HPD A;  1LPJ A;  4BOE A;  1KXO A;  4OS3 A;  4YBP A;  2FR2 A;  1BM5 A;  1OPB A;  1LIF A;  1CRB A;  4KCA A;  1H91 A;  3STK A;  2Q2M A;  2L9C A;  4TJZ A;  3NQ9 A;  1EPB A;  3WOV A;  2X8T A;  4DQ3 A;  3F9D A;  3O2Y A;  1HQP A;  1LIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...