3VGWA

Crystal structure of monoac-biotin-avidin complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
123
structure length
123
Chain Sequence
ARKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biotin-binding protein
molecule keywords Avidin
publication title Rational development of caged-biotin protein-labeling agents and some applications in live cells
pubmed doi rcsb
total genus 24
structure length 123
sequence length 123
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 3vgwA00
1KL3A 1SRHA 2RTGB 4BX6B 2RTEB 1N43A 2WPUA 1STPA 1SLEB 5CHKA 5CSEA 3FDCA 2OF9A 1NBXA 1KFFA 1HQQA 2UYWA 4JHQA 5B5FA 1LUQA 5JD2A 4GGRA 2F01A 1HXZA 4CPEA 3RE5A 1SWNA 1VYOA 1LCVA 1HY2A 2RTLA 5K68A 4GDAA 4BX7B 2OFAA 4BBOA 1SLFB 2JGSA 1Y52X 1RSUB 3VHHA 1SREA 1I9HA 1VWIB 3RDUA 2C1QA 2IZLB 2RTKA 3PK2A 3T2XA 1VWEB 1SWDA 3WYQA 1LCZA 1N9YA 4EKVA 1VWCB 5B5GA 3VHIA 5F2BA 4YVBA 2CAMA 1KL5A 2QCBA 4Z27A 1AVEA 3RY2A 1STRB 2A8GA 1SWPA 1SWJA 2IZGB 4Z2PA 3RDOA 2ZSCA 3EW1A 1MOYA 1STSB 1SRJA 1SRIA 1LCWA 4Y59A 1PTSA 4BX5B 3T6LA 1RAVA 3T6FA 1LELA 1VWBB 1SWOA 1VWGB 3VHMA 1SWKA 4GD9A 2IZKA 4Z28A 3WYPA 2RTAA 5IRAA 1SWFA 1VWKB 4BCSA 3EW2A 4IRWA 2IZDB 2RTCB 1DF8A 2RTNB 1WBIA 2OFBA 4Z6JA 2Y3EA 1VWPB 4BX6A 2UZ2A 1VWOB 4GGZA 1RXKA 3RY1A 1SWLA 1VWRB 2IZHB 1VWHB 3RE6A 4CPHB 2IZCB 1N7YA 1RXJA 1AVDA 1SWHA 2BC3A 2OF8A 3SZJA 3RDQA 4BX7A 4JO6A 1VWJB 1Y55X 3WZPA 1VWAB 3RDSA 1SWAA 4I60A 1SLDB 2IZFB 2RTRB 1IJ8A 1SWTA 1SRFA 1NQMA 2RTQB 5L3YA 4U46A 2RTFB 5K67A 4GJVA 2IZJA 1SRGA 2IZBA 5IRWA 1SWUA 1VWQB 2A5BA 2IZAA 3WZOA 1SWSA 1MK5A 1NC9A 2FHLA 2RTDB 2RTPB 4GJSA 1Y53X 1VWDB 2G5LA 4JNJA 2MF6A 2RTBB 1SWGA 4CPFA 1RXHA 1SWEA 4Y5DA 1KL4A 1HXLA 1SWBA 3RDXA 2Y3FA 5IRUA 1RSTB 2RTIB 2Y32A 4BX5A 1SWQA 3MG5A 1SWCA 1MEPA 3T2WA 3MM0A 3X00A 2IZEB 1LDQA 2FHNX 4CPIA 2AVIA 2GH7A 4BJ8A 1LDOA 2RTJA 4DNEA 1N9MA 3WZNA 1NDJA 1N4JA 1SWRA 2IZIA 4Z2OA 3SZHA 1NQNA 1VWFB 3SZIA 2C4IA 1SLGB 1VWMB 1MM9A 2RTHB 1VWLB 2C1SA 3VGWA 4Z2VA 3RDMA 1VWNB 2RTOB 3WZQA 2A5CA 4CPHA 2RTMA 4GGTA 4OKAA
chains in the Genus database with same CATH superfamily
4U3QA 2POAA 4EDEA 1SA8A 2WPUA 1A18A 3C76X 1SLEB 4ZHGA 3FIQA 1NBXA 2FKGA 2UYWA 3KFHA 4RUUA 1JYDA 1Z24A 2N93A 4CDCA 1FDQA 2FRSA 4OS3A 4LKTA 3RE5A 4ZHDA 1SWNA 3ZZVA 2W2FA 3NX2A 3VE1A 3WBGA 2GC9A 3RZYA 4M6SA 2OL7A 2JW1A 3QQ2A 2OFAA 4BBOA 5HTEA 1SLFB 3DSZA 1Y52X 3FR4A 3TZSA 1TVQA 4Y0RA 3FW5A 1EIIA 3L4RA 3CQNA 1LNMA 3PK2A 1JMXA 3T2XA 3PPTA 3ZQ3A 1B56A 1VPRA 1VWEB 1X8OA 3GE2A 2QO5A 3FELA 2AT8X 3H3IA 1BSOA 1N9YA 1VWCB 3BU9A 3P6FA 4MIRA 5B5GA 5HA0A 4Z27A 1A57A 1STRB 3KVNA 1SWJA 3O2YA 4ALBA 1UZ2X 3P6HA 5FQ6E 1OBPA 5CE4A 2KD2A 1DZPA 3AKNA 3D9WA 3OD9A 1ZNLA 3SLOA 1SRIA 2F09A 2X45A 5EEDA 3NPOA 1D3SA 1EPAA 5H9LA 3FW4A 3T6FA 4ODDA 4TQ2A 4HPCA 1SWKA 2Q4NA 4FQBB 1H91A 5IO5A 4ORYA 4XMEA 1HMRA 2NP1A 4TKHA 3JSQA 1X8UA 4R0BA 1FJ1E 4MVIA 3UEWA 2MJIA 5BVQA 1GT3A 2Y3EA 1VWPB 3AKMA 2BSZA 2ACPX 3KFIA 1YWAA 3RBYA 1LIFA 1Y0GA 2JMBA 3NX1A 5FFHA 2OY8A 4IABA 2AMMX 4GDZA 2FR3A 4O4SA 4U8UO 3O22A 5H8TA 3TGAA 1Y9TA 1BBPA 1LKEA 3OBLA 5D45A 1O1UA 1SWHA 4PSQA 1HMTA 1HN2A 3RSWA 1QY2A 4BX7A 1VWJB 4NV7A 4YGHA 3RDSA 4I95A 1YP7A 3ZW0A 4GRJA 4YVBA 5L3YA 2HMBA 2RN4A 4GH7A 1K24A 3NBXX 1BRQA 3PQSA 1ZNDA 3ELXA 4LQZA 4WHIA 1EI5A 5D47A 5HTDA 1BSQA 1OBQA 3TGBA 4AYHA 3I17A 5EZ2A 2A2GA 1NC9A 2JU3A 1ACDA 2FGSA 1SXWA 2G5LA 2LB6A 1QG5A 1S7DA 4HPAA 2CZUA 1SWEA 4PJ2A 4Y5DA 1I06A 4L3RA 1VYFA 1GXAA 4NP1A 3UEVA 1R0UA 2Y32A 2JU8A 2X46A 3MG5A 1FTPA 4O4OA 3T2WA 4YMYA 2X4MA 1ZRYA 2E4JA 4I9RA 2CZTA 3WJCA 1LDOA 5FQ8E 1E2TA 3S5XA 1LPJA 1CBIA 1N4JA 2IZIA 2KTSA 3AUMO 3B2KA 4WFVA 2C4IA 2Q9SA 4OMWA 4A1HA 3BRNA 1SLGB 4YFRA 1G5WA 3P6DA 5FENA 3HWDA 4JGLA 2OFRX 5HCEC 3P24A 3VGWA 4BVMA 2WQAE 4O4UA 4ORRA 4XMDA 5H9AA 5F6ZA 5K06A 1QY1A 4CPHA 2RTMA 2HKDA 5BYPA 1CBQA 4OKAA 3S60A 1KL3A 5HZ6A 5EEEA 1ALBA 2RTGB 4NYQA 5CHKA 5LJDA 1AB0A 3C78X 1B4MA 5H9NA 2OVSA 3FIDA 1JZUA 2OVDA 2Q2PA 2W2AA 4JHQA 2GTLM 3AEHA 5JD2A 3ZW1A 1HXZA 4YFPA 5AJBA 2OY1O 4KT5A 1FE3A 1SXXA 3EMMA 2WWPA 2ZAGA 3NQKA 5LJCA 2RTLA 3F6ZB 2OZQA 3SLTA 4EFGA 2RCTA 2ALLX 4GDAA 1KQXA 4O9SA 4YCHA 3VG2A 1AELA 3ZI8A 1IIUA 4CDDA 1TOWA 4QYPA 3UAQA 4AZMA 3CQRA 1ZNHA 2Q2MA 1KT5A 2MO5A 2Z4IA 3WYQA 1SWDA 1KQWA 1LCZA 2LBAA 2O62A 4WFUA 4ZH6A 1B8EA 3WVMA 4N7DA 1OBUA 2QO6A 2YMSA 3PQUA 2VFCA 3OJYC 3PH5A 4IBAA 1KL5A 4MVLA 2BHVA 1AVEA 3P6CA 5F2BA 2A8GA 1SWPA 4Z2PA 1IW2A 1T0VA 1DZKA 2MM3A 3NP1A 1X89A 3BU1A 2K23A 1SY1A 4YH0A 1MOYA 1JV4A 2AT6X 1SRJA 2X32A 1NP1A 3PDFA 4LKPA 1BEBA 3U9PC 5HCCC 1TW4A 4Y59A 1PTSA 1GKAA 1RAVA 2GTFX 4KIIA 4NW4A 1KZXA 1VWBB 1VWGB 2L68A 3NR3A 2FS7A 3HWEA 2IZKA 4GD9A 2OVEA 2RTAA 4YBPA 1I78A 4BCSA 1D2UA 2FS6A 3EW2A 4U8UN 1G85A 4GK9A 4ML7B 4UU3A 1E00A 1OPBA 4AZNA 2RTCB 1DF8A 4BOEA 2ASNX 2QM9A 2QOMA 2OFBA 2RTNB 4HPDA 3CKGA 4Z6JA 4ZGFA 4BX6A 1VWOB 1RXKA 2OVAA 2OYBO 4FBVA 2EU7X 4FGIB 1KT4A 5LJKA 4ZCBA 1RXJA 4QRLA 3WJDA 3CKFA 2AL0X 2OF8A 3RDQA 1KT6A 1ADLA 1OEKA 1EXSA 4JO6A 3WJEA 3WZPA 4DCBA 1BWYA 5EDBA 2GTLN 4I6SA 1E06A 4QGXA 2VDFA 1HQPA 1IJ8A 1SWTA 1I04A 1NQMA 1SRFA 2RTQB 4KH8A 4TNNA 4KC8A 2HNXA 3D95A 5FQ7E 5DPQA 3ZW2A 1I05A 2HZRA 2RTFB 2ACOA 4O4XA 1KGLA 2R56A 3EBKA 5IRWA 1SY3A 1IFCA 3BY0A 5B11O 1SWSA 1MK5A 2FHLA 3STMX 2RTPB 5AJCA 3JS1A 1VWDB 4NNSA 4O3YA 2RTBB 4CDEA 1SWGA 1KT7A 2A0AA 4CPFA 1BRPA 1RXHA 3APVA 5EPQA 1S2PA 1E02A 3DTQA 2WEXA 1MVGA 5LJHA 4BX5A 1O1VA 3EC5A 5B29A 1MEPA 3FEKA 3X00A 5D48A 1TXLA 1LDQA 1DC9A 3HTYA 2AVIA 3MVFA 5HCDC 3FA8A 2DJGA 4ZHCA 1QQSA 3S5VA 4GZVA 2FLJA 2FTBA 1N0SA 3PP6A 4CK4A 1RLBE 4ZJ0A 3P02A 4ORWA 4K19A 4INNA 1VWMB 2A2UA 1FENA 2BT9A 1LFOA 4Z2VA 4I3BA 4UU2A 1VWNB 3HOLA 2GTLO 1A2DA 1YWBA 2A5CA 1PM1X 1BLRA 3HK1A 4IAXA 1X8QA 3G7XA 2MHDA 3LTWA 3RWXA 2RTEB 1N43A 3GAQA 4YKMA 1QABE 5CSEA 3FDCA 1TOUA 1KFFA 3FR5A 4D6BA 1I4UA 2X55A 5B5FA 4GGRA 1GT4A 4GKCA 2F01A 3LV4A 4CPEA 3T1DA 2PI3O 4A60A 4ES7A 3IA8A 1VYOA 1LCVA 2CBRA 4O3WA 4A8ZA 1AQBA 4QZUA 1YWCA 2X8SA 4BX7B 2JGSA 4GUZA 1G74A 2W2BA 1RSUB 2JU7A 4OS0A 3BS2A 3VHHA 4AW8A 2CBSA 1KZWA 1I9HA 4YDAA 3ZW0B 3BX7A 4TKJA 1OEEA 3FA6A 4ORSA 2IZLB 1FELA 2RTKA 2NNEA 2R74A 3RDUA 3OE3A 3P6GA 4CDFA 5LJEA 1ERXA 2X8TA 1LIBA 3I0AA 4IMOA 5B10O 5HZQA 3SLJA 4FBOA 2CAMA 2QCBA 5B3MO 3RY2A 3C77X 5L8IA 1EALA 1YUPA 5F1EA 1A3YA 4ON1A 3STNA 3WXQA 4O3XB 3S26A 2NNQA 3BX8A 4IB6A 1JQPA 4YDBA 4GE1A 4TJZA 5HWZA 4IB8A 4AZRA 1NGLA 1LIEA 4YBUA 1KXOA 1B0OA 2A13A 1SY0A 5LKEA 5KICA 3T6LA 3WOVA 1GGLA 1DZJA 3PH6A 1PEEA 3D4RA 4KC7A 1W6FA 3VG7A 3VPJE 3EM0A 3VHMA 3B2LA 1GT1A 1BJ7A 2M4LA 2P8GA 4XMGA 3F9DA 3VU1A 1VWKB 4ORUA 3N91A 4C5PA 5H9KA 2FKJA 4DQ4A 2IZDB 2ZAIA 4IMNA 5DG4A 1EQDA 4KCAA 1JJXA 1WBIA 1X8NA 1MUPA 5B27A 4NV8A 2AF5A 3PEDA 3BLGA 3RY1A 5IO7A 4NNTA 2Z4HA 1QFTA 1SWLA 5KHPA 2IZHB 1VWHB 3KFFA 4HPBA 3RE6A 4CPHB 4QGVA 1AVDA 1FEMA 3CBSA 1OEJA 2DJFA 1CBRA 1VWAB 4ARHA 2L9CA 1SWAA 4I60A 1SLDB 2IZFB 5L8OA 2RTRB 1YWDA 3SOTA 2KT4B 3CR6A 4MVKA 2F73A 2G79A 2BS6A 2JOZA 3ZUIA 3ZW1B 5AEOA 5IO6A 4U46A 4Y0QA 4NYRA 4OS8A 1ML7A 3BDRA 4GJVA 5K67A 1SRGA 2IZBA 3SAOA 1SWUA 4O49A 1VWQB 3V8UA 2G7BA 4OELA 2RTDB 4ZH9A 4GJSA 1Y53X 2RQ0A 3PECA 2MF6A 1ZNGA 4ZFXA 1QFVA 1KL4A 2AT3X 3LHNA 1SWBA 4HWMA 4QQ1A 3RDXA 4YCEA 3VG3A 4EQAC 4QNIA 2LKKA 1RSTB 2RTIB 1SWQA 1SWCA 2OL8O 5B2AO 1SXUA 2IZEB 4EEJA 1MDCA 2CM4A 2FHNX 4A1YA 4CPIA 4YGGA 2GH7A 4BJ8A 2RTJA 4GETA 4AZOA 4DNEA 1JYJA 1HBPA 3WZNA 3WJFA 1NDJA 3WJGA 3QKGA 1W5RA 3Q6LA 4GNWA 2WUTA 3VG5A 3SZHA 1QWDA 3HPEA 1NQNA 4OEMA 4Z2OA 1CJ5A 1EPBA 1GKAB 4QYNA 5F6BA 1LF7A 2AT0X 4LZVA 1JIWI 4YKOA 3NQ9A 4ALOA 1VWLB 3E3CA 1S44A 4ZR2A 1OPAA 2RTOB 2HZQA 2X8FA 4IAWA 3FR2A 3HOEA 4YFQA 5HAEA 3ZUOA 5LJGA 2HLVA 4GGTA 4WBKA 5D4AA 3STKA 1UREA 3IFBA 1SRHA 1ZNEA 1IKEA 1QY0A 2BLGA 3NADA 1MX8A 3Q34A 1STPA 5CYBA 4BX6B 5IXGA 4HFOA 5HZ9A 1WUBA 2OF9A 1HQQA 2WEWA 2LBVA 1EW3A 2FT9A 3O19A 1LUQA 2ANSA 2R73A 4XMHA 4D6AA 2X56A 5BVSA 4O3ZA 2AT5X 4IB9A 4BGFA 1HY2A 1KOIA 1PBYA 3CBCA 1W4TA 3FEPA 1ICMA 2FR2A 3EBWA 3P6EA 4MISA 4GNYA 5K68A 2OY7A 2RCQA 1T8VA 4AZQA 2OFMX 1SREA 4IB7A 4DQ3A 3UEXA 2AH7X 4TKBA 2CM9A 3FA7A 1ICNA 1NP4A 1VWIB 1DF3A 2C1QA 2HYSA 1LIDA 2QOSC 1U0XA 1PBOA 3VG4A 1JJJA 1CBSA 4FBRA 4ZGUA 1X8PA 2L67A 4EKVA 3VHIA 3MX7A 3U0DA 1AVGI 2YG2A 4XMCA 1JMZA 2IZGB 3RDOA 1O8VA 4BQUA 2VFBA 2ZSCA 4NLJA 2BS5A 1L6MA 3EW1A 3UEUA 1STSB 5KIDA 3U03A 2RA6A 1SY2A 5HZ5A 1MX7A 1UYNX 1LCWA 1GX8A 2GJ5A 4BX5B 2WSJA 5F7GA 1LELA 5F58A 5HZ8A 5C0NA 1SWOA 5AQ6A 1CRBA 3HWFA 3WYPA 4Z28A 4I3DA 1XCAA 1SWFA 3KZAA 5IRAA 3VG6A 1PMPA 4B55A 4ZHHA 1E5PA 3D97A 4RUNA 4IRWA 4LZUA 3VE2A 4CSBA 1ZNKA 2XSTA 1JBHA 4NLIA 4YGZA 1U17A 2RD7C 1DV9A 1DZMA 2UZ2A 3F8AA 5D8JA 4COTA 4GGZA 1GT5A 3NQ3A 4GU8A 1SMPI 1K3BA 5LKFA 1VWRB 3TF6A 1IFBA 2IZCB 2XKLA 1N7YA 3KFGA 2WQ9A 3FMZA 3B2IA 1DFVA 2BC3A 3APXA 4QGWA 4CV7A 4U9CA 2QMIA 2LFOA 3BSZE 3SZJA 1T68X 1Y55X 1BSYA 1X71A 2I5VO 3B2JA 5FAZA 1GX9A 2A3FX 3APWA 1G7NA 4QZTA 4U8UM 3FLLA 2MWHA 2L5PA 3D96A 1ERBA 4MVEA 2G78A 2KTDA 3APUA 3MBTA 5LJBA 2IZJA 2PY1A 4QAEA 2FWVA 2IFBA 2IZAA 2A5BA 1SXYA 1UYOX 3FYFA 3WZOA 4EXZA 1KT3A 4JNJA 1YP6A 3ZWEA 2NNDA 4N7CA 1JJUA 4Y0PA 1YIVA 5EDCA 3RKGA 2JN3A 3TGCA 5BVTA 2X34A 1HXLA 5HBSA 5JR8A 1U18A 4I3CA 2Y3FA 3JQOA 2G8CO 2OL6O 5IRUA 1BM5A 2QO4A 2DM5A 3ELZA 1HBQA 4MEEA 3FA9A 3MM0A 1Y9LA 2I5ZO 4M7MA 4I9SA 4L1NA 2LA7A 2K62A 3CWKA 1EUOA 1N9MA 3WJBA 1SWRA 1EIOA 2OY5O 1HMSA 1XKIA 3SZIA 1VWFB 2AKQA 2WR6A 5L8NA 3CMPA 4ZHFA 1IKJA 1MM9A 1RBPA 2RTHB 1P6PA 3B2HA 3HWGA 2C1SA 4OMXA 3EYCA 1GX3A 4ORXA 4TLJA 5HA1A 3KQ0A 2KW1A 2Q39A 4XMFA 3RDMA 4Y0SA 3K3LA 4AZPA 3WZQA 4ID2A 1GM6A 1OSPO 1LICA 3FENA 1VYGA
chains in the Genus database with same CATH topology
1KL3A 1SRHA 2RTGB 4BX6B 2RTEB 1N43A 2WPUA 1STPA 1SLEB 5CHKA 5CSEA 3FDCA 2OF9A 1NBXA 1KFFA 1HQQA 2UYWA 4JHQA 5B5FA 1LUQA 5JD2A 4GGRA 2F01A 1HXZA 4CPEA 3RE5A 1SWNA 1VYOA 1LCVA 1HY2A 2RTLA 5K68A 4GDAA 4BX7B 2OFAA 4BBOA 1SLFB 2JGSA 1Y52X 1RSUB 3VHHA 1SREA 1I9HA 1VWIB 3RDUA 2C1QA 2IZLB 2RTKA 3PK2A 3T2XA 1VWEB 1SWDA 3WYQA 1LCZA 1N9YA 4EKVA 1VWCB 5B5GA 3VHIA 5F2BA 4YVBA 2CAMA 1KL5A 2QCBA 4Z27A 1AVEA 3RY2A 1STRB 2A8GA 1SWPA 1SWJA 2IZGB 4Z2PA 3RDOA 2ZSCA 3EW1A 1MOYA 1STSB 1SRJA 1SRIA 1LCWA 4Y59A 1PTSA 4BX5B 3T6LA 1RAVA 3T6FA 1LELA 1VWBB 1SWOA 1VWGB 3VHMA 1SWKA 4GD9A 2IZKA 4Z28A 3WYPA 2RTAA 5IRAA 1SWFA 1VWKB 4BCSA 3EW2A 4IRWA 2IZDB 2RTCB 1DF8A 2RTNB 1WBIA 2OFBA 4Z6JA 2Y3EA 1VWPB 4BX6A 2UZ2A 1VWOB 4GGZA 1RXKA 3RY1A 1SWLA 1VWRB 2IZHB 1VWHB 3RE6A 4CPHB 2IZCB 1N7YA 1RXJA 1AVDA 1SWHA 2BC3A 2OF8A 3SZJA 3RDQA 4BX7A 4JO6A 1VWJB 1Y55X 3WZPA 1VWAB 3RDSA 1SWAA 4I60A 1SLDB 2IZFB 2RTRB 1IJ8A 1SWTA 1SRFA 1NQMA 2RTQB 5L3YA 4U46A 2RTFB 5K67A 4GJVA 2IZJA 1SRGA 2IZBA 5IRWA 1SWUA 1VWQB 2A5BA 2IZAA 3WZOA 1SWSA 1MK5A 1NC9A 2FHLA 2RTDB 2RTPB 4GJSA 1Y53X 1VWDB 2G5LA 4JNJA 2MF6A 2RTBB 1SWGA 4CPFA 1RXHA 1SWEA 4Y5DA 1KL4A 1HXLA 1SWBA 3RDXA 2Y3FA 5IRUA 1RSTB 2RTIB 2Y32A 4BX5A 1SWQA 3MG5A 1SWCA 1MEPA 3T2WA 3MM0A 3X00A 2IZEB 1LDQA 2FHNX 4CPIA 2AVIA 2GH7A 4BJ8A 1LDOA 2RTJA 4DNEA 1N9MA 3WZNA 1NDJA 1N4JA 1SWRA 2IZIA 4Z2OA 3SZHA 1NQNA 1VWFB 3SZIA 2C4IA 1SLGB 1VWMB 1MM9A 2RTHB 1VWLB 2C1SA 3VGWA 4Z2VA 3RDMA 1VWNB 2RTOB 3WZQA 2A5CA 4CPHA 2RTMA 4GGTA 4OKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KL3 A;  1SRH A;  2RTG B;  4BX6 B;  2RTE B;  1N43 A;  2WPU A;  1STP A;  1SLE B;  5CHK A;  5CSE A;  3FDC A;  2OF9 A;  1NBX A;  1KFF A;  1HQQ A;  2UYW A;  4JHQ A;  5B5F A;  1LUQ A;  5JD2 A;  4GGR A;  2F01 A;  1HXZ A;  4CPE A;  3RE5 A;  1SWN A;  1VYO A;  1LCV A;  1HY2 A;  2RTL A;  5K68 A;  4GDA A;  4BX7 B;  2OFA A;  4BBO A;  1SLF B;  2JGS A;  1Y52 X;  1RSU B;  3VHH A;  1SRE A;  1I9H A;  1VWI B;  3RDU A;  2C1Q A;  2IZL B;  2RTK A;  3PK2 A;  3T2X A;  1VWE B;  1SWD A;  3WYQ A;  1LCZ A;  1N9Y A;  4EKV A;  1VWC B;  5B5G A;  3VHI A;  5F2B A;  4YVB A;  2CAM A;  1KL5 A;  2QCB A;  4Z27 A;  1AVE A;  3RY2 A;  1STR B;  2A8G A;  1SWP A;  1SWJ A;  2IZG B;  4Z2P A;  3RDO A;  2ZSC A;  3EW1 A;  1MOY A;  1STS B;  1SRJ A;  1SRI A;  1LCW A;  4Y59 A;  1PTS A;  4BX5 B;  3T6L A;  1RAV A;  3T6F A;  1LEL A;  1VWB B;  1SWO A;  1VWG B;  3VHM A;  1SWK A;  4GD9 A;  2IZK A;  4Z28 A;  3WYP A;  2RTA A;  5IRA A;  1SWF A;  1VWK B;  4BCS A;  3EW2 A;  4IRW A;  2IZD B;  2RTC B;  1DF8 A;  2RTN B;  1WBI A;  2OFB A;  4Z6J A;  2Y3E A;  1VWP B;  4BX6 A;  2UZ2 A;  1VWO B;  4GGZ A;  1RXK A;  3RY1 A;  1SWL A;  1VWR B;  2IZH B;  1VWH B;  3RE6 A;  4CPH B;  2IZC B;  1N7Y A;  1RXJ A;  1AVD A;  1SWH A;  2BC3 A;  2OF8 A;  3SZJ A;  3RDQ A;  4BX7 A;  4JO6 A;  1VWJ B;  1Y55 X;  3WZP A;  1VWA B;  3RDS A;  1SWA A;  4I60 A;  1SLD B;  2IZF B;  2RTR B;  1IJ8 A;  1SWT A;  1SRF A;  1NQM A;  2RTQ B;  5L3Y A;  4U46 A;  2RTF B;  5K67 A;  4GJV A;  2IZJ A;  1SRG A;  2IZB A;  5IRW A;  1SWU A;  1VWQ B;  2A5B A;  2IZA A;  3WZO A;  1SWS A;  1MK5 A;  1NC9 A;  2FHL A;  2RTD B;  2RTP B;  4GJS A;  1Y53 X;  1VWD B;  2G5L A;  4JNJ A;  2MF6 A;  2RTB B;  1SWG A;  4CPF A;  1RXH A;  1SWE A;  4Y5D A;  1KL4 A;  1HXL A;  1SWB A;  3RDX A;  2Y3F A;  5IRU A;  1RST B;  2RTI B;  2Y32 A;  4BX5 A;  1SWQ A;  3MG5 A;  1SWC A;  1MEP A;  3T2W A;  3MM0 A;  3X00 A;  2IZE B;  1LDQ A;  2FHN X;  4CPI A;  2AVI A;  2GH7 A;  4BJ8 A;  1LDO A;  2RTJ A;  4DNE A;  1N9M A;  3WZN A;  1NDJ A;  1N4J A;  1SWR A;  2IZI A;  4Z2O A;  3SZH A;  1NQN A;  1VWF B;  3SZI A;  2C4I A;  1SLG B;  1VWM B;  1MM9 A;  2RTH B;  1VWL B;  2C1S A;  3VGW A;  4Z2V A;  3RDM A;  1VWN B;  2RTO B;  3WZQ A;  2A5C A;  4CPH A;  2RTM A;  4GGT A;  4OKA A; 
#chains in the Genus database with same CATH topology
 4U3Q A;  2POA A;  4EDE A;  1SA8 A;  2WPU A;  1A18 A;  3C76 X;  1SLE B;  4ZHG A;  3FIQ A;  1NBX A;  2FKG A;  2UYW A;  3KFH A;  4RUU A;  1JYD A;  1Z24 A;  2N93 A;  4CDC A;  1FDQ A;  2FRS A;  4OS3 A;  4LKT A;  3RE5 A;  4ZHD A;  1SWN A;  3ZZV A;  2W2F A;  3NX2 A;  3VE1 A;  3WBG A;  2GC9 A;  3RZY A;  4M6S A;  2OL7 A;  2JW1 A;  3QQ2 A;  2OFA A;  4BBO A;  5HTE A;  1SLF B;  3DSZ A;  1Y52 X;  3FR4 A;  3TZS A;  1TVQ A;  4Y0R A;  3FW5 A;  1EII A;  3L4R A;  3CQN A;  1LNM A;  3PK2 A;  1JMX A;  3T2X A;  3PPT A;  3ZQ3 A;  1B56 A;  1VPR A;  1VWE B;  1X8O A;  3GE2 A;  2QO5 A;  3FEL A;  2AT8 X;  3H3I A;  1BSO A;  1N9Y A;  1VWC B;  3BU9 A;  3P6F A;  4MIR A;  5B5G A;  5HA0 A;  4Z27 A;  1A57 A;  1STR B;  3KVN A;  1SWJ A;  3O2Y A;  4ALB A;  1UZ2 X;  3P6H A;  5FQ6 E;  1OBP A;  5CE4 A;  2KD2 A;  1DZP A;  3AKN A;  3D9W A;  3OD9 A;  1ZNL A;  3SLO A;  1SRI A;  2F09 A;  2X45 A;  5EED A;  3NPO A;  1D3S A;  1EPA A;  5H9L A;  3FW4 A;  3T6F A;  4ODD A;  4TQ2 A;  4HPC A;  1SWK A;  2Q4N A;  4FQB B;  1H91 A;  5IO5 A;  4ORY A;  4XME A;  1HMR A;  2NP1 A;  4TKH A;  3JSQ A;  1X8U A;  4R0B A;  1FJ1 E;  4MVI A;  3UEW A;  2MJI A;  5BVQ A;  1GT3 A;  2Y3E A;  1VWP B;  3AKM A;  2BSZ A;  2ACP X;  3KFI A;  1YWA A;  3RBY A;  1LIF A;  1Y0G A;  2JMB A;  3NX1 A;  5FFH A;  2OY8 A;  4IAB A;  2AMM X;  4GDZ A;  2FR3 A;  4O4S A;  4U8U O;  3O22 A;  5H8T A;  3TGA A;  1Y9T A;  1BBP A;  1LKE A;  3OBL A;  5D45 A;  1O1U A;  1SWH A;  4PSQ A;  1HMT A;  1HN2 A;  3RSW A;  1QY2 A;  4BX7 A;  1VWJ B;  4NV7 A;  4YGH A;  3RDS A;  4I95 A;  1YP7 A;  3ZW0 A;  4GRJ A;  4YVB A;  5L3Y A;  2HMB A;  2RN4 A;  4GH7 A;  1K24 A;  3NBX X;  1BRQ A;  3PQS A;  1ZND A;  3ELX A;  4LQZ A;  4WHI A;  1EI5 A;  5D47 A;  5HTD A;  1BSQ A;  1OBQ A;  3TGB A;  4AYH A;  3I17 A;  5EZ2 A;  2A2G A;  1NC9 A;  2JU3 A;  1ACD A;  2FGS A;  1SXW A;  2G5L A;  2LB6 A;  1QG5 A;  1S7D A;  4HPA A;  2CZU A;  1SWE A;  4PJ2 A;  4Y5D A;  1I06 A;  4L3R A;  1VYF A;  1GXA A;  4NP1 A;  3UEV A;  1R0U A;  2Y32 A;  2JU8 A;  2X46 A;  3MG5 A;  1FTP A;  4O4O A;  3T2W A;  4YMY A;  2X4M A;  1ZRY A;  2E4J A;  4I9R A;  2CZT A;  3WJC A;  1LDO A;  5FQ8 E;  1E2T A;  3S5X A;  1LPJ A;  1CBI A;  1N4J A;  2IZI A;  2KTS A;  3AUM O;  3B2K A;  4WFV A;  2C4I A;  2Q9S A;  4OMW A;  4A1H A;  3BRN A;  1SLG B;  4YFR A;  1G5W A;  3P6D A;  5FEN A;  3HWD A;  4JGL A;  2OFR X;  5HCE C;  3P24 A;  3VGW A;  4BVM A;  2WQA E;  4O4U A;  4ORR A;  4XMD A;  5H9A A;  5F6Z A;  5K06 A;  1QY1 A;  4CPH A;  2RTM A;  2HKD A;  5BYP A;  1CBQ A;  4OKA A;  3S60 A;  1KL3 A;  5HZ6 A;  5EEE A;  1ALB A;  2RTG B;  4NYQ A;  5CHK A;  5LJD A;  1AB0 A;  3C78 X;  1B4M A;  5H9N A;  2OVS A;  3FID A;  1JZU A;  2OVD A;  2Q2P A;  2W2A A;  4JHQ A;  2GTL M;  3AEH A;  5JD2 A;  3ZW1 A;  1HXZ A;  4YFP A;  5AJB A;  2OY1 O;  4KT5 A;  1FE3 A;  1SXX A;  3EMM A;  2WWP A;  2ZAG A;  3NQK A;  5LJC A;  2RTL A;  3F6Z B;  2OZQ A;  3SLT A;  4EFG A;  2RCT A;  2ALL X;  4GDA A;  1KQX A;  4O9S A;  4YCH A;  3VG2 A;  1AEL A;  3ZI8 A;  1IIU A;  4CDD A;  1TOW A;  4QYP A;  3UAQ A;  4AZM A;  3CQR A;  1ZNH A;  2Q2M A;  1KT5 A;  2MO5 A;  2Z4I A;  3WYQ A;  1SWD A;  1KQW A;  1LCZ A;  2LBA A;  2O62 A;  4WFU A;  4ZH6 A;  1B8E A;  3WVM A;  4N7D A;  1OBU A;  2QO6 A;  2YMS A;  3PQU A;  2VFC A;  3OJY C;  3PH5 A;  4IBA A;  1KL5 A;  4MVL A;  2BHV A;  1AVE A;  3P6C A;  5F2B A;  2A8G A;  1SWP A;  4Z2P A;  1IW2 A;  1T0V A;  1DZK A;  2MM3 A;  3NP1 A;  1X89 A;  3BU1 A;  2K23 A;  1SY1 A;  4YH0 A;  1MOY A;  1JV4 A;  2AT6 X;  1SRJ A;  2X32 A;  1NP1 A;  3PDF A;  4LKP A;  1BEB A;  3U9P C;  5HCC C;  1TW4 A;  4Y59 A;  1PTS A;  1GKA A;  1RAV A;  2GTF X;  4KII A;  4NW4 A;  1KZX A;  1VWB B;  1VWG B;  2L68 A;  3NR3 A;  2FS7 A;  3HWE A;  2IZK A;  4GD9 A;  2OVE A;  2RTA A;  4YBP A;  1I78 A;  4BCS A;  1D2U A;  2FS6 A;  3EW2 A;  4U8U N;  1G85 A;  4GK9 A;  4ML7 B;  4UU3 A;  1E00 A;  1OPB A;  4AZN A;  2RTC B;  1DF8 A;  4BOE A;  2ASN X;  2QM9 A;  2QOM A;  2OFB A;  2RTN B;  4HPD A;  3CKG A;  4Z6J A;  4ZGF A;  4BX6 A;  1VWO B;  1RXK A;  2OVA A;  2OYB O;  4FBV A;  2EU7 X;  4FGI B;  1KT4 A;  5LJK A;  4ZCB A;  1RXJ A;  4QRL A;  3WJD A;  3CKF A;  2AL0 X;  2OF8 A;  3RDQ A;  1KT6 A;  1ADL A;  1OEK A;  1EXS A;  4JO6 A;  3WJE A;  3WZP A;  4DCB A;  1BWY A;  5EDB A;  2GTL N;  4I6S A;  1E06 A;  4QGX A;  2VDF A;  1HQP A;  1IJ8 A;  1SWT A;  1I04 A;  1NQM A;  1SRF A;  2RTQ B;  4KH8 A;  4TNN A;  4KC8 A;  2HNX A;  3D95 A;  5FQ7 E;  5DPQ A;  3ZW2 A;  1I05 A;  2HZR A;  2RTF B;  2ACO A;  4O4X A;  1KGL A;  2R56 A;  3EBK A;  5IRW A;  1SY3 A;  1IFC A;  3BY0 A;  5B11 O;  1SWS A;  1MK5 A;  2FHL A;  3STM X;  2RTP B;  5AJC A;  3JS1 A;  1VWD B;  4NNS A;  4O3Y A;  2RTB B;  4CDE A;  1SWG A;  1KT7 A;  2A0A A;  4CPF A;  1BRP A;  1RXH A;  3APV A;  5EPQ A;  1S2P A;  1E02 A;  3DTQ A;  2WEX A;  1MVG A;  5LJH A;  4BX5 A;  1O1V A;  3EC5 A;  5B29 A;  1MEP A;  3FEK A;  3X00 A;  5D48 A;  1TXL A;  1LDQ A;  1DC9 A;  3HTY A;  2AVI A;  3MVF A;  5HCD C;  3FA8 A;  2DJG A;  4ZHC A;  1QQS A;  3S5V A;  4GZV A;  2FLJ A;  2FTB A;  1N0S A;  3PP6 A;  4CK4 A;  1RLB E;  4ZJ0 A;  3P02 A;  4ORW A;  4K19 A;  4INN A;  1VWM B;  2A2U A;  1FEN A;  2BT9 A;  1LFO A;  4Z2V A;  4I3B A;  4UU2 A;  1VWN B;  3HOL A;  2GTL O;  1A2D A;  1YWB A;  2A5C A;  1PM1 X;  1BLR A;  3HK1 A;  4IAX A;  1X8Q A;  3G7X A;  2MHD A;  3LTW A;  3RWX A;  2RTE B;  1N43 A;  3GAQ A;  4YKM A;  1QAB E;  5CSE A;  3FDC A;  1TOU A;  1KFF A;  3FR5 A;  4D6B A;  1I4U A;  2X55 A;  5B5F A;  4GGR A;  1GT4 A;  4GKC A;  2F01 A;  3LV4 A;  4CPE A;  3T1D A;  2PI3 O;  4A60 A;  4ES7 A;  3IA8 A;  1VYO A;  1LCV A;  2CBR A;  4O3W A;  4A8Z A;  1AQB A;  4QZU A;  1YWC A;  2X8S A;  4BX7 B;  2JGS A;  4GUZ A;  1G74 A;  2W2B A;  1RSU B;  2JU7 A;  4OS0 A;  3BS2 A;  3VHH A;  4AW8 A;  2CBS A;  1KZW A;  1I9H A;  4YDA A;  3ZW0 B;  3BX7 A;  4TKJ A;  1OEE A;  3FA6 A;  4ORS A;  2IZL B;  1FEL A;  2RTK A;  2NNE A;  2R74 A;  3RDU A;  3OE3 A;  3P6G A;  4CDF A;  5LJE A;  1ERX A;  2X8T A;  1LIB A;  3I0A A;  4IMO A;  5B10 O;  5HZQ A;  3SLJ A;  4FBO A;  2CAM A;  2QCB A;  5B3M O;  3RY2 A;  3C77 X;  5L8I A;  1EAL A;  1YUP A;  5F1E A;  1A3Y A;  4ON1 A;  3STN A;  3WXQ A;  4O3X B;  3S26 A;  2NNQ A;  3BX8 A;  4IB6 A;  1JQP A;  4YDB A;  4GE1 A;  4TJZ A;  5HWZ A;  4IB8 A;  4AZR A;  1NGL A;  1LIE A;  4YBU A;  1KXO A;  1B0O A;  2A13 A;  1SY0 A;  5LKE A;  5KIC A;  3T6L A;  3WOV A;  1GGL A;  1DZJ A;  3PH6 A;  1PEE A;  3D4R A;  4KC7 A;  1W6F A;  3VG7 A;  3VPJ E;  3EM0 A;  3VHM A;  3B2L A;  1GT1 A;  1BJ7 A;  2M4L A;  2P8G A;  4XMG A;  3F9D A;  3VU1 A;  1VWK B;  4ORU A;  3N91 A;  4C5P A;  5H9K A;  2FKJ A;  4DQ4 A;  2IZD B;  2ZAI A;  4IMN A;  5DG4 A;  1EQD A;  4KCA A;  1JJX A;  1WBI A;  1X8N A;  1MUP A;  5B27 A;  4NV8 A;  2AF5 A;  3PED A;  3BLG A;  3RY1 A;  5IO7 A;  4NNT A;  2Z4H A;  1QFT A;  1SWL A;  5KHP A;  2IZH B;  1VWH B;  3KFF A;  4HPB A;  3RE6 A;  4CPH B;  4QGV A;  1AVD A;  1FEM A;  3CBS A;  1OEJ A;  2DJF A;  1CBR A;  1VWA B;  4ARH A;  2L9C A;  1SWA A;  4I60 A;  1SLD B;  2IZF B;  5L8O A;  2RTR B;  1YWD A;  3SOT A;  2KT4 B;  3CR6 A;  4MVK A;  2F73 A;  2G79 A;  2BS6 A;  2JOZ A;  3ZUI A;  3ZW1 B;  5AEO A;  5IO6 A;  4U46 A;  4Y0Q A;  4NYR A;  4OS8 A;  1ML7 A;  3BDR A;  4GJV A;  5K67 A;  1SRG A;  2IZB A;  3SAO A;  1SWU A;  4O49 A;  1VWQ B;  3V8U A;  2G7B A;  4OEL A;  2RTD B;  4ZH9 A;  4GJS A;  1Y53 X;  2RQ0 A;  3PEC A;  2MF6 A;  1ZNG A;  4ZFX A;  1QFV A;  1KL4 A;  2AT3 X;  3LHN A;  1SWB A;  4HWM A;  4QQ1 A;  3RDX A;  4YCE A;  3VG3 A;  4EQA C;  4QNI A;  2LKK A;  1RST B;  2RTI B;  1SWQ A;  1SWC A;  2OL8 O;  5B2A O;  1SXU A;  2IZE B;  4EEJ A;  1MDC A;  2CM4 A;  2FHN X;  4A1Y A;  4CPI A;  4YGG A;  2GH7 A;  4BJ8 A;  2RTJ A;  4GET A;  4AZO A;  4DNE A;  1JYJ A;  1HBP A;  3WZN A;  3WJF A;  1NDJ A;  3WJG A;  3QKG A;  1W5R A;  3Q6L A;  4GNW A;  2WUT A;  3VG5 A;  3SZH A;  1QWD A;  3HPE A;  1NQN A;  4OEM A;  4Z2O A;  1CJ5 A;  1EPB A;  1GKA B;  4QYN A;  5F6B A;  1LF7 A;  2AT0 X;  4LZV A;  1JIW I;  4YKO A;  3NQ9 A;  4ALO A;  1VWL B;  3E3C A;  1S44 A;  4ZR2 A;  1OPA A;  2RTO B;  2HZQ A;  2X8F A;  4IAW A;  3FR2 A;  3HOE A;  4YFQ A;  5HAE A;  3ZUO A;  5LJG A;  2HLV A;  4GGT A;  4WBK A;  5D4A A;  3STK A;  1URE A;  3IFB A;  1SRH A;  1ZNE A;  1IKE A;  1QY0 A;  2BLG A;  3NAD A;  1MX8 A;  3Q34 A;  1STP A;  5CYB A;  4BX6 B;  5IXG A;  4HFO A;  5HZ9 A;  1WUB A;  2OF9 A;  1HQQ A;  2WEW A;  2LBV A;  1EW3 A;  2FT9 A;  3O19 A;  1LUQ A;  2ANS A;  2R73 A;  4XMH A;  4D6A A;  2X56 A;  5BVS A;  4O3Z A;  2AT5 X;  4IB9 A;  4BGF A;  1HY2 A;  1KOI A;  1PBY A;  3CBC A;  1W4T A;  3FEP A;  1ICM A;  2FR2 A;  3EBW A;  3P6E A;  4MIS A;  4GNY A;  5K68 A;  2OY7 A;  2RCQ A;  1T8V A;  4AZQ A;  2OFM X;  1SRE A;  4IB7 A;  4DQ3 A;  3UEX A;  2AH7 X;  4TKB A;  2CM9 A;  3FA7 A;  1ICN A;  1NP4 A;  1VWI B;  1DF3 A;  2C1Q A;  2HYS A;  1LID A;  2QOS C;  1U0X A;  1PBO A;  3VG4 A;  1JJJ A;  1CBS A;  4FBR A;  4ZGU A;  1X8P A;  2L67 A;  4EKV A;  3VHI A;  3MX7 A;  3U0D A;  1AVG I;  2YG2 A;  4XMC A;  1JMZ A;  2IZG B;  3RDO A;  1O8V A;  4BQU A;  2VFB A;  2ZSC A;  4NLJ A;  2BS5 A;  1L6M A;  3EW1 A;  3UEU A;  1STS B;  5KID A;  3U03 A;  2RA6 A;  1SY2 A;  5HZ5 A;  1MX7 A;  1UYN X;  1LCW A;  1GX8 A;  2GJ5 A;  4BX5 B;  2WSJ A;  5F7G A;  1LEL A;  5F58 A;  5HZ8 A;  5C0N A;  1SWO A;  5AQ6 A;  1CRB A;  3HWF A;  3WYP A;  4Z28 A;  4I3D A;  1XCA A;  1SWF A;  3KZA A;  5IRA A;  3VG6 A;  1PMP A;  4B55 A;  4ZHH A;  1E5P A;  3D97 A;  4RUN A;  4IRW A;  4LZU A;  3VE2 A;  4CSB A;  1ZNK A;  2XST A;  1JBH A;  4NLI A;  4YGZ A;  1U17 A;  2RD7 C;  1DV9 A;  1DZM A;  2UZ2 A;  3F8A A;  5D8J A;  4COT A;  4GGZ A;  1GT5 A;  3NQ3 A;  4GU8 A;  1SMP I;  1K3B A;  5LKF A;  1VWR B;  3TF6 A;  1IFB A;  2IZC B;  2XKL A;  1N7Y A;  3KFG A;  2WQ9 A;  3FMZ A;  3B2I A;  1DFV A;  2BC3 A;  3APX A;  4QGW A;  4CV7 A;  4U9C A;  2QMI A;  2LFO A;  3BSZ E;  3SZJ A;  1T68 X;  1Y55 X;  1BSY A;  1X71 A;  2I5V O;  3B2J A;  5FAZ A;  1GX9 A;  2A3F X;  3APW A;  1G7N A;  4QZT A;  4U8U M;  3FLL A;  2MWH A;  2L5P A;  3D96 A;  1ERB A;  4MVE A;  2G78 A;  2KTD A;  3APU A;  3MBT A;  5LJB A;  2IZJ A;  2PY1 A;  4QAE A;  2FWV A;  2IFB A;  2IZA A;  2A5B A;  1SXY A;  1UYO X;  3FYF A;  3WZO A;  4EXZ A;  1KT3 A;  4JNJ A;  1YP6 A;  3ZWE A;  2NND A;  4N7C A;  1JJU A;  4Y0P A;  1YIV A;  5EDC A;  3RKG A;  2JN3 A;  3TGC A;  5BVT A;  2X34 A;  1HXL A;  5HBS A;  5JR8 A;  1U18 A;  4I3C A;  2Y3F A;  3JQO A;  2G8C O;  2OL6 O;  5IRU A;  1BM5 A;  2QO4 A;  2DM5 A;  3ELZ A;  1HBQ A;  4MEE A;  3FA9 A;  3MM0 A;  1Y9L A;  2I5Z O;  4M7M A;  4I9S A;  4L1N A;  2LA7 A;  2K62 A;  3CWK A;  1EUO A;  1N9M A;  3WJB A;  1SWR A;  1EIO A;  2OY5 O;  1HMS A;  1XKI A;  3SZI A;  1VWF B;  2AKQ A;  2WR6 A;  5L8N A;  3CMP A;  4ZHF A;  1IKJ A;  1MM9 A;  1RBP A;  2RTH B;  1P6P A;  3B2H A;  3HWG A;  2C1S A;  4OMX A;  3EYC A;  1GX3 A;  4ORX A;  4TLJ A;  5HA1 A;  3KQ0 A;  2KW1 A;  2Q39 A;  4XMF A;  3RDM A;  4Y0S A;  3K3L A;  4AZP A;  3WZQ A;  4ID2 A;  1GM6 A;  1OSP O;  1LIC A;  3FEN A;  1VYG A; 
#chains in the Genus database with same CATH homology
 1KL3 A;  1SRH A;  2RTG B;  4BX6 B;  2RTE B;  1N43 A;  2WPU A;  1STP A;  1SLE B;  5CHK A;  5CSE A;  3FDC A;  2OF9 A;  1NBX A;  1KFF A;  1HQQ A;  2UYW A;  4JHQ A;  5B5F A;  1LUQ A;  5JD2 A;  4GGR A;  2F01 A;  1HXZ A;  4CPE A;  3RE5 A;  1SWN A;  1VYO A;  1LCV A;  1HY2 A;  2RTL A;  5K68 A;  4GDA A;  4BX7 B;  2OFA A;  4BBO A;  1SLF B;  2JGS A;  1Y52 X;  1RSU B;  3VHH A;  1SRE A;  1I9H A;  1VWI B;  3RDU A;  2C1Q A;  2IZL B;  2RTK A;  3PK2 A;  3T2X A;  1VWE B;  1SWD A;  3WYQ A;  1LCZ A;  1N9Y A;  4EKV A;  1VWC B;  5B5G A;  3VHI A;  5F2B A;  4YVB A;  2CAM A;  1KL5 A;  2QCB A;  4Z27 A;  1AVE A;  3RY2 A;  1STR B;  2A8G A;  1SWP A;  1SWJ A;  2IZG B;  4Z2P A;  3RDO A;  2ZSC A;  3EW1 A;  1MOY A;  1STS B;  1SRJ A;  1SRI A;  1LCW A;  4Y59 A;  1PTS A;  4BX5 B;  3T6L A;  1RAV A;  3T6F A;  1LEL A;  1VWB B;  1SWO A;  1VWG B;  3VHM A;  1SWK A;  4GD9 A;  2IZK A;  4Z28 A;  3WYP A;  2RTA A;  5IRA A;  1SWF A;  1VWK B;  4BCS A;  3EW2 A;  4IRW A;  2IZD B;  2RTC B;  1DF8 A;  2RTN B;  1WBI A;  2OFB A;  4Z6J A;  2Y3E A;  1VWP B;  4BX6 A;  2UZ2 A;  1VWO B;  4GGZ A;  1RXK A;  3RY1 A;  1SWL A;  1VWR B;  2IZH B;  1VWH B;  3RE6 A;  4CPH B;  2IZC B;  1N7Y A;  1RXJ A;  1AVD A;  1SWH A;  2BC3 A;  2OF8 A;  3SZJ A;  3RDQ A;  4BX7 A;  4JO6 A;  1VWJ B;  1Y55 X;  3WZP A;  1VWA B;  3RDS A;  1SWA A;  4I60 A;  1SLD B;  2IZF B;  2RTR B;  1IJ8 A;  1SWT A;  1SRF A;  1NQM A;  2RTQ B;  5L3Y A;  4U46 A;  2RTF B;  5K67 A;  4GJV A;  2IZJ A;  1SRG A;  2IZB A;  5IRW A;  1SWU A;  1VWQ B;  2A5B A;  2IZA A;  3WZO A;  1SWS A;  1MK5 A;  1NC9 A;  2FHL A;  2RTD B;  2RTP B;  4GJS A;  1Y53 X;  1VWD B;  2G5L A;  4JNJ A;  2MF6 A;  2RTB B;  1SWG A;  4CPF A;  1RXH A;  1SWE A;  4Y5D A;  1KL4 A;  1HXL A;  1SWB A;  3RDX A;  2Y3F A;  5IRU A;  1RST B;  2RTI B;  2Y32 A;  4BX5 A;  1SWQ A;  3MG5 A;  1SWC A;  1MEP A;  3T2W A;  3MM0 A;  3X00 A;  2IZE B;  1LDQ A;  2FHN X;  4CPI A;  2AVI A;  2GH7 A;  4BJ8 A;  1LDO A;  2RTJ A;  4DNE A;  1N9M A;  3WZN A;  1NDJ A;  1N4J A;  1SWR A;  2IZI A;  4Z2O A;  3SZH A;  1NQN A;  1VWF B;  3SZI A;  2C4I A;  1SLG B;  1VWM B;  1MM9 A;  2RTH B;  1VWL B;  2C1S A;  3VGW A;  4Z2V A;  3RDM A;  1VWN B;  2RTO B;  3WZQ A;  2A5C A;  4CPH A;  2RTM A;  4GGT A;  4OKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...