1AELA

Nmr structure of apo intestinal fatty acid-binding protein, 20 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
131
structure length
131
Chain Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords FATTY ACID-BINDING PROTEIN
publication title Ligand binding alters the backbone mobility of intestinal fatty acid-binding protein as monitored by 15N NMR relaxation and 1H exchange.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 11
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 1996-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1aelA00
5LJHA 3C76X 4ZHFA 4NNTA 4RUNA 2AL0X 2Q39A 3B2LA 1D3SA 4AYHA 2LBAA 1QG5A 1JZUA 1CBIA 3P6FA 4I3BA 4PSQA 2NNDA 3MVFA 3JS1A 3VG5A 3UEVA 1GKAA 3SAOA 2WUTA 4TKHA 1GT4A 5HZ8A 2CZTA 3RZYA 2ALLX 4GRJA 5L8NA 5LKEA 3IFBA 1X89A 2OVEA 1G85A 1GX9A 2LB6A 2R56A 3AKNA 5EEEA 2HZQA 4CK4A 2AH7X 2RD7C 3KQ0A 1OBUA 2DM5A 3NQ9A 1IFBA 5BVSA 2NNQA 3FA8A 2GTFX 1YWDA 3APXA 1ZNKA 4I3DA 3FW4A 4WFVA 1QY1A 1LICA 2WEWA 5FFHA 4QGVA 1P6PA 1ICNA 5HTEA 3FLLA 3PECA 1IKEA 4Y0PA 3WJBA 1EQDA 3UEUA 3B2JA 1BRPA 1O8VA 4D6AA 3BLGA 3K3LA 4IB6A 2GJ5A 4HPBA 4OS8A 5IO5A 4LZVA 3CMPA 1SXWA 1TXLA 2A0AA 3B2IA 1X8NA 4GNWA 5DPQA 2R73A 3P6DA 2POAA 1SXYA 2CZUA 1PBOA 1OPBA 3KFGA 3APUA 4IMNA 2HNXA 3T1DA 2WWPA 2AT5X 4XMDA 5B27A 5FENA 4ORSA 3TZSA 4N7DA 2L9CA 1IFCA 2FTBA 1YUPA 3VG6A 3TGBA 3JSQA 1JYDA 3I0AA 5H9AA 5K06A 1BM5A 4LKTA 1IKJA 1SY3A 3OJYC 4YMYA 1S2PA 2OVDA 4IMOA 5L8OA 1AB0A 5LJCA 3G7XA 1YWAA 1DC9A 4XMEA 5CE4A 3CWKA 3D95A 4YFRA 1BRQA 3GAQA 2GC9A 3D96A 2L67A 1BJ7A 3FMZA 3PH5A 1CJ5A 1L6MA 2XKLA 3FW5A 5F6ZA 3STKA 3VG7A 4TJZA 5HTDA 4ZCBA 4ZH6A 4IB8A 4M6SA 3FA7A 3VG3A 3PH6A 5FAZA 1TVQA 1KZWA 4GH7A 4A60A 4AZNA 3PEDA 2FLJA 3BDRA 3WBGA 1B4MA 3HWGA 4YCEA 2ANSA 3EM0A 1ZNLA 2K23A 3FEKA 3IA8A 2O62A 4A8ZA 1I04A 4YCHA 4QGXA 1YWBA 3U03A 1X8UA 2G7BA 3C77X 1ZRYA 1T68X 4ALOA 2OFRX 5B29A 5IO7A 1G7NA 1KT5A 1SXXA 2MJIA 2QO5A 4IB9A 4ORYA 1LFOA 2QO4A 3ELZA 2RCTA 3NPOA 3P6GA 2A2GA 5H9KA 1FTPA 1I06A 4YFPA 5H8TA 5HZ5A 3P6HA 2ACPX 3KFFA 2G78A 4ORRA 3MBTA 4GETA 4ZR2A 1KOIA 3FR4A 4WFUA 1E02A 4IAWA 1A18A 1E5PA 4AW8A 1E00A 1PM1X 3STMX 3STNA 2A13A 2K62A 2FWVA 2HLVA 1ALBA 3RSWA 1PMPA 2F73A 3D97A 3BRNA 3ZUIA 1GX8A 4YDBA 5F58A 2NNEA 3CR6A 4NYRA 4I3CA 3BX8A 1S7DA 1G5WA 3ZQ3A 4ZGUA 1LKEA 4TLJA 1EUOA 2Q4NA 3WXQA 4DQ4A 4D6BA 1A57A 1DF3A 1SY0A 4R0BA 4IBAA 1EIIA 3P6CA 1ERBA 5D47A 1DFVA 5EEDA 1OEKA 2Q2MA 4ES7A 1BEBA 2WQAE 4KIIA 4YGGA 5EZ2A 4TQ2A 5LJDA 3VG4A 1XCAA 1T0VA 2AT8X 3U9PC 4TKBA 1BLRA 3I17A 1JV4A 4IB7A 3CBSA 4WBKA 1LPJA 5KIDA 1N0SA 3B2KA 1MX8A 4XMHA 2RQ0A 1BSYA 5D48A 4A1HA 1RBPA 2RCQA 3B2HA 2A3FX 3C78X 4UU3A 1S44A 1LF7A 1QY2A 3NX1A 4AZPA 5IO6A 3WJGA 1AQBA 1A2DA 1DZJA 4NYQA 5HA1A 1IIUA 1ML7A 1SXUA 2FR3A 4OS0A 5EDCA 5DG4A 1MDCA 1ERXA 5JR8A 1EPBA 1OEEA 1IW2A 1BSQA 2FS7A 4YKMA 5L8IA 2LBVA 2ACOA 3AKMA 2W2BA 3UEWA 1HMTA 3BU9A 5C0NA 1X8OA 2WQ9A 1FDQA 2YG2A 4AZRA 1U17A 3FIQA 1SA8A 1T8VA 3O19A 2QOSC 5D8JA 1Z24A 4MVLA 5D4AA 1LNMA 1AVGI 1GT1A 1KT4A 2Q9SA 5HCCC 1YP7A 4LZUA 1FEMA 4YBPA 3EYCA 2WEXA 1ADLA 4XMGA 5HCEC 1KXOA 1DZKA 1EALA 2IFBA 4OMWA 1VYFA 2E4JA 4ORUA 1FELA 1GT3A 4NLIA 1QQSA 4DQ3A 4AZQA 1GGLA 1D2UA 2HYSA 1MUPA 3Q6LA 4MVIA 4EFGA 1OPAA 4GKCA 1CBQA 3HWEA 4YFQA 5EPQA 5KICA 4XMFA 2LKKA 3HWDA 4GE1A 5H9NA 2XSTA 3PP6A 1EIOA 3U0DA 1EXSA 2R74A 1OBPA 1JYJA 3ZUOA 4M7MA 2QM9A 1YWCA 5HBSA 1KZXA 3S26A 2MM3A 1B0OA 4I9SA 2WR6A 1MVGA 1HMSA 1ZNEA 4EDEA 1JBHA 4BQUA 4EEJA 4ODDA 2L68A 4YGHA 2FT9A 5HWZA 1GXAA 4ZH9A 3KFIA 2W2FA 5LKFA 2OFMX 2G79A 1KT7A 5H9LA 3WVMA 1QABE 1OEJA 2WSJA 1QFTA 1BSOA 1NP1A 4N7CA 2A2UA 5KHPA 1CBSA 3NR3A 2FS6A 5F7GA 2JN3A 4O9SA 1ZNDA 1UREA 4ORXA 4YGZA 4YH0A 5LJEA 3BY0A 2NP1A 1RLBE 1CRBA 1ZNHA 5LJKA 1HMRA 4ALBA 1HN2A 4QYNA 3TGAA 4HPAA 1JJJA 3BSZE 1EW3A 1DZMA 1GM6A 4QYPA 4I9RA 5D45A 5F6BA 4ZHGA 3KZAA 4ZJ0A 1NP4A 3CQNA 3ELXA 3HK1A 1XKIA 1HQPA 2X46A 2X45A 1GKAB 2MO5A 1QY0A 3EBWA 3WJCA 4ZHHA 5BVQA 1LIDA 3BS2A 3EMMA 1BWYA 1KQXA 4BVMA 2KT4B 4QAEA 1I05A 5AQ6A 4YKOA 3FA9A 2AMMX 3O22A 4TNNA 1MX7A 1U0XA 2AT3X 4RUUA 3HWFA 4NNSA 2HMBA 3NP1A 4OMXA 3KFHA 2FR2A 3WJEA 3TGCA 1HBQA 3QKGA 4UU2A 5LJGA 5BVTA 2KTDA 1O1UA 1I4UA 2ASNX 1O1VA 2JU7A 2OVAA 4Y0RA 1SY2A 5HZQA 2P8GA 3FELA 2AKQA 4TKJA 1NGLA 3EBKA 1PEEA 4NLJA 4ZHDA 3P6EA 1VPRA 1YP6A 3NQ3A 4ZFXA 4MVKA 4QZTA 4GNYA 4YBUA 4HPCA 1LIFA 5LJBA 1FENA 4K19A 3FEPA 4QZUA 1A3YA 1VYGA 2RA6A 3DTQA 3F8AA 1H91A 3TF6A 4NP1A 3CQRA 3BU1A 3CBCA 3O2YA 4Y0QA 1YIVA 2CM9A 3WJDA 3FA6A 2LFOA 3APWA 3UEXA 3VG2A 4XMCA 3L4RA 3NADA 2PY1A 3FR5A 4AZOA 5HZ6A 1JJXA 2CBSA 1QWDA 2HZRA 2L5PA 1G74A 3WJFA 2JU8A 2Q2PA 1U18A 3FR2A 1FE3A 1ACDA 2W2AA 5HCDC 5HAEA 4Y0SA 1DV9A 2QO6A 5EDBA 1QFVA 3APVA 4QGWA 1KQWA 1AELA 1ZNGA 1EPAA 1X71A 2FRSA 4AZMA 2BLGA 1X8QA 1KT6A 2JOZA 4OS3A 1OBQA 2N93A 4IAXA 1ICMA 4HFOA 3F9DA 2AT0X 4BOEA 3BX7A 1GT5A 4ORWA 4ZHCA 4YDAA 5HZ9A 3PPTA 2CBRA 2AT6X 3NX2A 1TW4A 5HA0A 1TOUA 3DSZA 4LKPA 1HBPA 1LIEA 1SY1A 1CBRA 1X8PA 1E06A 2EU7X 5F1EA 1B8EA 2CM4A 1R0UA 1LIBA 1BBPA 4EXZA 1TOWA 1KT3A 1UZ2X 4HPDA 2JU3A 4ARHA 1B56A 1KGLA 1DZPA 2OZQA 4A1YA 3FENA
chains in the Genus database with same CATH superfamily
5LJHA 3C76X 4ZHFA 4NNTA 4RUNA 2AL0X 2Q39A 3B2LA 1D3SA 4AYHA 2LBAA 1QG5A 4EQAC 1JZUA 2IZIA 3T2WA 1CBIA 3P6FA 4KC8A 4I3BA 3WZNA 4PSQA 2NNDA 1MEPA 3MVFA 3JS1A 2A5CA 3VG5A 3UEVA 1GKAA 2WPUA 3SAOA 2RTKA 2WUTA 1GT4A 4TKHA 3RBYA 5HZ8A 2CZTA 2BC3A 2ALLX 3RZYA 4GRJA 2X56A 1SWEA 3IFBA 1X89A 2OVEA 1G85A 1GX9A 2F01A 2LB6A 1OSPO 2R56A 4HWMA 3AKNA 4IRWA 4CPIA 2OL6O 5EEEA 4WHIA 2HZQA 4CK4A 1SREA 2AH7X 1SRJA 2RD7C 3N91A 3SZJA 4GJSA 1W6FA 1OBUA 3KQ0A 5JD2A 2DM5A 1SWKA 1IFBA 3NQ9A 5BVSA 2NNQA 3FA8A 2GTFX 1YWDA 5K67A 3APXA 1ZNKA 4I3DA 3FW4A 4WFVA 1QY1A 1IJ8A 1LICA 2WEWA 3MM0A 1P6PA 1ICNA 5FFHA 5HTEA 3RDXA 3FLLA 3PECA 1IKEA 4QGVA 5B10O 4Y0PA 3WJBA 1EQDA 2GH7A 3UEUA 3B2JA 1BRPA 1O8VA 2C4IA 4D6AA 4FQBB 2VFBA 3BLGA 3K3LA 4IB6A 2GJ5A 2X34A 4HPBA 4KCAA 4OS8A 1SWSA 5IO5A 3D9WA 3OD9A 4LZVA 3CMPA 1VWGB 1SXWA 1TXLA 4U8UO 2A0AA 3B2IA 1X8NA 4GNWA 3MG5A 5DPQA 1I9HA 2R73A 3P6DA 2VDFA 1NQMA 2POAA 4O3ZA 1SXYA 3P02A 2CZUA 1K3BA 1PBOA 1OPBA 3KFGA 3SLOA 4MVEA 3APUA 2PI3O 2X4MA 4IMNA 3RY1A 2HNXA 2BHVA 2JMBA 3T1DA 2WWPA 2AT5X 4XMDA 5B27A 5FENA 4ORSA 2X55A 3TZSA 4N7DA 2L9CA 1IFCA 2FTBA 1YUPA 2BS5A 2RTCB 3VG6A 3TGBA 2OY1O 3JSQA 5B3MO 2IZFB 1AVEA 1JYDA 3I0AA 5H9AA 1SRHA 1VWMB 5K06A 1VYOA 1VWEB 4CPFA 3S5VA 4Y59A 2C1SA 1DF8A 2RTAA 1BM5A 4LKTA 1IKJA 1SY3A 3OJYC 2JW1A 4YMYA 1S2PA 2OVDA 3HPEA 4IMOA 3VU1A 5L8OA 1AB0A 5LJCA 3PQSA 2GTLM 5AJCA 4DNEA 3G7XA 1YWAA 1DC9A 4XMEA 5CE4A 2IZAA 3CWKA 3D95A 2MWHA 1BRQA 4YFRA 3GAQA 1VWLB 5B5FA 2GC9A 3D96A 2L67A 1BJ7A 3FMZA 2BSZA 3PH5A 3X00A 3T6FA 1CJ5A 1WBIA 1L6MA 2XKLA 4U3QA 1SWHA 4GK9A 3FW5A 5F6ZA 3STKA 3VG7A 1UYNX 1RAVA 5IXGA 4TJZA 5HTDA 4ZCBA 4ZH6A 3PDFA 3AUMO 3FDCA 3P24A 1Y0GA 4IB8A 4M6SA 1NQNA 1SWTA 3FA7A 2OYBO 1STRB 3PH6A 3VG3A 2KW1A 5FAZA 1TVQA 1KZWA 1E2TA 1LCZA 4GH7A 3RE5A 4A60A 3PEDA 4AZNA 4FBVA 2FLJA 1VWBB 3BDRA 3WBGA 1HY2A 1B4MA 3HWGA 4YCEA 5FQ8E 2ANSA 3EM0A 1ZNLA 2K23A 3FEKA 3IA8A 1SLDB 1VWKB 2O62A 4A8ZA 1I04A 4YCHA 4QGXA 1YWBA 3U03A 1X8UA 2G7BA 2QMIA 2RTQB 4U9CA 3C77X 2RTLA 1SWLA 3RE6A 1ZRYA 1T68X 4ALOA 2OFRX 5B29A 2I5ZO 5IO7A 1MM9A 1G7NA 1KT5A 1SXXA 2MJIA 2QO5A 4IB9A 4ORYA 1LFOA 2QO4A 3ELZA 2RCTA 3NPOA 3SOTA 1SRGA 1AVDA 1EI5A 3P6GA 2A2GA 5H9KA 1FTPA 1JMXA 1I06A 4YFPA 5H8TA 3ZW2A 5HZ5A 3P6HA 1PBYA 3ZW0A 2OY5O 1SLEB 2ACPX 3KFFA 2G78A 1STSB 4MEEA 1SLFB 4ORRA 4CV7A 3MBTA 4GETA 3ZW0B 1MOYA 4ZR2A 1KOIA 3FR4A 3NBXX 4WFUA 1E02A 4IAWA 1SWGA 1A18A 1E5PA 4AW8A 2MF6A 5CSEA 1E00A 1N9YA 1SWRA 3LV4A 1PM1X 2UYWA 3STMX 3STNA 2A13A 2OF8A 5IRUA 3ZWEA 1LELA 1VWCB 2FWVA 1ALBA 2HLVA 1PMPA 2F73A 2K62A 4GD9A 3RSWA 1KL3A 3D97A 1JMZA 3BRNA 1VWRB 3WZOA 1GX8A 3ZUIA 4YDBA 5F58A 2NNEA 3CR6A 3FIDA 4NYRA 2IZKA 4I3CA 3BX8A 1S7DA 1G5WA 2GTLN 3ZQ3A 2RTNB 4ZGUA 1SRFA 4Z2PA 1LKEA 4TLJA 3T2XA 5K68A 1EUOA 2Q4NA 3WXQA 1RXJA 4DQ4A 4FBRA 4D6BA 1A57A 1I78A 3KVNA 2RTHB 2RN4A 4Z6JA 1JQPA 1DF3A 1SY0A 4R0BA 4IBAA 4I6SA 1EIIA 3P6CA 1ERBA 5D47A 1DFVA 4BX7B 2IZLB 5EEDA 1OEKA 2Q2MA 4MIRA 4O3XB 4ES7A 1BEBA 2WQAE 4KIIA 4YGGA 5EZ2A 2RTPB 4FBOA 4TQ2A 5LJDA 2AVIA 4ON1A 3VG4A 1VWOB 3WYPA 1XCAA 2M4LA 1T0VA 4CPHB 2AT8X 3U9PC 4TKBA 1BLRA 2CAMA 1JV4A 1SLGB 1Y9TA 3I17A 3CBSA 1SWQA 4IB7A 4EKVA 4WBKA 1LPJA 3SZIA 4Z2OA 5KIDA 2ZAGA 1N0SA 4GDZA 1JJUA 1RSTB 2OVSA 2F09A 3B2KA 1HQQA 1MX8A 2RTIB 4XMHA 2RQ0A 1BSYA 5D48A 4A1HA 1RBPA 3VE1A 1N43A 2RCQA 4GGRA 3B2HA 4BX6B 2A3FX 2X32A 4ZGFA 3C78X 4UU3A 1S44A 1LF7A 1QY2A 3NX1A 4GUZA 4INNA 4AZPA 2RTOB 5IO6A 3WJGA 2OY7A 1AQBA 1A2DA 1DZJA 4L3RA 2Y3EA 4NYQA 3SZHA 2IZCB 5HA1A 3NQKA 2QOMA 3H3IA 3PQUA 1IIUA 5B5GA 2IZGB 2RTFB 3RDSA 2IZHB 1ML7A 1SXUA 2FR3A 3AEHA 4OS0A 5EDCA 4IABA 5DG4A 1MDCA 4CDCA 2Y3FA 2X8FA 1ERXA 5JR8A 2LBVA 1EPBA 1SRIA 1OEEA 1IW2A 1BSQA 2FS7A 4YKMA 5BYPA 1LCVA 1SMPI 4NW4A 3UAQA 5L8IA 1LDQA 1Y9LA 5CHKA 1HXZA 2ACOA 5IRAA 3AKMA 2W2BA 4I60A 3UEWA 1JIWI 1HMTA 3BU9A 5C0NA 1X8OA 2WQ9A 4JGLA 1Y53X 5L3YA 4COTA 4B55A 1LUQA 1FDQA 2YG2A 4AZRA 1U17A 5B11O 3FIQA 1SA8A 1T8VA 2IZJA 4O4OA 3O19A 2QOSC 5D8JA 1Z24A 4MVLA 5D4AA 1LNMA 1AVGI 1GT1A 1KT4A 2FGSA 2Q9SA 5HCCC 3EW2A 3LHNA 4JHQA 1YP7A 4OEMA 4CDFA 4LZUA 1FEMA 1SWDA 3EC5A 3EYCA 4YBPA 2OF9A 1ADLA 2WEXA 4XMGA 2FHNX 5HCEC 1KXOA 1DZKA 5FQ6E 4CDDA 2IFBA 4OMWA 3RWXA 1VYFA 2E4JA 4DCBA 4ORUA 1EALA 1FELA 1GT3A 4NLIA 1QQSA 4DQ3A 3VHHA 4AZQA 1GGLA 3VGWA 1D2UA 1WUBA 2BT9A 2HYSA 1MUPA 3RY2A 2A8GA 4BGFA 3ZZVA 3Q6LA 3S5XA 1HXLA 4MVIA 4EFGA 1OPAA 1UYOX 4GKCA 1CBQA 3HWEA 4NV8A 4YFQA 5EPQA 4BJ8A 4XMFA 2LKKA 3SLTA 3HWDA 4GGZA 5KICA 4GE1A 4O4SA 2XSTA 3PP6A 5H9NA 3S60A 4BX5B 1STPA 3ZW1A 2QCBA 3U0DA 1EXSA 2R74A 1FJ1E 1EIOA 1OBPA 3LTWA 1JYJA 1VWPB 3WOVA 3ZUOA 4M7MA 2QM9A 1YWCA 5HBSA 1KZXA 2Z4IA 4GJVA 3S26A 2MM3A 2RTDB 1B0OA 2Z4HA 4I9SA 2WR6A 4O4UA 1N4JA 1MVGA 3RDUA 3CKFA 1HMSA 1ZNEA 4EDEA 4CPEA 1KL4A 1JBHA 4BQUA 1VWDB 4EEJA 4ODDA 2L68A 4YGHA 1RXHA 2FT9A 4LQZA 5HWZA 1GXAA 4U8UM 4ZH9A 4OKAA 2OY8A 1RSUB 3KFIA 2W2FA 5LKFA 4Z28A 3WZPA 2IZDB 2OFMX 2G79A 3MX7A 1KT7A 5H9LA 3WVMA 4GZVA 1QABE 1OEJA 2BS6A 1QFTA 1VWIB 1W4TA 2WSJA 1BSOA 1NP1A 4N7CA 2A2UA 3PK2A 4QQ1A 5KHPA 1CBSA 3NR3A 2FS6A 5F7GA 4PJ2A 3WZQA 2JN3A 2VFCA 2RTJA 4Z2VA 2RTRB 4O9SA 1ZNDA 1UREA 4ORXA 4YGZA 4YH0A 5LJEA 3BY0A 2NP1A 1RLBE 4O49A 3RKGA 1CRBA 1ZNHA 4U46A 3VE2A 4CDEA 1HMRA 3GE2A 5LJKA 4ALBA 1W5RA 1HN2A 4QYNA 3TGAA 4HPAA 4CSBA 4BX7A 1JJJA 3BSZE 2JGSA 1EW3A 3OE3A 4ID2A 1DZMA 1GM6A 4QYPA 2I5VO 4I9RA 5D45A 5F6BA 4ZHGA 1VWJB 3FYFA 3KZAA 1SWCA 1NP4A 4ZJ0A 3CQNA 4CPHA 4OELA 5AEOA 3ELXA 3HK1A 1XKIA 1HQPA 5CYBA 2X46A 3Q34A 4C5PA 2MHDA 2X45A 1GKAB 2MO5A 1QY0A 1GX3A 3EBWA 3WJCA 1SWAA 2A5BA 4ZHHA 1SWNA 5BVQA 3VHMA 1LIDA 2YMSA 3V8UA 3VPJE 3BS2A 2DJFA 3EMMA 4BX6A 1KQXA 4BVMA 4Z27A 2KT4B 4GU8A 1BWYA 1VWNB 2OL7A 1I05A 4QAEA 5B2AO 5AQ6A 2OFAA 4YKOA 2LA7A 3FA9A 2AMMX 3O22A 4TNNA 1SWPA 1MX7A 1U0XA 5IRWA 2AT3X 4RUUA 2RTMA 3HWFA 4NNSA 2HMBA 3HOLA 3NP1A 4OMXA 3KFHA 2FR2A 3WJEA 3TGCA 1HBQA 3QKGA 4UU2A 5LJGA 5BVTA 2FKJA 2KTDA 2FHLA 1O1UA 1SWBA 1I4UA 2ASNX 1O1VA 2JU7A 2OVAA 4GGTA 4Y0RA 1SY2A 5HZQA 2OFBA 2P8GA 3FELA 2IZEB 5L8NA 2AKQA 4YVBA 4TKJA 1NGLA 3EBKA 4KC7A 1PEEA 4NLJA 4ZHDA 1SWJA 3P6EA 3QQ2A 1KL5A 1VPRA 1YP6A 3NQ3A 1VWFB 4ZFXA 4MVKA 1N9MA 4QZTA 4GNYA 4YBUA 4HPCA 1LIFA 5LJBA 5F2BA 3T6LA 1FENA 1RXKA 4K19A 3ZI8A 1SWOA 3D4RA 3FEPA 4O3YA 4QZUA 1A3YA 2RTEB 1VYGA 5AJBA 2RA6A 2AF5A 4U8UN 3DTQA 3F8AA 1H91A 2FKGA 3CKGA 3OBLA 3TF6A 4NP1A 1NC9A 3CQRA 3BU1A 3CBCA 3O2YA 4Y0QA 1YIVA 2CM9A 3WJDA 4ML7B 3FA6A 2LFOA 3APWA 4I95A 3UEXA 4JO6A 3VHIA 5LKEA 2G5LA 3JQOA 1N7YA 4JNJA 1VWQB 3RDMA 3VG2A 4XMCA 3L4RA 3NADA 2PY1A 2ZSCA 3FR5A 4AZOA 5HZ6A 1JJXA 4GDAA 2CBSA 1QWDA 2HZRA 2L5PA 1G74A 2RTGB 4BCSA 2RTBB 2JU8A 4L1NA 3WJFA 2Q2PA 1U18A 1K24A 3FR2A 2Y32A 1FE3A 2G8CO 1ACDA 2W2AA 3F6ZB 4BX5A 2OL8O 4QRLA 4Y0SA 5HAEA 5HCDC 1KFFA 1DV9A 1SWFA 2QO6A 1PTSA 4KH8A 3HTYA 5EDBA 1QFVA 3APVA 4QGWA 3RDOA 3SLJA 1KQWA 1AELA 1ZNGA 1EPAA 1X71A 2FRSA 3EW1A 2BLGA 4O3WA 1X8QA 4AZMA 4FGIB 1KT6A 2IZBA 2JOZA 4OS3A 4BBOA 1OBQA 2DJGA 2N93A 4IAXA 1ICMA 4HFOA 1LCWA 2C1QA 3F9DA 4NV7A 2ZAIA 1NDJA 2AT0X 4BOEA 3BX7A 3RDQA 1GT5A 3HOEA 4ORWA 5FQ7E 1Y55X 4YDAA 3WYQA 4ZHCA 5HZ9A 3PPTA 2HKDA 2CBRA 2AT6X 3NX2A 1TW4A 5HA0A 2KTSA 1TOUA 3DSZA 4LKPA 1HBPA 1LIEA 1LDOA 1SY1A 4Y5DA 1X8PA 1CBRA 1MK5A 1E06A 3E3CA 4KT5A 1SWUA 2EU7X 1B8EA 4MISA 5F1EA 2GTLO 2CM4A 1R0UA 1LIBA 1BBPA 2X8TA 4EXZA 2X8SA 2KD2A 1NBXA 1TOWA 1Y52X 1KT3A 1VWHB 2UZ2A 1UZ2X 4HPDA 1VWAB 2JU3A 4O4XA 4QNIA 4ARHA 1B56A 1KGLA 1DZPA 2OZQA 4A1YA 3FENA 3ZW1B
chains in the Genus database with same CATH topology
5LJHA 3C76X 4ZHFA 4NNTA 4RUNA 2AL0X 2Q39A 3B2LA 1D3SA 4AYHA 2LBAA 1QG5A 4EQAC 1JZUA 1CBIA 3P6FA 4KC8A 4I3BA 4PSQA 2NNDA 3MVFA 3JS1A 3VG5A 3UEVA 1GKAA 3SAOA 2WUTA 4TKHA 1GT4A 3RBYA 5HZ8A 2CZTA 3RZYA 2ALLX 4GRJA 5L8NA 5LKEA 3IFBA 1X89A 2OVEA 1G85A 1GX9A 2LB6A 4HWMA 2R56A 3AKNA 5EEEA 4WHIA 2HZQA 4CK4A 2AH7X 3N91A 2RD7C 3KQ0A 1OBUA 2DM5A 3NQ9A 1IFBA 5BVSA 2NNQA 3FA8A 2GTFX 1YWDA 3APXA 1ZNKA 4I3DA 3FW4A 4WFVA 1QY1A 1LICA 2WEWA 5FFHA 4QGVA 1P6PA 1ICNA 5HTEA 3FLLA 3PECA 1IKEA 4Y0PA 3WJBA 1EQDA 3UEUA 3B2JA 1BRPA 1O8VA 4D6AA 4FQBB 3BLGA 3K3LA 4IB6A 4KCAA 2GJ5A 4HPBA 4OS8A 5IO5A 3OD9A 4LZVA 3CMPA 1SXWA 1TXLA 4U8UO 2A0AA 3B2IA 1X8NA 4GNWA 5DPQA 2R73A 3P6DA 2POAA 4O3ZA 1SXYA 3P02A 2CZUA 1PBOA 1OPBA 3KFGA 4MVEA 3APUA 4IMNA 2HNXA 2BHVA 2JMBA 3T1DA 2WWPA 2AT5X 4XMDA 5B27A 5FENA 4ORSA 3TZSA 4N7DA 2L9CA 1IFCA 2FTBA 1YUPA 2BS5A 3VG6A 3TGBA 3JSQA 1JYDA 3I0AA 5H9AA 5K06A 3S5VA 1BM5A 4LKTA 1IKJA 1SY3A 3OJYC 2JW1A 4YMYA 1S2PA 2OVDA 4IMOA 3VU1A 5L8OA 1AB0A 5LJCA 3PQSA 2GTLM 5AJCA 3G7XA 1YWAA 1DC9A 4XMEA 5CE4A 3CWKA 3D95A 2MWHA 1BRQA 4YFRA 3GAQA 2GC9A 3D96A 2L67A 1BJ7A 3FMZA 3PH5A 1CJ5A 1L6MA 2XKLA 4U3QA 4GK9A 3FW5A 5F6ZA 3STKA 3VG7A 4TJZA 5HTDA 4ZCBA 4ZH6A 3P24A 4IB8A 4M6SA 3FA7A 3VG3A 3PH6A 2KW1A 5FAZA 1TVQA 1KZWA 4GH7A 4A60A 4AZNA 3PEDA 4FBVA 2FLJA 3BDRA 3WBGA 1B4MA 3HWGA 4YCEA 5FQ8E 2ANSA 3EM0A 1ZNLA 2K23A 3FEKA 3IA8A 2O62A 4A8ZA 1I04A 4YCHA 4QGXA 1YWBA 3U03A 1X8UA 2G7BA 2QMIA 4U9CA 3C77X 1ZRYA 1T68X 4ALOA 2OFRX 5B29A 5IO7A 1G7NA 1KT5A 1SXXA 2MJIA 2QO5A 4IB9A 4ORYA 1LFOA 2QO4A 3ELZA 2RCTA 3NPOA 3SOTA 1EI5A 3P6GA 2A2GA 5H9KA 1FTPA 1I06A 4YFPA 5H8TA 3ZW2A 3ZW1B 5HZ5A 3P6HA 3ZW0A 2ACPX 3KFFA 2G78A 4ORRA 4CV7A 3MBTA 4GETA 3ZW0B 4ZR2A 1KOIA 3FR4A 3NBXX 4WFUA 1E02A 4IAWA 1A18A 1E5PA 4AW8A 1E00A 3LV4A 1PM1X 3STMX 3STNA 2A13A 3ZWEA 2K62A 2FWVA 2HLVA 1ALBA 3RSWA 1PMPA 2F73A 3D97A 3BRNA 3ZUIA 1GX8A 4YDBA 5F58A 2NNEA 3CR6A 4NYRA 4I3CA 3BX8A 1S7DA 1G5WA 2GTLN 3ZQ3A 4ZGUA 1LKEA 4TLJA 1EUOA 2Q4NA 3WXQA 4DQ4A 4FBRA 4D6BA 1A57A 2RN4A 1DF3A 1SY0A 4R0BA 4IBAA 4I6SA 1EIIA 3P6CA 1ERBA 5D47A 1DFVA 5EEDA 1OEKA 2Q2MA 4MIRA 4O3XB 4ES7A 1BEBA 2WQAE 4KIIA 4YGGA 5EZ2A 4FBOA 4TQ2A 5LJDA 4ON1A 3VG4A 1XCAA 2M4LA 1T0VA 2AT8X 3U9PC 4TKBA 1BLRA 3I17A 1JV4A 1Y9TA 4IB7A 3CBSA 4WBKA 1LPJA 5KIDA 2ZAGA 1N0SA 4GDZA 2OVSA 2F09A 3B2KA 1MX8A 4XMHA 2RQ0A 1BSYA 5D48A 4A1HA 1RBPA 3VE1A 2RCQA 4ZGFA 3B2HA 2A3FX 3C78X 4UU3A 1S44A 1LF7A 1QY2A 3NX1A 4INNA 4AZPA 5IO6A 3WJGA 1AQBA 1A2DA 1DZJA 4L3RA 4NYQA 5HA1A 3NQKA 3H3IA 3PQUA 1IIUA 1ML7A 1SXUA 2FR3A 4OS0A 5EDCA 4IABA 5DG4A 1MDCA 2X8FA 1ERXA 5JR8A 1EPBA 1OEEA 1IW2A 1BSQA 2FS7A 4YKMA 5BYPA 1SMPI 4NW4A 3UAQA 5L8IA 2LBVA 1Y9LA 2ACOA 3AKMA 2W2BA 3UEWA 1JIWI 1HMTA 3BU9A 5C0NA 1X8OA 2WQ9A 4JGLA 4COTA 1FDQA 2YG2A 4AZRA 1U17A 3FIQA 1SA8A 1T8VA 4O4OA 3O19A 2QOSC 5D8JA 1Z24A 4MVLA 5D4AA 1LNMA 1AVGI 1GT1A 1KT4A 2Q9SA 5HCCC 3LHNA 1YP7A 4LZUA 1FEMA 4YBPA 3EYCA 2WEXA 1ADLA 4XMGA 5HCEC 1KXOA 1DZKA 5FQ6E 1EALA 2IFBA 4OMWA 3RWXA 1VYFA 2E4JA 4ORUA 1FELA 1GT3A 4NLIA 1QQSA 4DQ3A 4AZQA 1GGLA 1D2UA 2BT9A 2HYSA 1MUPA 3ZZVA 3Q6LA 3S5XA 4MVIA 4EFGA 1OPAA 4GKCA 1CBQA 3HWEA 4YFQA 5EPQA 5KICA 4XMFA 2LKKA 3HWDA 4GE1A 4O4SA 2XSTA 3PP6A 5H9NA 3S60A 3ZW1A 1EIOA 3U0DA 1EXSA 2R74A 1OBPA 1JYJA 3WOVA 3ZUOA 4M7MA 2QM9A 1YWCA 5HBSA 1KZXA 2Z4IA 3S26A 2MM3A 2Z4HA 1B0OA 4I9SA 4O4UA 2WR6A 1MVGA 1HMSA 1ZNEA 4EDEA 1JBHA 4BQUA 4EEJA 4ODDA 2L68A 4YGHA 4LQZA 2FT9A 5HWZA 1GXAA 4U8UM 4ZH9A 3KFIA 2W2FA 5LKFA 2OFMX 2G79A 3MX7A 1KT7A 5H9LA 3WVMA 4GZVA 1QABE 1OEJA 2BS6A 1QFTA 2WSJA 1BSOA 1NP1A 4N7CA 2A2UA 4QQ1A 5KHPA 1CBSA 3NR3A 2FS6A 5F7GA 4PJ2A 2JN3A 4O9SA 1ZNDA 1UREA 4ORXA 4YGZA 4YH0A 5LJEA 3BY0A 2NP1A 1RLBE 4O49A 3RKGA 1CRBA 1ZNHA 3VE2A 5LJKA 1HMRA 3GE2A 4ALBA 1HN2A 4QYNA 3TGAA 4HPAA 4CSBA 1JJJA 3BSZE 1EW3A 3OE3A 4ID2A 1DZMA 1GM6A 4QYPA 4I9RA 5D45A 5F6BA 4ZHGA 3FYFA 3KZAA 4ZJ0A 1NP4A 3CQNA 5AEOA 3ELXA 3HK1A 1XKIA 1HQPA 5CYBA 2X46A 2MHDA 2X45A 1GKAB 2MO5A 1QY0A 3EBWA 3WJCA 4ZHHA 5BVQA 1LIDA 2YMSA 3V8UA 3VPJE 3BS2A 3EMMA 1BWYA 1KQXA 4BVMA 2KT4B 4GU8A 4QAEA 1I05A 5AQ6A 4YKOA 2LA7A 3FA9A 2AMMX 3O22A 4TNNA 1MX7A 1U0XA 2AT3X 4RUUA 3HWFA 4NNSA 2HMBA 3HOLA 3NP1A 4OMXA 3KFHA 2FR2A 3WJEA 3TGCA 1HBQA 3QKGA 4UU2A 5LJGA 5BVTA 2KTDA 1O1UA 1I4UA 2ASNX 1O1VA 2JU7A 2OVAA 4Y0RA 1SY2A 5HZQA 2P8GA 3FELA 2AKQA 4TKJA 1NGLA 3EBKA 4KC7A 1PEEA 4NLJA 4ZHDA 3P6EA 1VPRA 1YP6A 3NQ3A 4ZFXA 4MVKA 4QZTA 4GNYA 4YBUA 4HPCA 1LIFA 5LJBA 1FENA 4K19A 3ZI8A 3D4RA 3FEPA 4O3YA 4QZUA 1A3YA 1VYGA 5AJBA 2RA6A 4U8UN 3DTQA 3F8AA 1H91A 3OBLA 3TF6A 4NP1A 3CQRA 3BU1A 3CBCA 3O2YA 4Y0QA 1YIVA 2CM9A 3WJDA 4ML7B 3FA6A 2LFOA 3APWA 4I95A 3UEXA 3JQOA 3VG2A 4XMCA 3L4RA 3NADA 2PY1A 3FR5A 4AZOA 5HZ6A 1JJXA 2CBSA 1QWDA 2HZRA 2L5PA 1G74A 3WJFA 2JU8A 4L1NA 2Q2PA 1U18A 3FR2A 1FE3A 3F6ZB 1ACDA 2W2AA 5HCDC 5HAEA 4Y0SA 4QRLA 1DV9A 2QO6A 4KH8A 5EDBA 3HTYA 1QFVA 3APVA 4QGWA 1KQWA 1AELA 1ZNGA 1EPAA 1X71A 2FRSA 4O3WA 2BLGA 4AZMA 1X8QA 4FGIB 1KT6A 2JOZA 4OS3A 1OBQA 2N93A 4IAXA 1ICMA 4HFOA 3F9DA 2ZAIA 2AT0X 4BOEA 3BX7A 1GT5A 3HOEA 4ORWA 5FQ7E 4YDAA 4ZHCA 5HZ9A 3PPTA 2CBRA 2AT6X 3NX2A 1TW4A 5HA0A 2KTSA 1TOUA 3DSZA 4LKPA 1HBPA 1LIEA 1SY1A 1CBRA 1X8PA 3E3CA 1E06A 4KT5A 4MISA 2EU7X 5F1EA 1B8EA 2GTLO 2CM4A 1R0UA 1LIBA 1BBPA 2X8TA 4EXZA 2X8SA 2KD2A 1TOWA 1KT3A 1UZ2X 4HPDA 2JU3A 4O4XA 4QNIA 4ARHA 1B56A 1KGLA 1DZPA 2OZQA 4A1YA 3FENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJH A;  3C76 X;  4ZHF A;  4NNT A;  4RUN A;  2AL0 X;  2Q39 A;  3B2L A;  1D3S A;  4AYH A;  2LBA A;  1QG5 A;  1JZU A;  1CBI A;  3P6F A;  4I3B A;  4PSQ A;  2NND A;  3MVF A;  3JS1 A;  3VG5 A;  3UEV A;  1GKA A;  3SAO A;  2WUT A;  4TKH A;  1GT4 A;  5HZ8 A;  2CZT A;  3RZY A;  2ALL X;  4GRJ A;  5L8N A;  5LKE A;  3IFB A;  1X89 A;  2OVE A;  1G85 A;  1GX9 A;  2LB6 A;  2R56 A;  3AKN A;  5EEE A;  2HZQ A;  4CK4 A;  2AH7 X;  2RD7 C;  3KQ0 A;  1OBU A;  2DM5 A;  3NQ9 A;  1IFB A;  5BVS A;  2NNQ A;  3FA8 A;  2GTF X;  1YWD A;  3APX A;  1ZNK A;  4I3D A;  3FW4 A;  4WFV A;  1QY1 A;  1LIC A;  2WEW A;  5FFH A;  4QGV A;  1P6P A;  1ICN A;  5HTE A;  3FLL A;  3PEC A;  1IKE A;  4Y0P A;  3WJB A;  1EQD A;  3UEU A;  3B2J A;  1BRP A;  1O8V A;  4D6A A;  3BLG A;  3K3L A;  4IB6 A;  2GJ5 A;  4HPB A;  4OS8 A;  5IO5 A;  4LZV A;  3CMP A;  1SXW A;  1TXL A;  2A0A A;  3B2I A;  1X8N A;  4GNW A;  5DPQ A;  2R73 A;  3P6D A;  2POA A;  1SXY A;  2CZU A;  1PBO A;  1OPB A;  3KFG A;  3APU A;  4IMN A;  2HNX A;  3T1D A;  2WWP A;  2AT5 X;  4XMD A;  5B27 A;  5FEN A;  4ORS A;  3TZS A;  4N7D A;  2L9C A;  1IFC A;  2FTB A;  1YUP A;  3VG6 A;  3TGB A;  3JSQ A;  1JYD A;  3I0A A;  5H9A A;  5K06 A;  1BM5 A;  4LKT A;  1IKJ A;  1SY3 A;  3OJY C;  4YMY A;  1S2P A;  2OVD A;  4IMO A;  5L8O A;  1AB0 A;  5LJC A;  3G7X A;  1YWA A;  1DC9 A;  4XME A;  5CE4 A;  3CWK A;  3D95 A;  4YFR A;  1BRQ A;  3GAQ A;  2GC9 A;  3D96 A;  2L67 A;  1BJ7 A;  3FMZ A;  3PH5 A;  1CJ5 A;  1L6M A;  2XKL A;  3FW5 A;  5F6Z A;  3STK A;  3VG7 A;  4TJZ A;  5HTD A;  4ZCB A;  4ZH6 A;  4IB8 A;  4M6S A;  3FA7 A;  3VG3 A;  3PH6 A;  5FAZ A;  1TVQ A;  1KZW A;  4GH7 A;  4A60 A;  4AZN A;  3PED A;  2FLJ A;  3BDR A;  3WBG A;  1B4M A;  3HWG A;  4YCE A;  2ANS A;  3EM0 A;  1ZNL A;  2K23 A;  3FEK A;  3IA8 A;  2O62 A;  4A8Z A;  1I04 A;  4YCH A;  4QGX A;  1YWB A;  3U03 A;  1X8U A;  2G7B A;  3C77 X;  1ZRY A;  1T68 X;  4ALO A;  2OFR X;  5B29 A;  5IO7 A;  1G7N A;  1KT5 A;  1SXX A;  2MJI A;  2QO5 A;  4IB9 A;  4ORY A;  1LFO A;  2QO4 A;  3ELZ A;  2RCT A;  3NPO A;  3P6G A;  2A2G A;  5H9K A;  1FTP A;  1I06 A;  4YFP A;  5H8T A;  5HZ5 A;  3P6H A;  2ACP X;  3KFF A;  2G78 A;  4ORR A;  3MBT A;  4GET A;  4ZR2 A;  1KOI A;  3FR4 A;  4WFU A;  1E02 A;  4IAW A;  1A18 A;  1E5P A;  4AW8 A;  1E00 A;  1PM1 X;  3STM X;  3STN A;  2A13 A;  2K62 A;  2FWV A;  2HLV A;  1ALB A;  3RSW A;  1PMP A;  2F73 A;  3D97 A;  3BRN A;  3ZUI A;  1GX8 A;  4YDB A;  5F58 A;  2NNE A;  3CR6 A;  4NYR A;  4I3C A;  3BX8 A;  1S7D A;  1G5W A;  3ZQ3 A;  4ZGU A;  1LKE A;  4TLJ A;  1EUO A;  2Q4N A;  3WXQ A;  4DQ4 A;  4D6B A;  1A57 A;  1DF3 A;  1SY0 A;  4R0B A;  4IBA A;  1EII A;  3P6C A;  1ERB A;  5D47 A;  1DFV A;  5EED A;  1OEK A;  2Q2M A;  4ES7 A;  1BEB A;  2WQA E;  4KII A;  4YGG A;  5EZ2 A;  4TQ2 A;  5LJD A;  3VG4 A;  1XCA A;  1T0V A;  2AT8 X;  3U9P C;  4TKB A;  1BLR A;  3I17 A;  1JV4 A;  4IB7 A;  3CBS A;  4WBK A;  1LPJ A;  5KID A;  1N0S A;  3B2K A;  1MX8 A;  4XMH A;  2RQ0 A;  1BSY A;  5D48 A;  4A1H A;  1RBP A;  2RCQ A;  3B2H A;  2A3F X;  3C78 X;  4UU3 A;  1S44 A;  1LF7 A;  1QY2 A;  3NX1 A;  4AZP A;  5IO6 A;  3WJG A;  1AQB A;  1A2D A;  1DZJ A;  4NYQ A;  5HA1 A;  1IIU A;  1ML7 A;  1SXU A;  2FR3 A;  4OS0 A;  5EDC A;  5DG4 A;  1MDC A;  1ERX A;  5JR8 A;  1EPB A;  1OEE A;  1IW2 A;  1BSQ A;  2FS7 A;  4YKM A;  5L8I A;  2LBV A;  2ACO A;  3AKM A;  2W2B A;  3UEW A;  1HMT A;  3BU9 A;  5C0N A;  1X8O A;  2WQ9 A;  1FDQ A;  2YG2 A;  4AZR A;  1U17 A;  3FIQ A;  1SA8 A;  1T8V A;  3O19 A;  2QOS C;  5D8J A;  1Z24 A;  4MVL A;  5D4A A;  1LNM A;  1AVG I;  1GT1 A;  1KT4 A;  2Q9S A;  5HCC C;  1YP7 A;  4LZU A;  1FEM A;  4YBP A;  3EYC A;  2WEX A;  1ADL A;  4XMG A;  5HCE C;  1KXO A;  1DZK A;  1EAL A;  2IFB A;  4OMW A;  1VYF A;  2E4J A;  4ORU A;  1FEL A;  1GT3 A;  4NLI A;  1QQS A;  4DQ3 A;  4AZQ A;  1GGL A;  1D2U A;  2HYS A;  1MUP A;  3Q6L A;  4MVI A;  4EFG A;  1OPA A;  4GKC A;  1CBQ A;  3HWE A;  4YFQ A;  5EPQ A;  5KIC A;  4XMF A;  2LKK A;  3HWD A;  4GE1 A;  5H9N A;  2XST A;  3PP6 A;  1EIO A;  3U0D A;  1EXS A;  2R74 A;  1OBP A;  1JYJ A;  3ZUO A;  4M7M A;  2QM9 A;  1YWC A;  5HBS A;  1KZX A;  3S26 A;  2MM3 A;  1B0O A;  4I9S A;  2WR6 A;  1MVG A;  1HMS A;  1ZNE A;  4EDE A;  1JBH A;  4BQU A;  4EEJ A;  4ODD A;  2L68 A;  4YGH A;  2FT9 A;  5HWZ A;  1GXA A;  4ZH9 A;  3KFI A;  2W2F A;  5LKF A;  2OFM X;  2G79 A;  1KT7 A;  5H9L A;  3WVM A;  1QAB E;  1OEJ A;  2WSJ A;  1QFT A;  1BSO A;  1NP1 A;  4N7C A;  2A2U A;  5KHP A;  1CBS A;  3NR3 A;  2FS6 A;  5F7G A;  2JN3 A;  4O9S A;  1ZND A;  1URE A;  4ORX A;  4YGZ A;  4YH0 A;  5LJE A;  3BY0 A;  2NP1 A;  1RLB E;  1CRB A;  1ZNH A;  5LJK A;  1HMR A;  4ALB A;  1HN2 A;  4QYN A;  3TGA A;  4HPA A;  1JJJ A;  3BSZ E;  1EW3 A;  1DZM A;  1GM6 A;  4QYP A;  4I9R A;  5D45 A;  5F6B A;  4ZHG A;  3KZA A;  4ZJ0 A;  1NP4 A;  3CQN A;  3ELX A;  3HK1 A;  1XKI A;  1HQP A;  2X46 A;  2X45 A;  1GKA B;  2MO5 A;  1QY0 A;  3EBW A;  3WJC A;  4ZHH A;  5BVQ A;  1LID A;  3BS2 A;  3EMM A;  1BWY A;  1KQX A;  4BVM A;  2KT4 B;  4QAE A;  1I05 A;  5AQ6 A;  4YKO A;  3FA9 A;  2AMM X;  3O22 A;  4TNN A;  1MX7 A;  1U0X A;  2AT3 X;  4RUU A;  3HWF A;  4NNS A;  2HMB A;  3NP1 A;  4OMX A;  3KFH A;  2FR2 A;  3WJE A;  3TGC A;  1HBQ A;  3QKG A;  4UU2 A;  5LJG A;  5BVT A;  2KTD A;  1O1U A;  1I4U A;  2ASN X;  1O1V A;  2JU7 A;  2OVA A;  4Y0R A;  1SY2 A;  5HZQ A;  2P8G A;  3FEL A;  2AKQ A;  4TKJ A;  1NGL A;  3EBK A;  1PEE A;  4NLJ A;  4ZHD A;  3P6E A;  1VPR A;  1YP6 A;  3NQ3 A;  4ZFX A;  4MVK A;  4QZT A;  4GNY A;  4YBU A;  4HPC A;  1LIF A;  5LJB A;  1FEN A;  4K19 A;  3FEP A;  4QZU A;  1A3Y A;  1VYG A;  2RA6 A;  3DTQ A;  3F8A A;  1H91 A;  3TF6 A;  4NP1 A;  3CQR A;  3BU1 A;  3CBC A;  3O2Y A;  4Y0Q A;  1YIV A;  2CM9 A;  3WJD A;  3FA6 A;  2LFO A;  3APW A;  3UEX A;  3VG2 A;  4XMC A;  3L4R A;  3NAD A;  2PY1 A;  3FR5 A;  4AZO A;  5HZ6 A;  1JJX A;  2CBS A;  1QWD A;  2HZR A;  2L5P A;  1G74 A;  3WJF A;  2JU8 A;  2Q2P A;  1U18 A;  3FR2 A;  1FE3 A;  1ACD A;  2W2A A;  5HCD C;  5HAE A;  4Y0S A;  1DV9 A;  2QO6 A;  5EDB A;  1QFV A;  3APV A;  4QGW A;  1KQW A;  1AEL A;  1ZNG A;  1EPA A;  1X71 A;  2FRS A;  4AZM A;  2BLG A;  1X8Q A;  1KT6 A;  2JOZ A;  4OS3 A;  1OBQ A;  2N93 A;  4IAX A;  1ICM A;  4HFO A;  3F9D A;  2AT0 X;  4BOE A;  3BX7 A;  1GT5 A;  4ORW A;  4ZHC A;  4YDA A;  5HZ9 A;  3PPT A;  2CBR A;  2AT6 X;  3NX2 A;  1TW4 A;  5HA0 A;  1TOU A;  3DSZ A;  4LKP A;  1HBP A;  1LIE A;  1SY1 A;  1CBR A;  1X8P A;  1E06 A;  2EU7 X;  5F1E A;  1B8E A;  2CM4 A;  1R0U A;  1LIB A;  1BBP A;  4EXZ A;  1TOW A;  1KT3 A;  1UZ2 X;  4HPD A;  2JU3 A;  4ARH A;  1B56 A;  1KGL A;  1DZP A;  2OZQ A;  4A1Y A;  3FEN A; 
#chains in the Genus database with same CATH topology
 5LJH A;  3C76 X;  4ZHF A;  4NNT A;  4RUN A;  2AL0 X;  2Q39 A;  3B2L A;  1D3S A;  4AYH A;  2LBA A;  1QG5 A;  4EQA C;  1JZU A;  2IZI A;  3T2W A;  1CBI A;  3P6F A;  4KC8 A;  4I3B A;  3WZN A;  4PSQ A;  2NND A;  1MEP A;  3MVF A;  3JS1 A;  2A5C A;  3VG5 A;  3UEV A;  1GKA A;  2WPU A;  3SAO A;  2RTK A;  2WUT A;  1GT4 A;  4TKH A;  3RBY A;  5HZ8 A;  2CZT A;  2BC3 A;  2ALL X;  3RZY A;  4GRJ A;  2X56 A;  1SWE A;  3IFB A;  1X89 A;  2OVE A;  1G85 A;  1GX9 A;  2F01 A;  2LB6 A;  1OSP O;  2R56 A;  4HWM A;  3AKN A;  4IRW A;  4CPI A;  2OL6 O;  5EEE A;  4WHI A;  2HZQ A;  4CK4 A;  1SRE A;  2AH7 X;  1SRJ A;  2RD7 C;  3N91 A;  3SZJ A;  4GJS A;  1W6F A;  1OBU A;  3KQ0 A;  5JD2 A;  2DM5 A;  1SWK A;  1IFB A;  3NQ9 A;  5BVS A;  2NNQ A;  3FA8 A;  2GTF X;  1YWD A;  5K67 A;  3APX A;  1ZNK A;  4I3D A;  3FW4 A;  4WFV A;  1QY1 A;  1IJ8 A;  1LIC A;  2WEW A;  3MM0 A;  1P6P A;  1ICN A;  5FFH A;  5HTE A;  3RDX A;  3FLL A;  3PEC A;  1IKE A;  4QGV A;  5B10 O;  4Y0P A;  3WJB A;  1EQD A;  2GH7 A;  3UEU A;  3B2J A;  1BRP A;  1O8V A;  2C4I A;  4D6A A;  4FQB B;  2VFB A;  3BLG A;  3K3L A;  4IB6 A;  2GJ5 A;  2X34 A;  4HPB A;  4KCA A;  4OS8 A;  1SWS A;  5IO5 A;  3D9W A;  3OD9 A;  4LZV A;  3CMP A;  1VWG B;  1SXW A;  1TXL A;  4U8U O;  2A0A A;  3B2I A;  1X8N A;  4GNW A;  3MG5 A;  5DPQ A;  1I9H A;  2R73 A;  3P6D A;  2VDF A;  1NQM A;  2POA A;  4O3Z A;  1SXY A;  3P02 A;  2CZU A;  1K3B A;  1PBO A;  1OPB A;  3KFG A;  3SLO A;  4MVE A;  3APU A;  2PI3 O;  2X4M A;  4IMN A;  3RY1 A;  2HNX A;  2BHV A;  2JMB A;  3T1D A;  2WWP A;  2AT5 X;  4XMD A;  5B27 A;  5FEN A;  4ORS A;  2X55 A;  3TZS A;  4N7D A;  2L9C A;  1IFC A;  2FTB A;  1YUP A;  2BS5 A;  2RTC B;  3VG6 A;  3TGB A;  2OY1 O;  3JSQ A;  5B3M O;  2IZF B;  1AVE A;  1JYD A;  3I0A A;  5H9A A;  1SRH A;  1VWM B;  5K06 A;  1VYO A;  1VWE B;  4CPF A;  3S5V A;  4Y59 A;  2C1S A;  1DF8 A;  2RTA A;  1BM5 A;  4LKT A;  1IKJ A;  1SY3 A;  3OJY C;  2JW1 A;  4YMY A;  1S2P A;  2OVD A;  3HPE A;  4IMO A;  3VU1 A;  5L8O A;  1AB0 A;  5LJC A;  3PQS A;  2GTL M;  5AJC A;  4DNE A;  3G7X A;  1YWA A;  1DC9 A;  4XME A;  5CE4 A;  2IZA A;  3CWK A;  3D95 A;  2MWH A;  1BRQ A;  4YFR A;  3GAQ A;  1VWL B;  5B5F A;  2GC9 A;  3D96 A;  2L67 A;  1BJ7 A;  3FMZ A;  2BSZ A;  3PH5 A;  3X00 A;  3T6F A;  1CJ5 A;  1WBI A;  1L6M A;  2XKL A;  4U3Q A;  1SWH A;  4GK9 A;  3FW5 A;  5F6Z A;  3STK A;  3VG7 A;  1UYN X;  1RAV A;  5IXG A;  4TJZ A;  5HTD A;  4ZCB A;  4ZH6 A;  3PDF A;  3AUM O;  3FDC A;  3P24 A;  1Y0G A;  4IB8 A;  4M6S A;  1NQN A;  1SWT A;  3FA7 A;  2OYB O;  1STR B;  3PH6 A;  3VG3 A;  2KW1 A;  5FAZ A;  1TVQ A;  1KZW A;  1E2T A;  1LCZ A;  4GH7 A;  3RE5 A;  4A60 A;  3PED A;  4AZN A;  4FBV A;  2FLJ A;  1VWB B;  3BDR A;  3WBG A;  1HY2 A;  1B4M A;  3HWG A;  4YCE A;  5FQ8 E;  2ANS A;  3EM0 A;  1ZNL A;  2K23 A;  3FEK A;  3IA8 A;  1SLD B;  1VWK B;  2O62 A;  4A8Z A;  1I04 A;  4YCH A;  4QGX A;  1YWB A;  3U03 A;  1X8U A;  2G7B A;  2QMI A;  2RTQ B;  4U9C A;  3C77 X;  2RTL A;  1SWL A;  3RE6 A;  1ZRY A;  1T68 X;  4ALO A;  2OFR X;  5B29 A;  2I5Z O;  5IO7 A;  1MM9 A;  1G7N A;  1KT5 A;  1SXX A;  2MJI A;  2QO5 A;  4IB9 A;  4ORY A;  1LFO A;  2QO4 A;  3ELZ A;  2RCT A;  3NPO A;  3SOT A;  1SRG A;  1AVD A;  1EI5 A;  3P6G A;  2A2G A;  5H9K A;  1FTP A;  1JMX A;  1I06 A;  4YFP A;  5H8T A;  3ZW2 A;  5HZ5 A;  3P6H A;  1PBY A;  3ZW0 A;  2OY5 O;  1SLE B;  2ACP X;  3KFF A;  2G78 A;  1STS B;  4MEE A;  1SLF B;  4ORR A;  4CV7 A;  3MBT A;  4GET A;  3ZW0 B;  1MOY A;  4ZR2 A;  1KOI A;  3FR4 A;  3NBX X;  4WFU A;  1E02 A;  4IAW A;  1SWG A;  1A18 A;  1E5P A;  4AW8 A;  2MF6 A;  5CSE A;  1E00 A;  1N9Y A;  1SWR A;  3LV4 A;  1PM1 X;  2UYW A;  3STM X;  3STN A;  2A13 A;  2OF8 A;  5IRU A;  3ZWE A;  1LEL A;  1VWC B;  2FWV A;  1ALB A;  2HLV A;  1PMP A;  2F73 A;  2K62 A;  4GD9 A;  3RSW A;  1KL3 A;  3D97 A;  1JMZ A;  3BRN A;  1VWR B;  3WZO A;  1GX8 A;  3ZUI A;  4YDB A;  5F58 A;  2NNE A;  3CR6 A;  3FID A;  4NYR A;  2IZK A;  4I3C A;  3BX8 A;  1S7D A;  1G5W A;  2GTL N;  3ZQ3 A;  2RTN B;  4ZGU A;  1SRF A;  4Z2P A;  1LKE A;  4TLJ A;  3T2X A;  5K68 A;  1EUO A;  2Q4N A;  3WXQ A;  1RXJ A;  4DQ4 A;  4FBR A;  4D6B A;  1A57 A;  1I78 A;  3KVN A;  2RTH B;  2RN4 A;  4Z6J A;  1JQP A;  1DF3 A;  1SY0 A;  4R0B A;  4IBA A;  4I6S A;  1EII A;  3P6C A;  1ERB A;  5D47 A;  1DFV A;  4BX7 B;  2IZL B;  5EED A;  1OEK A;  2Q2M A;  4MIR A;  4O3X B;  4ES7 A;  1BEB A;  2WQA E;  4KII A;  4YGG A;  5EZ2 A;  2RTP B;  4FBO A;  4TQ2 A;  5LJD A;  2AVI A;  4ON1 A;  3VG4 A;  1VWO B;  3WYP A;  1XCA A;  2M4L A;  1T0V A;  4CPH B;  2AT8 X;  3U9P C;  4TKB A;  1BLR A;  2CAM A;  1JV4 A;  1SLG B;  1Y9T A;  3I17 A;  3CBS A;  1SWQ A;  4IB7 A;  4EKV A;  4WBK A;  1LPJ A;  3SZI A;  4Z2O A;  5KID A;  2ZAG A;  1N0S A;  4GDZ A;  1JJU A;  1RST B;  2OVS A;  2F09 A;  3B2K A;  1HQQ A;  1MX8 A;  2RTI B;  4XMH A;  2RQ0 A;  1BSY A;  5D48 A;  4A1H A;  1RBP A;  3VE1 A;  1N43 A;  2RCQ A;  4GGR A;  3B2H A;  4BX6 B;  2A3F X;  2X32 A;  4ZGF A;  3C78 X;  4UU3 A;  1S44 A;  1LF7 A;  1QY2 A;  3NX1 A;  4GUZ A;  4INN A;  4AZP A;  2RTO B;  5IO6 A;  3WJG A;  2OY7 A;  1AQB A;  1A2D A;  1DZJ A;  4L3R A;  2Y3E A;  4NYQ A;  3SZH A;  2IZC B;  5HA1 A;  3NQK A;  2QOM A;  3H3I A;  3PQU A;  1IIU A;  5B5G A;  2IZG B;  2RTF B;  3RDS A;  2IZH B;  1ML7 A;  1SXU A;  2FR3 A;  3AEH A;  4OS0 A;  5EDC A;  4IAB A;  5DG4 A;  1MDC A;  4CDC A;  2Y3F A;  2X8F A;  1ERX A;  5JR8 A;  2LBV A;  1EPB A;  1SRI A;  1OEE A;  1IW2 A;  1BSQ A;  2FS7 A;  4YKM A;  5BYP A;  1LCV A;  1SMP I;  4NW4 A;  3UAQ A;  5L8I A;  1LDQ A;  1Y9L A;  5CHK A;  1HXZ A;  2ACO A;  5IRA A;  3AKM A;  2W2B A;  4I60 A;  3UEW A;  1JIW I;  1HMT A;  3BU9 A;  5C0N A;  1X8O A;  2WQ9 A;  4JGL A;  1Y53 X;  5L3Y A;  4COT A;  4B55 A;  1LUQ A;  1FDQ A;  2YG2 A;  4AZR A;  1U17 A;  5B11 O;  3FIQ A;  1SA8 A;  1T8V A;  2IZJ A;  4O4O A;  3O19 A;  2QOS C;  5D8J A;  1Z24 A;  4MVL A;  5D4A A;  1LNM A;  1AVG I;  1GT1 A;  1KT4 A;  2FGS A;  2Q9S A;  5HCC C;  3EW2 A;  3LHN A;  4JHQ A;  1YP7 A;  4OEM A;  4CDF A;  4LZU A;  1FEM A;  1SWD A;  3EC5 A;  3EYC A;  4YBP A;  2OF9 A;  1ADL A;  2WEX A;  4XMG A;  2FHN X;  5HCE C;  1KXO A;  1DZK A;  5FQ6 E;  4CDD A;  2IFB A;  4OMW A;  3RWX A;  1VYF A;  2E4J A;  4DCB A;  4ORU A;  1EAL A;  1FEL A;  1GT3 A;  4NLI A;  1QQS A;  4DQ3 A;  3VHH A;  4AZQ A;  1GGL A;  3VGW A;  1D2U A;  1WUB A;  2BT9 A;  2HYS A;  1MUP A;  3RY2 A;  2A8G A;  4BGF A;  3ZZV A;  3Q6L A;  3S5X A;  1HXL A;  4MVI A;  4EFG A;  1OPA A;  1UYO X;  4GKC A;  1CBQ A;  3HWE A;  4NV8 A;  4YFQ A;  5EPQ A;  4BJ8 A;  4XMF A;  2LKK A;  3SLT A;  3HWD A;  4GGZ A;  5KIC A;  4GE1 A;  4O4S A;  2XST A;  3PP6 A;  5H9N A;  3S60 A;  4BX5 B;  1STP A;  3ZW1 A;  2QCB A;  3U0D A;  1EXS A;  2R74 A;  1FJ1 E;  1EIO A;  1OBP A;  3LTW A;  1JYJ A;  1VWP B;  3WOV A;  3ZUO A;  4M7M A;  2QM9 A;  1YWC A;  5HBS A;  1KZX A;  2Z4I A;  4GJV A;  3S26 A;  2MM3 A;  2RTD B;  1B0O A;  2Z4H A;  4I9S A;  2WR6 A;  4O4U A;  1N4J A;  1MVG A;  3RDU A;  3CKF A;  1HMS A;  1ZNE A;  4EDE A;  4CPE A;  1KL4 A;  1JBH A;  4BQU A;  1VWD B;  4EEJ A;  4ODD A;  2L68 A;  4YGH A;  1RXH A;  2FT9 A;  4LQZ A;  5HWZ A;  1GXA A;  4U8U M;  4ZH9 A;  4OKA A;  2OY8 A;  1RSU B;  3KFI A;  2W2F A;  5LKF A;  4Z28 A;  3WZP A;  2IZD B;  2OFM X;  2G79 A;  3MX7 A;  1KT7 A;  5H9L A;  3WVM A;  4GZV A;  1QAB E;  1OEJ A;  2BS6 A;  1QFT A;  1VWI B;  1W4T A;  2WSJ A;  1BSO A;  1NP1 A;  4N7C A;  2A2U A;  3PK2 A;  4QQ1 A;  5KHP A;  1CBS A;  3NR3 A;  2FS6 A;  5F7G A;  4PJ2 A;  3WZQ A;  2JN3 A;  2VFC A;  2RTJ A;  4Z2V A;  2RTR B;  4O9S A;  1ZND A;  1URE A;  4ORX A;  4YGZ A;  4YH0 A;  5LJE A;  3BY0 A;  2NP1 A;  1RLB E;  4O49 A;  3RKG A;  1CRB A;  1ZNH A;  4U46 A;  3VE2 A;  4CDE A;  1HMR A;  3GE2 A;  5LJK A;  4ALB A;  1W5R A;  1HN2 A;  4QYN A;  3TGA A;  4HPA A;  4CSB A;  4BX7 A;  1JJJ A;  3BSZ E;  2JGS A;  1EW3 A;  3OE3 A;  4ID2 A;  1DZM A;  1GM6 A;  4QYP A;  2I5V O;  4I9R A;  5D45 A;  5F6B A;  4ZHG A;  1VWJ B;  3FYF A;  3KZA A;  1SWC A;  1NP4 A;  4ZJ0 A;  3CQN A;  4CPH A;  4OEL A;  5AEO A;  3ELX A;  3HK1 A;  1XKI A;  1HQP A;  5CYB A;  2X46 A;  3Q34 A;  4C5P A;  2MHD A;  2X45 A;  1GKA B;  2MO5 A;  1QY0 A;  1GX3 A;  3EBW A;  3WJC A;  1SWA A;  2A5B A;  4ZHH A;  1SWN A;  5BVQ A;  3VHM A;  1LID A;  2YMS A;  3V8U A;  3VPJ E;  3BS2 A;  2DJF A;  3EMM A;  4BX6 A;  1KQX A;  4BVM A;  4Z27 A;  2KT4 B;  4GU8 A;  1BWY A;  1VWN B;  2OL7 A;  1I05 A;  4QAE A;  5B2A O;  5AQ6 A;  2OFA A;  4YKO A;  2LA7 A;  3FA9 A;  2AMM X;  3O22 A;  4TNN A;  1SWP A;  1MX7 A;  1U0X A;  5IRW A;  2AT3 X;  4RUU A;  2RTM A;  3HWF A;  4NNS A;  2HMB A;  3HOL A;  3NP1 A;  4OMX A;  3KFH A;  2FR2 A;  3WJE A;  3TGC A;  1HBQ A;  3QKG A;  4UU2 A;  5LJG A;  5BVT A;  2FKJ A;  2KTD A;  2FHL A;  1O1U A;  1SWB A;  1I4U A;  2ASN X;  1O1V A;  2JU7 A;  2OVA A;  4GGT A;  4Y0R A;  1SY2 A;  5HZQ A;  2OFB A;  2P8G A;  3FEL A;  2IZE B;  5L8N A;  2AKQ A;  4YVB A;  4TKJ A;  1NGL A;  3EBK A;  4KC7 A;  1PEE A;  4NLJ A;  4ZHD A;  1SWJ A;  3P6E A;  3QQ2 A;  1KL5 A;  1VPR A;  1YP6 A;  3NQ3 A;  1VWF B;  4ZFX A;  4MVK A;  1N9M A;  4QZT A;  4GNY A;  4YBU A;  4HPC A;  1LIF A;  5LJB A;  5F2B A;  3T6L A;  1FEN A;  1RXK A;  4K19 A;  3ZI8 A;  1SWO A;  3D4R A;  3FEP A;  4O3Y A;  4QZU A;  1A3Y A;  2RTE B;  1VYG A;  5AJB A;  2RA6 A;  2AF5 A;  4U8U N;  3DTQ A;  3F8A A;  1H91 A;  2FKG A;  3CKG A;  3OBL A;  3TF6 A;  4NP1 A;  1NC9 A;  3CQR A;  3BU1 A;  3CBC A;  3O2Y A;  4Y0Q A;  1YIV A;  2CM9 A;  3WJD A;  4ML7 B;  3FA6 A;  2LFO A;  3APW A;  4I95 A;  3UEX A;  4JO6 A;  3VHI A;  5LKE A;  2G5L A;  3JQO A;  1N7Y A;  4JNJ A;  1VWQ B;  3RDM A;  3VG2 A;  4XMC A;  3L4R A;  3NAD A;  2PY1 A;  2ZSC A;  3FR5 A;  4AZO A;  5HZ6 A;  1JJX A;  4GDA A;  2CBS A;  1QWD A;  2HZR A;  2L5P A;  1G74 A;  2RTG B;  4BCS A;  2RTB B;  2JU8 A;  4L1N A;  3WJF A;  2Q2P A;  1U18 A;  1K24 A;  3FR2 A;  2Y32 A;  1FE3 A;  2G8C O;  1ACD A;  2W2A A;  3F6Z B;  4BX5 A;  2OL8 O;  4QRL A;  4Y0S A;  5HAE A;  5HCD C;  1KFF A;  1DV9 A;  1SWF A;  2QO6 A;  1PTS A;  4KH8 A;  3HTY A;  5EDB A;  1QFV A;  3APV A;  4QGW A;  3RDO A;  3SLJ A;  1KQW A;  1AEL A;  1ZNG A;  1EPA A;  1X71 A;  2FRS A;  3EW1 A;  2BLG A;  4O3W A;  1X8Q A;  4AZM A;  4FGI B;  1KT6 A;  2IZB A;  2JOZ A;  4OS3 A;  4BBO A;  1OBQ A;  2DJG A;  2N93 A;  4IAX A;  1ICM A;  4HFO A;  1LCW A;  2C1Q A;  3F9D A;  4NV7 A;  2ZAI A;  1NDJ A;  2AT0 X;  4BOE A;  3BX7 A;  3RDQ A;  1GT5 A;  3HOE A;  4ORW A;  5FQ7 E;  1Y55 X;  4YDA A;  3WYQ A;  4ZHC A;  5HZ9 A;  3PPT A;  2HKD A;  2CBR A;  2AT6 X;  3NX2 A;  1TW4 A;  5HA0 A;  2KTS A;  1TOU A;  3DSZ A;  4LKP A;  1HBP A;  1LIE A;  1LDO A;  1SY1 A;  4Y5D A;  1X8P A;  1CBR A;  1MK5 A;  1E06 A;  3E3C A;  4KT5 A;  1SWU A;  2EU7 X;  1B8E A;  4MIS A;  5F1E A;  2GTL O;  2CM4 A;  1R0U A;  1LIB A;  1BBP A;  2X8T A;  4EXZ A;  2X8S A;  2KD2 A;  1NBX A;  1TOW A;  1Y52 X;  1KT3 A;  1VWH B;  2UZ2 A;  1UZ2 X;  4HPD A;  1VWA B;  2JU3 A;  4O4X A;  4QNI A;  4ARH A;  1B56 A;  1KGL A;  1DZP A;  2OZQ A;  4A1Y A;  3FEN A;  3ZW1 B; 
#chains in the Genus database with same CATH homology
 5LJH A;  3C76 X;  4ZHF A;  4NNT A;  4RUN A;  2AL0 X;  2Q39 A;  3B2L A;  1D3S A;  4AYH A;  2LBA A;  1QG5 A;  4EQA C;  1JZU A;  1CBI A;  3P6F A;  4KC8 A;  4I3B A;  4PSQ A;  2NND A;  3MVF A;  3JS1 A;  3VG5 A;  3UEV A;  1GKA A;  3SAO A;  2WUT A;  4TKH A;  1GT4 A;  3RBY A;  5HZ8 A;  2CZT A;  3RZY A;  2ALL X;  4GRJ A;  5L8N A;  5LKE A;  3IFB A;  1X89 A;  2OVE A;  1G85 A;  1GX9 A;  2LB6 A;  4HWM A;  2R56 A;  3AKN A;  5EEE A;  4WHI A;  2HZQ A;  4CK4 A;  2AH7 X;  3N91 A;  2RD7 C;  3KQ0 A;  1OBU A;  2DM5 A;  3NQ9 A;  1IFB A;  5BVS A;  2NNQ A;  3FA8 A;  2GTF X;  1YWD A;  3APX A;  1ZNK A;  4I3D A;  3FW4 A;  4WFV A;  1QY1 A;  1LIC A;  2WEW A;  5FFH A;  4QGV A;  1P6P A;  1ICN A;  5HTE A;  3FLL A;  3PEC A;  1IKE A;  4Y0P A;  3WJB A;  1EQD A;  3UEU A;  3B2J A;  1BRP A;  1O8V A;  4D6A A;  4FQB B;  3BLG A;  3K3L A;  4IB6 A;  4KCA A;  2GJ5 A;  4HPB A;  4OS8 A;  5IO5 A;  3OD9 A;  4LZV A;  3CMP A;  1SXW A;  1TXL A;  4U8U O;  2A0A A;  3B2I A;  1X8N A;  4GNW A;  5DPQ A;  2R73 A;  3P6D A;  2POA A;  4O3Z A;  1SXY A;  3P02 A;  2CZU A;  1PBO A;  1OPB A;  3KFG A;  4MVE A;  3APU A;  4IMN A;  2HNX A;  2BHV A;  2JMB A;  3T1D A;  2WWP A;  2AT5 X;  4XMD A;  5B27 A;  5FEN A;  4ORS A;  3TZS A;  4N7D A;  2L9C A;  1IFC A;  2FTB A;  1YUP A;  2BS5 A;  3VG6 A;  3TGB A;  3JSQ A;  1JYD A;  3I0A A;  5H9A A;  5K06 A;  3S5V A;  1BM5 A;  4LKT A;  1IKJ A;  1SY3 A;  3OJY C;  2JW1 A;  4YMY A;  1S2P A;  2OVD A;  4IMO A;  3VU1 A;  5L8O A;  1AB0 A;  5LJC A;  3PQS A;  2GTL M;  5AJC A;  3G7X A;  1YWA A;  1DC9 A;  4XME A;  5CE4 A;  3CWK A;  3D95 A;  2MWH A;  1BRQ A;  4YFR A;  3GAQ A;  2GC9 A;  3D96 A;  2L67 A;  1BJ7 A;  3FMZ A;  3PH5 A;  1CJ5 A;  1L6M A;  2XKL A;  4U3Q A;  4GK9 A;  3FW5 A;  5F6Z A;  3STK A;  3VG7 A;  4TJZ A;  5HTD A;  4ZCB A;  4ZH6 A;  3P24 A;  4IB8 A;  4M6S A;  3FA7 A;  3VG3 A;  3PH6 A;  2KW1 A;  5FAZ A;  1TVQ A;  1KZW A;  4GH7 A;  4A60 A;  4AZN A;  3PED A;  4FBV A;  2FLJ A;  3BDR A;  3WBG A;  1B4M A;  3HWG A;  4YCE A;  5FQ8 E;  2ANS A;  3EM0 A;  1ZNL A;  2K23 A;  3FEK A;  3IA8 A;  2O62 A;  4A8Z A;  1I04 A;  4YCH A;  4QGX A;  1YWB A;  3U03 A;  1X8U A;  2G7B A;  2QMI A;  4U9C A;  3C77 X;  1ZRY A;  1T68 X;  4ALO A;  2OFR X;  5B29 A;  5IO7 A;  1G7N A;  1KT5 A;  1SXX A;  2MJI A;  2QO5 A;  4IB9 A;  4ORY A;  1LFO A;  2QO4 A;  3ELZ A;  2RCT A;  3NPO A;  3SOT A;  1EI5 A;  3P6G A;  2A2G A;  5H9K A;  1FTP A;  1I06 A;  4YFP A;  5H8T A;  3ZW2 A;  3ZW1 B;  5HZ5 A;  3P6H A;  3ZW0 A;  2ACP X;  3KFF A;  2G78 A;  4ORR A;  4CV7 A;  3MBT A;  4GET A;  3ZW0 B;  4ZR2 A;  1KOI A;  3FR4 A;  3NBX X;  4WFU A;  1E02 A;  4IAW A;  1A18 A;  1E5P A;  4AW8 A;  1E00 A;  3LV4 A;  1PM1 X;  3STM X;  3STN A;  2A13 A;  3ZWE A;  2K62 A;  2FWV A;  2HLV A;  1ALB A;  3RSW A;  1PMP A;  2F73 A;  3D97 A;  3BRN A;  3ZUI A;  1GX8 A;  4YDB A;  5F58 A;  2NNE A;  3CR6 A;  4NYR A;  4I3C A;  3BX8 A;  1S7D A;  1G5W A;  2GTL N;  3ZQ3 A;  4ZGU A;  1LKE A;  4TLJ A;  1EUO A;  2Q4N A;  3WXQ A;  4DQ4 A;  4FBR A;  4D6B A;  1A57 A;  2RN4 A;  1DF3 A;  1SY0 A;  4R0B A;  4IBA A;  4I6S A;  1EII A;  3P6C A;  1ERB A;  5D47 A;  1DFV A;  5EED A;  1OEK A;  2Q2M A;  4MIR A;  4O3X B;  4ES7 A;  1BEB A;  2WQA E;  4KII A;  4YGG A;  5EZ2 A;  4FBO A;  4TQ2 A;  5LJD A;  4ON1 A;  3VG4 A;  1XCA A;  2M4L A;  1T0V A;  2AT8 X;  3U9P C;  4TKB A;  1BLR A;  3I17 A;  1JV4 A;  1Y9T A;  4IB7 A;  3CBS A;  4WBK A;  1LPJ A;  5KID A;  2ZAG A;  1N0S A;  4GDZ A;  2OVS A;  2F09 A;  3B2K A;  1MX8 A;  4XMH A;  2RQ0 A;  1BSY A;  5D48 A;  4A1H A;  1RBP A;  3VE1 A;  2RCQ A;  4ZGF A;  3B2H A;  2A3F X;  3C78 X;  4UU3 A;  1S44 A;  1LF7 A;  1QY2 A;  3NX1 A;  4INN A;  4AZP A;  5IO6 A;  3WJG A;  1AQB A;  1A2D A;  1DZJ A;  4L3R A;  4NYQ A;  5HA1 A;  3NQK A;  3H3I A;  3PQU A;  1IIU A;  1ML7 A;  1SXU A;  2FR3 A;  4OS0 A;  5EDC A;  4IAB A;  5DG4 A;  1MDC A;  2X8F A;  1ERX A;  5JR8 A;  1EPB A;  1OEE A;  1IW2 A;  1BSQ A;  2FS7 A;  4YKM A;  5BYP A;  1SMP I;  4NW4 A;  3UAQ A;  5L8I A;  2LBV A;  1Y9L A;  2ACO A;  3AKM A;  2W2B A;  3UEW A;  1JIW I;  1HMT A;  3BU9 A;  5C0N A;  1X8O A;  2WQ9 A;  4JGL A;  4COT A;  1FDQ A;  2YG2 A;  4AZR A;  1U17 A;  3FIQ A;  1SA8 A;  1T8V A;  4O4O A;  3O19 A;  2QOS C;  5D8J A;  1Z24 A;  4MVL A;  5D4A A;  1LNM A;  1AVG I;  1GT1 A;  1KT4 A;  2Q9S A;  5HCC C;  3LHN A;  1YP7 A;  4LZU A;  1FEM A;  4YBP A;  3EYC A;  2WEX A;  1ADL A;  4XMG A;  5HCE C;  1KXO A;  1DZK A;  5FQ6 E;  1EAL A;  2IFB A;  4OMW A;  3RWX A;  1VYF A;  2E4J A;  4ORU A;  1FEL A;  1GT3 A;  4NLI A;  1QQS A;  4DQ3 A;  4AZQ A;  1GGL A;  1D2U A;  2BT9 A;  2HYS A;  1MUP A;  3ZZV A;  3Q6L A;  3S5X A;  4MVI A;  4EFG A;  1OPA A;  4GKC A;  1CBQ A;  3HWE A;  4YFQ A;  5EPQ A;  5KIC A;  4XMF A;  2LKK A;  3HWD A;  4GE1 A;  4O4S A;  2XST A;  3PP6 A;  5H9N A;  3S60 A;  3ZW1 A;  1EIO A;  3U0D A;  1EXS A;  2R74 A;  1OBP A;  1JYJ A;  3WOV A;  3ZUO A;  4M7M A;  2QM9 A;  1YWC A;  5HBS A;  1KZX A;  2Z4I A;  3S26 A;  2MM3 A;  2Z4H A;  1B0O A;  4I9S A;  4O4U A;  2WR6 A;  1MVG A;  1HMS A;  1ZNE A;  4EDE A;  1JBH A;  4BQU A;  4EEJ A;  4ODD A;  2L68 A;  4YGH A;  4LQZ A;  2FT9 A;  5HWZ A;  1GXA A;  4U8U M;  4ZH9 A;  3KFI A;  2W2F A;  5LKF A;  2OFM X;  2G79 A;  3MX7 A;  1KT7 A;  5H9L A;  3WVM A;  4GZV A;  1QAB E;  1OEJ A;  2BS6 A;  1QFT A;  2WSJ A;  1BSO A;  1NP1 A;  4N7C A;  2A2U A;  4QQ1 A;  5KHP A;  1CBS A;  3NR3 A;  2FS6 A;  5F7G A;  4PJ2 A;  2JN3 A;  4O9S A;  1ZND A;  1URE A;  4ORX A;  4YGZ A;  4YH0 A;  5LJE A;  3BY0 A;  2NP1 A;  1RLB E;  4O49 A;  3RKG A;  1CRB A;  1ZNH A;  3VE2 A;  5LJK A;  1HMR A;  3GE2 A;  4ALB A;  1HN2 A;  4QYN A;  3TGA A;  4HPA A;  4CSB A;  1JJJ A;  3BSZ E;  1EW3 A;  3OE3 A;  4ID2 A;  1DZM A;  1GM6 A;  4QYP A;  4I9R A;  5D45 A;  5F6B A;  4ZHG A;  3FYF A;  3KZA A;  4ZJ0 A;  1NP4 A;  3CQN A;  5AEO A;  3ELX A;  3HK1 A;  1XKI A;  1HQP A;  5CYB A;  2X46 A;  2MHD A;  2X45 A;  1GKA B;  2MO5 A;  1QY0 A;  3EBW A;  3WJC A;  4ZHH A;  5BVQ A;  1LID A;  2YMS A;  3V8U A;  3VPJ E;  3BS2 A;  3EMM A;  1BWY A;  1KQX A;  4BVM A;  2KT4 B;  4GU8 A;  4QAE A;  1I05 A;  5AQ6 A;  4YKO A;  2LA7 A;  3FA9 A;  2AMM X;  3O22 A;  4TNN A;  1MX7 A;  1U0X A;  2AT3 X;  4RUU A;  3HWF A;  4NNS A;  2HMB A;  3HOL A;  3NP1 A;  4OMX A;  3KFH A;  2FR2 A;  3WJE A;  3TGC A;  1HBQ A;  3QKG A;  4UU2 A;  5LJG A;  5BVT A;  2KTD A;  1O1U A;  1I4U A;  2ASN X;  1O1V A;  2JU7 A;  2OVA A;  4Y0R A;  1SY2 A;  5HZQ A;  2P8G A;  3FEL A;  2AKQ A;  4TKJ A;  1NGL A;  3EBK A;  4KC7 A;  1PEE A;  4NLJ A;  4ZHD A;  3P6E A;  1VPR A;  1YP6 A;  3NQ3 A;  4ZFX A;  4MVK A;  4QZT A;  4GNY A;  4YBU A;  4HPC A;  1LIF A;  5LJB A;  1FEN A;  4K19 A;  3ZI8 A;  3D4R A;  3FEP A;  4O3Y A;  4QZU A;  1A3Y A;  1VYG A;  5AJB A;  2RA6 A;  4U8U N;  3DTQ A;  3F8A A;  1H91 A;  3OBL A;  3TF6 A;  4NP1 A;  3CQR A;  3BU1 A;  3CBC A;  3O2Y A;  4Y0Q A;  1YIV A;  2CM9 A;  3WJD A;  4ML7 B;  3FA6 A;  2LFO A;  3APW A;  4I95 A;  3UEX A;  3JQO A;  3VG2 A;  4XMC A;  3L4R A;  3NAD A;  2PY1 A;  3FR5 A;  4AZO A;  5HZ6 A;  1JJX A;  2CBS A;  1QWD A;  2HZR A;  2L5P A;  1G74 A;  3WJF A;  2JU8 A;  4L1N A;  2Q2P A;  1U18 A;  3FR2 A;  1FE3 A;  3F6Z B;  1ACD A;  2W2A A;  5HCD C;  5HAE A;  4Y0S A;  4QRL A;  1DV9 A;  2QO6 A;  4KH8 A;  5EDB A;  3HTY A;  1QFV A;  3APV A;  4QGW A;  1KQW A;  1AEL A;  1ZNG A;  1EPA A;  1X71 A;  2FRS A;  4O3W A;  2BLG A;  4AZM A;  1X8Q A;  4FGI B;  1KT6 A;  2JOZ A;  4OS3 A;  1OBQ A;  2N93 A;  4IAX A;  1ICM A;  4HFO A;  3F9D A;  2ZAI A;  2AT0 X;  4BOE A;  3BX7 A;  1GT5 A;  3HOE A;  4ORW A;  5FQ7 E;  4YDA A;  4ZHC A;  5HZ9 A;  3PPT A;  2CBR A;  2AT6 X;  3NX2 A;  1TW4 A;  5HA0 A;  2KTS A;  1TOU A;  3DSZ A;  4LKP A;  1HBP A;  1LIE A;  1SY1 A;  1CBR A;  1X8P A;  3E3C A;  1E06 A;  4KT5 A;  4MIS A;  2EU7 X;  5F1E A;  1B8E A;  2GTL O;  2CM4 A;  1R0U A;  1LIB A;  1BBP A;  2X8T A;  4EXZ A;  2X8S A;  2KD2 A;  1TOW A;  1KT3 A;  1UZ2 X;  4HPD A;  2JU3 A;  4O4X A;  4QNI A;  4ARH A;  1B56 A;  1KGL A;  1DZP A;  2OZQ A;  4A1Y A;  3FEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...