1BLRA

Nmr solution structure of human cellular retinoic acid binding protein-type ii, 22 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
137
structure length
137
Chain Sequence
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport
molecule keywords CELLULAR RETINOIC ACID BINDING PROTEIN-TYPE II
publication title NMR solution structure of type II human cellular retinoic acid binding protein: implications for ligand binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 1998-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1blrA00
1ML7A 4ZJ0A 3C76X 4ORSA 1ZNHA 2Q2MA 2JOZA 1SA8A 3MVFA 1B8EA 3ELXA 1JZUA 5BVTA 1B4MA 2JU7A 3TZSA 1ADLA 3KFFA 4A1YA 1OPAA 3KFHA 5K06A 1OBUA 4EFGA 4RUNA 1PEEA 1CJ5A 1FELA 2FLJA 3VG3A 1CBRA 2X45A 3FA7A 4ORUA 3ZQ3A 5KICA 3UEVA 2NNQA 3UEWA 3NADA 1YWBA 4LZVA 2OVDA 1GXAA 5EZ2A 5L8OA 1KQXA 5FAZA 5L8IA 1KT3A 4O9SA 4ORRA 4ZHHA 2LBVA 3APWA 1YUPA 2W2FA 1YP7A 4A8ZA 4QAEA 3I17A 4TKBA 1X8OA 1HMRA 5F58A 5HZ8A 1BBPA 3AKNA 5LKEA 4ZGUA 1JJXA 4GRJA 5EEDA 1EALA 4ARHA 1LICA 1S2PA 4QYNA 1D2UA 2Q4NA 2JU8A 1G85A 1KOIA 2N93A 4Y0RA 3WJCA 1EUOA 2WEWA 2OFRX 1HBPA 1HMSA 3TGBA 2A2GA 1P6PA 5D47A 1BJ7A 3HK1A 4NLIA 4ODDA 3FEPA 1TXLA 5HCCC 4TLJA 2LFOA 3VG4A 1QY2A 2RQ0A 2CBRA 1TVQA 3CQNA 4YCEA 3VG7A 2A2UA 4AZPA 4EEJA 5AQ6A 1IW2A 3P6FA 3FR4A 1PBOA 1D3SA 3P6EA 1GT4A 1N0SA 2RCQA 4XMDA 1YWAA 4HPCA 4AYHA 2LKKA 2R74A 3FR5A 2JN3A 1SXUA 4XMGA 1OBQA 3K3LA 4NP1A 1OEJA 1MX7A 1I05A 1DV9A 1SY1A 1A3YA 3BS2A 1CBSA 3NX2A 2HLVA 3STMX 4QZTA 4IMOA 1X71A 1LIEA 4UU2A 2QO4A 3FMZA 2ACOA 5LJDA 1NGLA 1EW3A 3HWEA 4IB8A 4OS0A 1T68X 5L8NA 2GC9A 1FTPA 3BX8A 3TF6A 1YWCA 3BU1A 1NP1A 5HCEC 4M6SA 5HZ6A 4ZCBA 4QGXA 3FIQA 4NNTA 1T0VA 1B0OA 4IMNA 2LB6A 2XSTA 1E02A 3NPOA 2A3FX 3D96A 3O2YA 2QO6A 4WBKA 4AW8A 3PH5A 2AL0X 2FS6A 2WSJA 2RA6A 4OMXA 5KIDA 3VG5A 4BVMA 5F7GA 3CQRA 2FT9A 3HWFA 4YDAA 2QO5A 1GGLA 3IA8A 1E00A 3KFGA 5H9NA 4NNSA 3BX7A 3KFIA 1JV4A 1BEBA 1FENA 3ELZA 2XKLA 1MVGA 1O1VA 4HFOA 1GT3A 4M7MA 1ERBA 1UREA 5JR8A 2FTBA 2L68A 3WBGA 5IO6A 5CE4A 1KGLA 2CM4A 3EBKA 3IFBA 3PPTA 1KXOA 4YKMA 1A18A 1DC9A 2AT0X 1GKAA 1DFVA 4ZR2A 2AT5X 5H9KA 3NP1A 5HZ5A 1KT4A 3S26A 2ALLX 5HAEA 2A13A 2BLGA 4I9SA 4AZRA 2GJ5A 1TOUA 5B29A 2RD7C 1FE3A 2G78A 2WQ9A 2MJIA 2Q2PA 4ORYA 1BWYA 1OPBA 4NLJA 5F1EA 5D45A 3STKA 3C78X 2RCTA 5HZQA 1IFBA 1LIDA 3KZAA 1X8UA 3APVA 5D8JA 1LF7A 4QZUA 5D48A 1X8PA 4YGHA 3EMMA 1EIIA 2A0AA 2CZUA 3B2JA 3O22A 1KT7A 2HZQA 4ZHGA 4RUUA 3CBCA 4HPBA 2W2AA 4AZOA 2F73A 3C77X 1E5PA 1QG5A 3DSZA 4UU3A 2MO5A 1A57A 1O1UA 3Q6LA 2AKQA 2Q39A 1G74A 4XMEA 3UEUA 5BVQA 1TOWA 3STNA 4HPDA 3NX1A 4NYQA 3L4RA 3U9PC 3BY0A 3FEKA 4IB7A 4LKPA 2OZQA 3FW4A 5FFHA 1S44A 4WFVA 1MUPA 2IFBA 4YFPA 3P6HA 4HPAA 3FA9A 5HBSA 1YP6A 2PY1A 5EPQA 5B27A 4A1HA 1ACDA 3BDRA 3EM0A 4YBUA 5DPQA 1CRBA 1R0UA 1VYGA 2QM9A 3U0DA 4LZUA 1JYDA 4AZQA 5C0NA 4GNWA 4ORXA 2FWVA 4EXZA 1QQSA 4PSQA 2E4JA 4KIIA 1IKJA 4GETA 1IIUA 4TJZA 3EBWA 1LPJA 2AT8X 4QGWA 4YFQA 4YBPA 3G7XA 4OS3A 3VG2A 1QABE 2WUTA 3O19A 2WWPA 1HBQA 1BRQA 2ANSA 2WQAE 4I3DA 2K23A 1B56A 3B2IA 4D6AA 1ZRYA 2MM3A 4XMCA 1OBPA 1PM1X 4WFUA 1LIFA 4OMWA 1JBHA 5LJEA 1QFVA 1OEKA 2ASNX 1HQPA 1FEMA 3WVMA 1TW4A 3CBSA 1GT5A 1DZJA 2DM5A 5LJHA 2R73A 2OFMX 1RBPA 2JU3A 1GM6A 2KT4B 1LFOA 1ICNA 3WJFA 1BRPA 3UEXA 3D97A 1ICMA 4YCHA 5HA1A 4ZH9A 2HNXA 1DZPA 2QOSC 1Z24A 4N7DA 1PMPA 1I4UA 3ZUIA 3JS1A 4LKTA 1ERXA 1ZNDA 4TQ2A 1ZNKA 1EPAA 4ALBA 4YDBA 3QKGA 1SY0A 1XCAA 3GAQA 3PECA 4BOEA 1BSOA 1AELA 4ZH6A 2FR3A 3BSZE 2OVAA 3HWDA 1IKEA 1MX8A 3NQ9A 3NQ3A 1CBQA 2FRSA 3VG6A 1L6MA 1JYJA 3JSQA 1CBIA 3PEDA 4IB6A 1IFCA 1I04A 4ALOA 1S7DA 3BRNA 3B2LA 1QY1A 4NYRA 2K62A 2WR6A 1QY0A 5H9AA 5HTDA 4D6BA 5EEEA 3EYCA 3B2KA 3RSWA 1BSQA 1GKAB 4GNYA 1T8VA 3P6CA 1MDCA 4YKOA 3APUA 1HN2A 4OS8A 3KQ0A 4R0BA 5LJBA 1DF3A 2HYSA 4XMHA 3F9DA 2OVEA 5KHPA 4DQ3A 4MVIA 2AT3X 5F6BA 4ZHCA 1AVGI 2R56A 4CK4A 1ALBA 5IO5A 5HZ9A 1LIBA 3U03A 1KZXA 1O8VA 2LBAA 4IAXA 1U0XA 4ORWA 1KZWA 1U17A 3T1DA 1I06A 3CWKA 4YH0A 2P8GA 5D4AA 3WJGA 1HMTA 3OJYC 3WXQA 2AH7X 2FS7A 1SY3A 1YWDA 1JJJA 2YG2A 1SXWA 1U18A 4ES7A 4IAWA 4AZMA 1DZKA 1KT5A 2G79A 5HTEA 4IBAA 2FR2A 2ACPX 3FR2A 2POAA 1GX8A 2KTDA 4TNNA 3D95A 3CR6A 4XMFA 1BSYA 2Q9SA 1AQBA 5DG4A 1X8QA 4EDEA 1LKEA 5LJGA 2HMBA 4GH7A 4TKHA 4K19A 2NNDA 1OEEA 2L5PA 2AT6X 1E06A 1ZNGA 4MVLA 3CMPA 2NNEA 1EQDA 4YGZA 2W2BA 4Y0QA 4ZFXA 1G7NA 1GX9A 1LNMA 4MVKA 2CM9A 2NP1A 2X46A 3F8AA 4I3CA 1VPRA 3ZUOA 1VYFA 3P6DA 3TGCA 3AKMA 4QYPA 4DQ4A 3APXA 1QFTA 1FDQA 1YIVA 3FA8A 1ZNLA 4ZHDA 4A60A 5EDBA 5LJKA 1KT6A 5BVSA 1DZMA 1EIOA 1BLRA 2GTFX 2L9CA 1A2DA 2CBSA 3WJBA 5FENA 3MBTA 5HA0A 3BU9A 5HWZA 4Y0PA 3WJDA 3PP6A 1G5WA 4I3BA 1EPBA 1SXXA 4ZHFA 2CZTA 1XKIA 3HWGA 4N7CA 5EDCA 4QGVA 1ZNEA 1UZ2X 3FLLA 5H8TA 1KQWA 3TGAA 2AMMX 4TKJA 3NR3A 4AZNA 3FA6A 1X8NA 3DTQA 4GE1A 3RZYA 1X89A 2HZRA 3B2HA 3I0AA 5HCDC 1SXYA 5F6ZA 1SY2A 5LKFA 1RLBE 4YMYA 5LJCA 2WEXA 2O62A 4GKCA 5IO7A 1GT1A 3P6GA 3FENA 4IB9A 4BQUA 1BM5A 4Y0SA 1H91A 3WJEA 1EXSA 1AB0A 1NP4A 2EU7X 3FELA 3FW5A 2G7BA 3SAOA 4I9RA 3PH6A 4YGGA 3BLGA 5H9LA 4YFRA 1QWDA 2L67A
chains in the Genus database with same CATH superfamily
1ML7A 4ZJ0A 3C76X 3GE2A 2C1QA 4ORSA 4INNA 1ZNHA 2Q2MA 2JOZA 1NDJA 1SA8A 1SWLA 4GD9A 1SWFA 3MVFA 1B8EA 3ELXA 1JZUA 4JHQA 4Z2PA 5BVTA 1B4MA 2JU7A 3TZSA 1ADLA 3KFFA 4A1YA 4BX7A 1OPAA 3KFHA 5K06A 1OBUA 3AEHA 4EFGA 4RUNA 1SLEB 2QCBA 1PEEA 1CJ5A 2RTCB 1FELA 2FLJA 3VG3A 1CBRA 1MEPA 4JO6A 4BGFA 2X45A 3FA7A 4ORUA 1IJ8A 3ZQ3A 5KICA 3UEVA 2NNQA 3UEWA 3D4RA 4DNEA 2DJFA 1YWBA 3NADA 4LZVA 2OVDA 1GXAA 3RDMA 5EZ2A 5L8OA 1KQXA 5FAZA 5L8IA 4Z28A 1KT3A 2QMIA 2RTBB 3UAQA 2IZGB 4O9SA 4ORRA 2X34A 1SWDA 3ZW1B 1KL3A 4CSBA 4ZHHA 2LBVA 4O4UA 2BT9A 3APWA 1YUPA 2W2FA 4JNJA 1YP7A 4KC7A 4A8ZA 4QAEA 3I17A 4QNIA 1X8OA 4TKBA 1HMRA 5F58A 3VHMA 5HZ8A 1BBPA 3AKNA 5IRAA 3RE5A 5LKEA 4ZGUA 1JJXA 4GRJA 5EEDA 1EALA 2IZCB 4ARHA 3S5XA 2OF8A 1LICA 1SRFA 1S2PA 4QYNA 5FQ8E 1D2UA 1HXLA 2Q4NA 2JU8A 1G85A 1KOIA 1Y53X 2N93A 1SWEA 1EUOA 2WEWA 3D9WA 3FDCA 4O3XB 4Y0RA 2OFRX 1N9YA 1WBIA 1VWCB 2PI3O 4B55A 1HBPA 1HMSA 3TGBA 1SWUA 2A2GA 4Z2VA 1P6PA 5D47A 2VFCA 3WYQA 1BJ7A 4CPFA 3HK1A 4Z2OA 2KD2A 4NLIA 2OY5O 4ODDA 4U46A 3FEPA 1TXLA 5HCCC 4TLJA 2LFOA 3VG4A 1QY2A 2CBRA 2RQ0A 1TVQA 3ZI8A 3CQNA 4YCEA 4FBOA 2OVSA 4GUZA 1SWOA 2A2UA 3VG7A 1LCZA 1LUQA 5AQ6A 1IW2A 3P6FA 3VPJE 4AZPA 3H3IA 3FR4A 1PBOA 1D3SA 4COTA 3P6EA 1KFFA 1SRHA 2RTMA 3N91A 4KH8A 1SRJA 5B5GA 1GT4A 1N0SA 2RCQA 2X32A 4GDZA 4XMDA 1YWAA 2RTFB 4HPCA 4AYHA 2LKKA 2R74A 1VWDB 2ZAGA 3FR5A 4U3QA 2JN3A 5B3MO 1SXUA 1VWGB 4XMGA 4Z27A 1OBQA 3K3LA 4IRWA 5B2AO 4NP1A 1OEJA 1MX7A 4EQAC 1I05A 1AVEA 2ZSCA 1DV9A 1SY1A 1A3YA 3RY2A 3BS2A 4YKOA 3P02A 1CBSA 3NX2A 2HLVA 3NQKA 3STMX 4U9CA 4QZTA 4IMOA 1X71A 1LIEA 1JMZA 4UU2A 2QO4A 3FMZA 2ACOA 5LJDA 2RN4A 1NGLA 1EW3A 3HWEA 1VWOB 4CDEA 1VWJB 3WJCA 4IB8A 4GJVA 4PJ2A 4OS0A 1T68X 5L8NA 2Z4IA 2GC9A 1FTPA 3BX8A 3TF6A 1FJ1E 3OBLA 1YWCA 2FHNX 2X8TA 1VWFB 1NP1A 3BU1A 4ML7B 2F01A 5HCEC 4M6SA 5HZ6A 4ZCBA 1RXJA 4QGXA 3FIQA 1HQQA 4NNTA 1T0VA 4GGZA 1B0OA 4GU8A 4IMNA 3RDSA 4MVEA 2LB6A 2FKJA 2X55A 2XSTA 4U8UM 1E02A 3NPOA 2A3FX 3D96A 3O2YA 2QO6A 4O49A 4WBKA 3RBYA 3PH5A 4AW8A 2AL0X 2FS6A 2WSJA 1RXKA 1SWSA 2DJGA 2RA6A 1RSTB 1VWAB 4OMXA 4C5PA 4CV7A 2IZKA 5KIDA 3VG5A 4BVMA 2FKGA 4BX6B 5F7GA 3CQRA 1SWPA 2FT9A 3HWFA 4O3ZA 4YDAA 2QO5A 3S60A 4U8UN 1GGLA 3MX7A 1SWHA 1SREA 3IA8A 5B10O 2X4MA 3LHNA 1E00A 3KFGA 5H9NA 4BJ8A 2G5LA 4OELA 4NNSA 2MHDA 3AUMO 4CPHA 3BX7A 3KFIA 1JV4A 1W5RA 1BEBA 3WZOA 1FENA 3ELZA 3VU1A 2XKLA 2X56A 1VWBB 3V8UA 1MVGA 1O1VA 4HFOA 1JMXA 1SWQA 1GT3A 4M7MA 1ERBA 1UREA 5JR8A 3SZIA 2FTBA 4MEEA 3T2WA 2L68A 3WBGA 1VWIB 5IO6A 4O4XA 5CE4A 3PQSA 4O4OA 2JW1A 5L3YA 1KGLA 2CM4A 2IZLB 1LCWA 3EBKA 3IFBA 3PPTA 1KXOA 3UEUA 4YKMA 1A18A 1DC9A 2AT0X 4GGRA 1GKAA 4BX7B 1DFVA 4ZR2A 2AT5X 5H9KA 1RSUB 3NP1A 3SZJA 5HZ5A 1KT4A 3S26A 2ALLX 3JQOA 5HAEA 2A13A 1K3BA 2BLGA 4I9SA 4AZRA 1N4JA 2GJ5A 1TOUA 5FQ6E 5B29A 2RD7C 2VDFA 1FE3A 1VWHB 1Y9LA 1N43A 5K67A 2G78A 2WQ9A 3FIDA 2MJIA 2Q2PA 2RTOB 4Y59A 4ORYA 3LV4A 5B11O 1BWYA 1OPBA 3EW2A 4NW4A 4NLJA 4NV8A 3SLJA 5F1EA 5D45A 2X8SA 4KC8A 3STKA 2I5ZO 3C78X 2RCTA 5HZQA 1IFBA 1LIDA 3KZAA 1X8UA 3APVA 5D8JA 1MK5A 1LF7A 4QZUA 5D48A 5AEOA 1X8PA 4YGHA 3EMMA 1EIIA 2A0AA 2CZUA 3B2JA 2KTSA 3O22A 1KT7A 4KT5A 3RE6A 2HZQA 5IRUA 4ZHGA 3PDFA 4RUUA 3CBCA 4HPBA 2W2AA 4AZOA 2F73A 3C77X 1E5PA 1QG5A 3SOTA 2BC3A 3DSZA 4UU3A 1K24A 2MO5A 3RDXA 3WZQA 3WZPA 1O1UA 3Q6LA 1A57A 2AKQA 5IRWA 2Q39A 2C4IA 3RDOA 1G74A 4XMEA 1JIWI 5BYPA 2JGSA 5BVQA 2QOMA 2RTGB 4KCAA 1TOWA 2RTQB 4HPDA 4MIRA 3STNA 4CDCA 3NX1A 4NYQA 3L4RA 3U9PC 5B5FA 3Q34A 3BY0A 3FEKA 4IB7A 4LKPA 4FBRA 4CDDA 2OF9A 4FQBB 2OZQA 1MM9A 5AJBA 2RTHB 1NBXA 3FW4A 5FFHA 4I6SA 1DF8A 1LELA 1S44A 1SWCA 1VYOA 1MUPA 2IFBA 4WFVA 3P6HA 4HPAA 4YFPA 4U8UO 3FA9A 5HBSA 1JJUA 1YP6A 2RTEB 2PY1A 4OKAA 5EPQA 2OL8O 5B27A 4A1HA 1ACDA 3BDRA 4WHIA 2IZHB 3EM0A 4YBUA 5F2BA 5DPQA 1N9MA 1CRBA 2MWHA 1R0UA 1VYGA 1SLGB 2QM9A 1STPA 3U0DA 4LZUA 1JYDA 2RTAA 4JGLA 4AZQA 4GNWA 2IZFB 5C0NA 4FGIB 2FWVA 4ORXA 3ZWEA 4L1NA 4EXZA 1QQSA 3VGWA 3ZZVA 1Y0GA 4PSQA 2E4JA 3T6FA 4KIIA 1IKJA 2X8FA 4GETA 1IIUA 4TJZA 3EBWA 3RWXA 1LPJA 2AT8X 3VE1A 4QGWA 4YFQA 4YBPA 3G7XA 4OS3A 3VG2A 1QABE 1SRGA 2WUTA 1UYOX 2BS6A 3O19A 5AJCA 2WWPA 1HBQA 2GTLM 3FYFA 4GK9A 4IABA 1BRQA 5CSEA 3RDUA 2JMBA 4ZH6A 2ANSA 4ID2A 2WQAE 4I3DA 1Y52X 2K23A 1B56A 3B2IA 3HOLA 1NC9A 4D6AA 1ZRYA 2MM3A 1VWRB 4GGTA 4XMCA 1OBPA 1SLDB 1PM1X 2F09A 3EC5A 1GX3A 4WFUA 1LIFA 4OMWA 1JBHA 5LJEA 1QFVA 5FQ7E 1OEKA 2ASNX 1HQPA 4GDAA 1PTSA 1FEMA 3WVMA 1TW4A 4BX5A 3CBSA 1GT5A 1DZJA 2DM5A 2RTKA 1I78A 2R73A 4FBVA 3WYPA 5LJHA 1EI5A 2OFMX 1RBPA 1VWLB 1GM6A 2JU3A 2KT4B 1LDQA 1ICNA 1LFOA 1KL4A 1BRPA 2RTLA 3UEXA 3D97A 3WJFA 1ICMA 1SWBA 4YCHA 5HA1A 4ZH9A 2HNXA 2MF6A 4Y5DA 3ZW0A 1DZPA 2QOSC 1Z24A 4N7DA 1PMPA 4GZVA 1I4UA 3ZUIA 3JS1A 4L3RA 4LKTA 1ERXA 1ZNDA 4TQ2A 1ZNKA 2UZ2A 1EPAA 4ALBA 4YDBA 3QKGA 1JQPA 1SY0A 1XCAA 3GAQA 3X00A 3PECA 2FHLA 3EW1A 4BOEA 2Y3FA 2WPUA 1SWKA 1BSOA 1AELA 2OL7A 3CKGA 2FR3A 1HY2A 1RXHA 2OVAA 3BSZE 1LDOA 3HWDA 2IZDB 1SWNA 2Y3EA 3HPEA 2YMSA 4CPHB 1IKEA 2OFAA 1MX8A 3NBXX 3NQ9A 3SZHA 1SLFB 3NQ3A 1CBQA 3SLOA 2Z4HA 2FRSA 3VG6A 1L6MA 2A5CA 1JYJA 3JSQA 1CBIA 3PEDA 3PQUA 3RY1A 1PBYA 1MOYA 4IB6A 1IFCA 1I04A 1UYNX 1S7DA 3CKFA 3BRNA 4ALOA 5IXGA 3B2LA 5JD2A 3RDQA 3PK2A 1QY1A 4NYRA 2K62A 2WR6A 4MISA 1QY0A 5H9AA 3WZNA 5HTDA 4D6BA 2OY7A 3ZW1A 5EEEA 3EYCA 3B2KA 3RSWA 1BSQA 2OYBO 1GKAB 2BS5A 4GNYA 1T8VA 2IZJA 2RTRB 2I5VO 3P6CA 1MDCA 2CAMA 1I9HA 1HN2A 1SWJA 2IZEB 3APUA 3E3CA 3KQ0A 4O3WA 4OS8A 4R0BA 5LJBA 5CYBA 1DF3A 2HYSA 2LA7A 3F9DA 1AVDA 2OVEA 4XMHA 5KHPA 4ON1A 2FGSA 4DQ3A 2Y32A 4MVIA 1HXZA 2AT3X 4OEMA 5F6BA 4ZHCA 1AVGI 2A5BA 2R56A 4CK4A 1ALBA 5IO5A 5HZ9A 3T6LA 3MM0A 1LIBA 3U03A 4LQZA 1KZXA 1O8VA 4GJSA 2LBAA 2RTIB 3KVNA 1U0XA 4IAXA 4ORWA 1U17A 2IZAA 4DCBA 1KZWA 3T1DA 1I06A 3CWKA 5CHKA 1KL5A 3ZW2A 4YH0A 4BCSA 2G8CO 2P8GA 5D4AA 3WJGA 2M4LA 1HMTA 3OJYC 3WXQA 2AH7X 2FS7A 1SY3A 1YWDA 3VHHA 2YG2A 1JJJA 1SXWA 2IZBA 1U18A 4ES7A 1STRB 4IAWA 4AZMA 1DZKA 2IZIA 1KT5A 4ZGFA 2G79A 5HTEA 1VWEB 1OSPO 2FR2A 1W6FA 1SWTA 2ACPX 3FR2A 4IBAA 2GTLO 2POAA 1GX8A 4CPIA 2OY1O 2KTDA 4TNNA 3D95A 3S5VA 3CR6A 4XMFA 2C1SA 1BSYA 1SWAA 1AQBA 2Q9SA 1X8QA 5DG4A 2HKDA 4EDEA 1LKEA 5LJGA 2HMBA 4GH7A 3T2XA 2ZAIA 4TKHA 3OE3A 4K19A 2NNDA 1NQMA 1OEEA 2L5PA 2AT6X 1E06A 2OFBA 3P24A 1ZNGA 1W4TA 3CMPA 2NNEA 4MVLA 2AF5A 4YVBA 1EQDA 4NV7A 4YGZA 2OY8A 2W2BA 4Y0QA 4ZFXA 3F6ZB 1G7NA 1GX9A 1LNMA 4MVKA 2CM9A 2NP1A 2X46A 1SWGA 1RAVA 3F8AA 4I3CA 1VPRA 4I60A 3HOEA 3HTYA 3ZUOA 2VFBA 1VYFA 3P6DA 3TGCA 3AKMA 2RTJA 4QYPA 4DQ4A 3APXA 1QFTA 1FDQA 1YIVA 3FA8A 3VHIA 1ZNLA 1STSB 4ZHDA 4BBOA 1SRIA 1N7YA 5EDBA 4A60A 5LJKA 1KT6A 5BVSA 1VWQB 1Y55X 1DZMA 1WUBA 1EIOA 3MG5A 2GTFX 1BLRA 2L9CA 1A2DA 4Z6JA 2CBSA 3WJBA 4HWMA 3MBTA 5HA0A 5FENA 1VWMB 5K68A 3BU9A 5HWZA 4Y0PA 3WJDA 1NQNA 4CPEA 2GTLN 3QQ2A 3PP6A 1G5WA 4I3BA 1EPBA 2OL6O 1SXXA 4ZHFA 2CZTA 1XKIA 3HWGA 4N7CA 5EDCA 3WOVA 4QGVA 1ZNEA 1UZ2X 3FLLA 3SLTA 2UYWA 5H8TA 1KQWA 2KW1A 3TGAA 2AMMX 4TKJA 3NR3A 1LCVA 2AVIA 2GH7A 2BHVA 4AZNA 3FA6A 2RTNB 4QRLA 1X8NA 3DTQA 4GE1A 1Y9TA 1X89A 2HZRA 3B2HA 3I0AA 3RZYA 5HCDC 1SXYA 4O3YA 5F6ZA 4BX6A 1SY2A 3LTWA 5LKFA 1RLBE 4YMYA 5LJCA 2WEXA 1VWNB 4O4SA 2RTDB 2O62A 1SMPI 4GKCA 1VWKB 4EKVA 5IO7A 1GT1A 2A8GA 3P6GA 3FENA 4IB9A 1SWRA 4BQUA 1BM5A 1E2TA 2BSZA 3OD9A 1H91A 4Y0SA 3RKGA 4BX5B 4EEJA 3WJEA 4QQ1A 4I95A 3VE2A 1EXSA 1AB0A 1NP4A 2EU7X 3FELA 3FW5A 2G7BA 2RTPB 4CDFA 3SAOA 4I9RA 3PH6A 4YGGA 1VWPB 3BLGA 3ZW0B 5H9LA 4YFRA 1QWDA 2L67A
chains in the Genus database with same CATH topology
1ML7A 4ZJ0A 3C76X 3GE2A 4ORSA 4INNA 1ZNHA 2Q2MA 2JOZA 1SA8A 3MVFA 1B8EA 3ELXA 1JZUA 5BVTA 1B4MA 2JU7A 3TZSA 1ADLA 3KFFA 4A1YA 1OPAA 3KFHA 5K06A 1OBUA 4EFGA 4RUNA 1PEEA 1CJ5A 1FELA 2FLJA 3VG3A 1CBRA 2X45A 3FA7A 4ORUA 3ZQ3A 5KICA 3UEVA 2NNQA 3UEWA 3D4RA 3NADA 1YWBA 4LZVA 2OVDA 1GXAA 5EZ2A 5L8OA 1KQXA 5FAZA 5L8IA 1KT3A 2QMIA 3UAQA 4O9SA 4ORRA 3ZW1B 4CSBA 4ZHHA 2LBVA 4O4UA 2BT9A 3APWA 1YUPA 2W2FA 4KC7A 1YP7A 4A8ZA 4QAEA 3I17A 4QNIA 1X8OA 4TKBA 1HMRA 5F58A 5HZ8A 1BBPA 3AKNA 5LKEA 4ZGUA 1JJXA 4GRJA 5EEDA 1EALA 4ARHA 3S5XA 1LICA 1S2PA 4QYNA 5FQ8E 1D2UA 2Q4NA 2JU8A 1G85A 1KOIA 2N93A 4Y0RA 3WJCA 1EUOA 2WEWA 4O3XB 2OFRX 1HBPA 1HMSA 3TGBA 2A2GA 1P6PA 5D47A 1BJ7A 3HK1A 2KD2A 4NLIA 4ODDA 3FEPA 1TXLA 5HCCC 4TLJA 2LFOA 3VG4A 1QY2A 2CBRA 2RQ0A 1TVQA 3ZI8A 3CQNA 4YCEA 4FBOA 2OVSA 3VG7A 2A2UA 3VPJE 4AZPA 4EEJA 5AQ6A 1IW2A 3P6FA 3H3IA 3FR4A 1PBOA 1D3SA 4COTA 3P6EA 3N91A 4KH8A 1GT4A 1N0SA 2RCQA 4GDZA 4XMDA 1YWAA 4HPCA 4AYHA 2LKKA 2R74A 2ZAGA 3FR5A 4U3QA 2JN3A 1SXUA 4XMGA 1OBQA 3K3LA 4NP1A 1OEJA 1MX7A 4EQAC 1I05A 1DV9A 1SY1A 1A3YA 3BS2A 3P02A 1CBSA 3NX2A 2HLVA 3NQKA 3STMX 4U9CA 4QZTA 4IMOA 1X71A 1LIEA 4UU2A 2QO4A 3FMZA 2ACOA 5LJDA 2RN4A 1NGLA 1EW3A 3HWEA 4IB8A 4PJ2A 4OS0A 1T68X 5L8NA 2Z4IA 2GC9A 1FTPA 3BX8A 3TF6A 3OBLA 1YWCA 2X8TA 3BU1A 4ML7B 1NP1A 5HCEC 4M6SA 5HZ6A 4ZCBA 4QGXA 3FIQA 4NNTA 1T0VA 1B0OA 4GU8A 4IMNA 4MVEA 2LB6A 2XSTA 4U8UM 1E02A 3NPOA 2A3FX 3D96A 3O2YA 2QO6A 4O49A 4WBKA 3RBYA 3PH5A 4AW8A 2AL0X 2FS6A 2WSJA 2RA6A 4OMXA 4CV7A 5KIDA 3VG5A 4BVMA 5F7GA 3CQRA 2FT9A 3HWFA 4O3ZA 4YDAA 2QO5A 3S60A 4U8UN 1GGLA 3MX7A 3IA8A 3LHNA 1E00A 3KFGA 5H9NA 4NNSA 2MHDA 3BX7A 3KFIA 1JV4A 1BEBA 1FENA 3ELZA 3VU1A 2XKLA 3V8UA 1MVGA 1O1VA 4HFOA 1GT3A 4M7MA 1ERBA 1UREA 5JR8A 2FTBA 2L68A 3WBGA 5IO6A 4O4XA 5CE4A 3PQSA 4O4OA 2JW1A 1KGLA 2CM4A 3EBKA 3IFBA 3PPTA 1KXOA 4YKMA 1A18A 1DC9A 2AT0X 1GKAA 1DFVA 4ZR2A 2AT5X 5H9KA 3NP1A 5HZ5A 1KT4A 3S26A 2ALLX 3JQOA 5HAEA 2A13A 2BLGA 4I9SA 4AZRA 2GJ5A 1TOUA 5FQ6E 5B29A 2RD7C 1FE3A 1Y9LA 2G78A 2WQ9A 2MJIA 2Q2PA 4ORYA 3LV4A 1BWYA 1OPBA 4NW4A 4NLJA 5F1EA 5D45A 2X8SA 4KC8A 3STKA 3C78X 2RCTA 5HZQA 1IFBA 1LIDA 3KZAA 1X8UA 3APVA 5D8JA 1LF7A 4QZUA 5D48A 5AEOA 1X8PA 4YGHA 3EMMA 1EIIA 2A0AA 2CZUA 3B2JA 2KTSA 3O22A 1KT7A 4KT5A 2HZQA 4ZHGA 4RUUA 3CBCA 4HPBA 2W2AA 4AZOA 2F73A 3C77X 1E5PA 1QG5A 3SOTA 3DSZA 4UU3A 2MO5A 1A57A 1O1UA 3Q6LA 2AKQA 2Q39A 1G74A 4XMEA 1JIWI 5BYPA 3UEUA 5BVQA 4KCAA 1TOWA 4MIRA 4HPDA 3STNA 3NX1A 4NYQA 3L4RA 3U9PC 3BY0A 3FEKA 4IB7A 4LKPA 4FBRA 4FQBB 2OZQA 5AJBA 3FW4A 5FFHA 4I6SA 1S44A 4WFVA 1MUPA 2IFBA 4YFPA 3P6HA 4HPAA 4U8UO 3FA9A 5HBSA 1YP6A 2PY1A 5EPQA 5B27A 4A1HA 1ACDA 3BDRA 4WHIA 3EM0A 4YBUA 5DPQA 1CRBA 2MWHA 1R0UA 1VYGA 2QM9A 3U0DA 4LZUA 1JYDA 4JGLA 4AZQA 5C0NA 4GNWA 4FGIB 2FWVA 4ORXA 3ZWEA 4L1NA 4EXZA 1QQSA 3ZZVA 4PSQA 2E4JA 4KIIA 1IKJA 2X8FA 4GETA 1IIUA 4TJZA 3EBWA 3RWXA 1LPJA 2AT8X 3VE1A 4QGWA 4YFQA 4YBPA 3G7XA 4OS3A 3VG2A 1QABE 2WUTA 2BS6A 3O19A 5AJCA 2WWPA 1HBQA 2GTLM 3FYFA 4GK9A 4IABA 1BRQA 2JMBA 2ANSA 4ID2A 2WQAE 4I3DA 2K23A 1B56A 3B2IA 3HOLA 4D6AA 1ZRYA 2MM3A 4XMCA 1OBPA 2F09A 1PM1X 4WFUA 1LIFA 4OMWA 1JBHA 5LJEA 1QFVA 5FQ7E 1OEKA 2ASNX 1HQPA 1FEMA 3WVMA 1TW4A 3CBSA 1GT5A 1DZJA 2DM5A 5LJHA 2R73A 4FBVA 1EI5A 2OFMX 1RBPA 2JU3A 1GM6A 2KT4B 1LFOA 1ICNA 3WJFA 1BRPA 3UEXA 3D97A 1ICMA 4YCHA 5HA1A 4ZH9A 2HNXA 3ZW0A 1DZPA 2QOSC 1Z24A 4N7DA 1PMPA 4GZVA 1I4UA 3ZUIA 3JS1A 4L3RA 4LKTA 1ERXA 1ZNDA 4TQ2A 1ZNKA 1EPAA 4ALBA 4YDBA 3QKGA 1SY0A 1XCAA 3GAQA 3PECA 4BOEA 1BSOA 1AELA 4ZH6A 2FR3A 3BSZE 2OVAA 3HWDA 2YMSA 1IKEA 1MX8A 3NBXX 3NQ9A 3NQ3A 1CBQA 2Z4HA 2FRSA 3VG6A 1L6MA 1JYJA 3JSQA 1CBIA 3PEDA 3PQUA 4IB6A 1IFCA 1I04A 4ALOA 1S7DA 3BRNA 3B2LA 1QY1A 4NYRA 2K62A 2WR6A 4MISA 1QY0A 5H9AA 5HTDA 4D6BA 3ZW1A 5EEEA 3EYCA 3B2KA 3RSWA 1BSQA 1GKAB 2BS5A 4GNYA 1T8VA 3P6CA 1MDCA 4YKOA 3APUA 1HN2A 4OS8A 3E3CA 3KQ0A 4O3WA 4R0BA 5LJBA 5CYBA 1DF3A 2HYSA 2LA7A 3F9DA 2OVEA 4XMHA 5KHPA 4ON1A 4DQ3A 4MVIA 2AT3X 5F6BA 4ZHCA 1AVGI 2R56A 4CK4A 1ALBA 5IO5A 5HZ9A 1LIBA 3U03A 4LQZA 1KZXA 1O8VA 2LBAA 4IAXA 1U0XA 4ORWA 1KZWA 1U17A 3T1DA 1I06A 3CWKA 3ZW2A 4YH0A 2P8GA 5D4AA 3WJGA 2M4LA 1HMTA 3OJYC 3WXQA 2AH7X 2FS7A 1SY3A 1YWDA 1JJJA 2YG2A 1SXWA 1U18A 4ES7A 4IAWA 4AZMA 1DZKA 1KT5A 4ZGFA 2G79A 5HTEA 4IBAA 2FR2A 2ACPX 3FR2A 2GTLO 2POAA 1GX8A 2KTDA 4TNNA 3D95A 3S5VA 3CR6A 4XMFA 1BSYA 2Q9SA 1AQBA 5DG4A 1X8QA 4EDEA 1LKEA 5LJGA 2HMBA 4GH7A 2ZAIA 4TKHA 3OE3A 4K19A 2NNDA 1OEEA 2L5PA 2AT6X 1E06A 3P24A 1ZNGA 4MVLA 3CMPA 2NNEA 1EQDA 4YGZA 2W2BA 4Y0QA 4ZFXA 3F6ZB 1G7NA 1GX9A 1LNMA 4MVKA 2CM9A 2NP1A 2X46A 3F8AA 4I3CA 1VPRA 3HOEA 3HTYA 3ZUOA 1VYFA 3P6DA 3TGCA 3AKMA 4QYPA 4DQ4A 3APXA 1QFTA 1FDQA 1YIVA 3FA8A 1ZNLA 4ZHDA 4A60A 5EDBA 5LJKA 1KT6A 5BVSA 1DZMA 1EIOA 1BLRA 2GTFX 2L9CA 1A2DA 2CBSA 3WJBA 4HWMA 3MBTA 5HA0A 5FENA 3BU9A 5HWZA 4Y0PA 3WJDA 2GTLN 3PP6A 1G5WA 4I3BA 1EPBA 1SXXA 4ZHFA 2CZTA 1XKIA 3HWGA 4N7CA 5EDCA 3WOVA 4QGVA 1ZNEA 1UZ2X 3FLLA 5H8TA 1KQWA 2KW1A 3TGAA 2AMMX 4TKJA 3NR3A 2BHVA 4AZNA 3FA6A 4QRLA 1X8NA 3DTQA 4GE1A 1Y9TA 1X89A 2HZRA 3B2HA 3I0AA 3RZYA 5HCDC 1SXYA 4O3YA 5F6ZA 1SY2A 5LKFA 1RLBE 4YMYA 5LJCA 2WEXA 4O4SA 2O62A 1SMPI 4GKCA 5IO7A 1GT1A 3P6GA 3FENA 4IB9A 4BQUA 1BM5A 3OD9A 4Y0SA 1H91A 3RKGA 3WJEA 4QQ1A 4I95A 3VE2A 1EXSA 1AB0A 1NP4A 2EU7X 3FELA 3FW5A 2G7BA 3SAOA 4I9RA 3PH6A 4YGGA 3BLGA 3ZW0B 5H9LA 4YFRA 1QWDA 2L67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML7 A;  4ZJ0 A;  3C76 X;  4ORS A;  1ZNH A;  2Q2M A;  2JOZ A;  1SA8 A;  3MVF A;  1B8E A;  3ELX A;  1JZU A;  5BVT A;  1B4M A;  2JU7 A;  3TZS A;  1ADL A;  3KFF A;  4A1Y A;  1OPA A;  3KFH A;  5K06 A;  1OBU A;  4EFG A;  4RUN A;  1PEE A;  1CJ5 A;  1FEL A;  2FLJ A;  3VG3 A;  1CBR A;  2X45 A;  3FA7 A;  4ORU A;  3ZQ3 A;  5KIC A;  3UEV A;  2NNQ A;  3UEW A;  3NAD A;  1YWB A;  4LZV A;  2OVD A;  1GXA A;  5EZ2 A;  5L8O A;  1KQX A;  5FAZ A;  5L8I A;  1KT3 A;  4O9S A;  4ORR A;  4ZHH A;  2LBV A;  3APW A;  1YUP A;  2W2F A;  1YP7 A;  4A8Z A;  4QAE A;  3I17 A;  4TKB A;  1X8O A;  1HMR A;  5F58 A;  5HZ8 A;  1BBP A;  3AKN A;  5LKE A;  4ZGU A;  1JJX A;  4GRJ A;  5EED A;  1EAL A;  4ARH A;  1LIC A;  1S2P A;  4QYN A;  1D2U A;  2Q4N A;  2JU8 A;  1G85 A;  1KOI A;  2N93 A;  4Y0R A;  3WJC A;  1EUO A;  2WEW A;  2OFR X;  1HBP A;  1HMS A;  3TGB A;  2A2G A;  1P6P A;  5D47 A;  1BJ7 A;  3HK1 A;  4NLI A;  4ODD A;  3FEP A;  1TXL A;  5HCC C;  4TLJ A;  2LFO A;  3VG4 A;  1QY2 A;  2RQ0 A;  2CBR A;  1TVQ A;  3CQN A;  4YCE A;  3VG7 A;  2A2U A;  4AZP A;  4EEJ A;  5AQ6 A;  1IW2 A;  3P6F A;  3FR4 A;  1PBO A;  1D3S A;  3P6E A;  1GT4 A;  1N0S A;  2RCQ A;  4XMD A;  1YWA A;  4HPC A;  4AYH A;  2LKK A;  2R74 A;  3FR5 A;  2JN3 A;  1SXU A;  4XMG A;  1OBQ A;  3K3L A;  4NP1 A;  1OEJ A;  1MX7 A;  1I05 A;  1DV9 A;  1SY1 A;  1A3Y A;  3BS2 A;  1CBS A;  3NX2 A;  2HLV A;  3STM X;  4QZT A;  4IMO A;  1X71 A;  1LIE A;  4UU2 A;  2QO4 A;  3FMZ A;  2ACO A;  5LJD A;  1NGL A;  1EW3 A;  3HWE A;  4IB8 A;  4OS0 A;  1T68 X;  5L8N A;  2GC9 A;  1FTP A;  3BX8 A;  3TF6 A;  1YWC A;  3BU1 A;  1NP1 A;  5HCE C;  4M6S A;  5HZ6 A;  4ZCB A;  4QGX A;  3FIQ A;  4NNT A;  1T0V A;  1B0O A;  4IMN A;  2LB6 A;  2XST A;  1E02 A;  3NPO A;  2A3F X;  3D96 A;  3O2Y A;  2QO6 A;  4WBK A;  4AW8 A;  3PH5 A;  2AL0 X;  2FS6 A;  2WSJ A;  2RA6 A;  4OMX A;  5KID A;  3VG5 A;  4BVM A;  5F7G A;  3CQR A;  2FT9 A;  3HWF A;  4YDA A;  2QO5 A;  1GGL A;  3IA8 A;  1E00 A;  3KFG A;  5H9N A;  4NNS A;  3BX7 A;  3KFI A;  1JV4 A;  1BEB A;  1FEN A;  3ELZ A;  2XKL A;  1MVG A;  1O1V A;  4HFO A;  1GT3 A;  4M7M A;  1ERB A;  1URE A;  5JR8 A;  2FTB A;  2L68 A;  3WBG A;  5IO6 A;  5CE4 A;  1KGL A;  2CM4 A;  3EBK A;  3IFB A;  3PPT A;  1KXO A;  4YKM A;  1A18 A;  1DC9 A;  2AT0 X;  1GKA A;  1DFV A;  4ZR2 A;  2AT5 X;  5H9K A;  3NP1 A;  5HZ5 A;  1KT4 A;  3S26 A;  2ALL X;  5HAE A;  2A13 A;  2BLG A;  4I9S A;  4AZR A;  2GJ5 A;  1TOU A;  5B29 A;  2RD7 C;  1FE3 A;  2G78 A;  2WQ9 A;  2MJI A;  2Q2P A;  4ORY A;  1BWY A;  1OPB A;  4NLJ A;  5F1E A;  5D45 A;  3STK A;  3C78 X;  2RCT A;  5HZQ A;  1IFB A;  1LID A;  3KZA A;  1X8U A;  3APV A;  5D8J A;  1LF7 A;  4QZU A;  5D48 A;  1X8P A;  4YGH A;  3EMM A;  1EII A;  2A0A A;  2CZU A;  3B2J A;  3O22 A;  1KT7 A;  2HZQ A;  4ZHG A;  4RUU A;  3CBC A;  4HPB A;  2W2A A;  4AZO A;  2F73 A;  3C77 X;  1E5P A;  1QG5 A;  3DSZ A;  4UU3 A;  2MO5 A;  1A57 A;  1O1U A;  3Q6L A;  2AKQ A;  2Q39 A;  1G74 A;  4XME A;  3UEU A;  5BVQ A;  1TOW A;  3STN A;  4HPD A;  3NX1 A;  4NYQ A;  3L4R A;  3U9P C;  3BY0 A;  3FEK A;  4IB7 A;  4LKP A;  2OZQ A;  3FW4 A;  5FFH A;  1S44 A;  4WFV A;  1MUP A;  2IFB A;  4YFP A;  3P6H A;  4HPA A;  3FA9 A;  5HBS A;  1YP6 A;  2PY1 A;  5EPQ A;  5B27 A;  4A1H A;  1ACD A;  3BDR A;  3EM0 A;  4YBU A;  5DPQ A;  1CRB A;  1R0U A;  1VYG A;  2QM9 A;  3U0D A;  4LZU A;  1JYD A;  4AZQ A;  5C0N A;  4GNW A;  4ORX A;  2FWV A;  4EXZ A;  1QQS A;  4PSQ A;  2E4J A;  4KII A;  1IKJ A;  4GET A;  1IIU A;  4TJZ A;  3EBW A;  1LPJ A;  2AT8 X;  4QGW A;  4YFQ A;  4YBP A;  3G7X A;  4OS3 A;  3VG2 A;  1QAB E;  2WUT A;  3O19 A;  2WWP A;  1HBQ A;  1BRQ A;  2ANS A;  2WQA E;  4I3D A;  2K23 A;  1B56 A;  3B2I A;  4D6A A;  1ZRY A;  2MM3 A;  4XMC A;  1OBP A;  1PM1 X;  4WFU A;  1LIF A;  4OMW A;  1JBH A;  5LJE A;  1QFV A;  1OEK A;  2ASN X;  1HQP A;  1FEM A;  3WVM A;  1TW4 A;  3CBS A;  1GT5 A;  1DZJ A;  2DM5 A;  5LJH A;  2R73 A;  2OFM X;  1RBP A;  2JU3 A;  1GM6 A;  2KT4 B;  1LFO A;  1ICN A;  3WJF A;  1BRP A;  3UEX A;  3D97 A;  1ICM A;  4YCH A;  5HA1 A;  4ZH9 A;  2HNX A;  1DZP A;  2QOS C;  1Z24 A;  4N7D A;  1PMP A;  1I4U A;  3ZUI A;  3JS1 A;  4LKT A;  1ERX A;  1ZND A;  4TQ2 A;  1ZNK A;  1EPA A;  4ALB A;  4YDB A;  3QKG A;  1SY0 A;  1XCA A;  3GAQ A;  3PEC A;  4BOE A;  1BSO A;  1AEL A;  4ZH6 A;  2FR3 A;  3BSZ E;  2OVA A;  3HWD A;  1IKE A;  1MX8 A;  3NQ9 A;  3NQ3 A;  1CBQ A;  2FRS A;  3VG6 A;  1L6M A;  1JYJ A;  3JSQ A;  1CBI A;  3PED A;  4IB6 A;  1IFC A;  1I04 A;  4ALO A;  1S7D A;  3BRN A;  3B2L A;  1QY1 A;  4NYR A;  2K62 A;  2WR6 A;  1QY0 A;  5H9A A;  5HTD A;  4D6B A;  5EEE A;  3EYC A;  3B2K A;  3RSW A;  1BSQ A;  1GKA B;  4GNY A;  1T8V A;  3P6C A;  1MDC A;  4YKO A;  3APU A;  1HN2 A;  4OS8 A;  3KQ0 A;  4R0B A;  5LJB A;  1DF3 A;  2HYS A;  4XMH A;  3F9D A;  2OVE A;  5KHP A;  4DQ3 A;  4MVI A;  2AT3 X;  5F6B A;  4ZHC A;  1AVG I;  2R56 A;  4CK4 A;  1ALB A;  5IO5 A;  5HZ9 A;  1LIB A;  3U03 A;  1KZX A;  1O8V A;  2LBA A;  4IAX A;  1U0X A;  4ORW A;  1KZW A;  1U17 A;  3T1D A;  1I06 A;  3CWK A;  4YH0 A;  2P8G A;  5D4A A;  3WJG A;  1HMT A;  3OJY C;  3WXQ A;  2AH7 X;  2FS7 A;  1SY3 A;  1YWD A;  1JJJ A;  2YG2 A;  1SXW A;  1U18 A;  4ES7 A;  4IAW A;  4AZM A;  1DZK A;  1KT5 A;  2G79 A;  5HTE A;  4IBA A;  2FR2 A;  2ACP X;  3FR2 A;  2POA A;  1GX8 A;  2KTD A;  4TNN A;  3D95 A;  3CR6 A;  4XMF A;  1BSY A;  2Q9S A;  1AQB A;  5DG4 A;  1X8Q A;  4EDE A;  1LKE A;  5LJG A;  2HMB A;  4GH7 A;  4TKH A;  4K19 A;  2NND A;  1OEE A;  2L5P A;  2AT6 X;  1E06 A;  1ZNG A;  4MVL A;  3CMP A;  2NNE A;  1EQD A;  4YGZ A;  2W2B A;  4Y0Q A;  4ZFX A;  1G7N A;  1GX9 A;  1LNM A;  4MVK A;  2CM9 A;  2NP1 A;  2X46 A;  3F8A A;  4I3C A;  1VPR A;  3ZUO A;  1VYF A;  3P6D A;  3TGC A;  3AKM A;  4QYP A;  4DQ4 A;  3APX A;  1QFT A;  1FDQ A;  1YIV A;  3FA8 A;  1ZNL A;  4ZHD A;  4A60 A;  5EDB A;  5LJK A;  1KT6 A;  5BVS A;  1DZM A;  1EIO A;  1BLR A;  2GTF X;  2L9C A;  1A2D A;  2CBS A;  3WJB A;  5FEN A;  3MBT A;  5HA0 A;  3BU9 A;  5HWZ A;  4Y0P A;  3WJD A;  3PP6 A;  1G5W A;  4I3B A;  1EPB A;  1SXX A;  4ZHF A;  2CZT A;  1XKI A;  3HWG A;  4N7C A;  5EDC A;  4QGV A;  1ZNE A;  1UZ2 X;  3FLL A;  5H8T A;  1KQW A;  3TGA A;  2AMM X;  4TKJ A;  3NR3 A;  4AZN A;  3FA6 A;  1X8N A;  3DTQ A;  4GE1 A;  3RZY A;  1X89 A;  2HZR A;  3B2H A;  3I0A A;  5HCD C;  1SXY A;  5F6Z A;  1SY2 A;  5LKF A;  1RLB E;  4YMY A;  5LJC A;  2WEX A;  2O62 A;  4GKC A;  5IO7 A;  1GT1 A;  3P6G A;  3FEN A;  4IB9 A;  4BQU A;  1BM5 A;  4Y0S A;  1H91 A;  3WJE A;  1EXS A;  1AB0 A;  1NP4 A;  2EU7 X;  3FEL A;  3FW5 A;  2G7B A;  3SAO A;  4I9R A;  3PH6 A;  4YGG A;  3BLG A;  5H9L A;  4YFR A;  1QWD A;  2L67 A; 
#chains in the Genus database with same CATH topology
 1ML7 A;  4ZJ0 A;  3C76 X;  3GE2 A;  2C1Q A;  4ORS A;  4INN A;  1ZNH A;  2Q2M A;  2JOZ A;  1NDJ A;  1SA8 A;  1SWL A;  4GD9 A;  1SWF A;  3MVF A;  1B8E A;  3ELX A;  1JZU A;  4JHQ A;  4Z2P A;  5BVT A;  1B4M A;  2JU7 A;  3TZS A;  1ADL A;  3KFF A;  4A1Y A;  4BX7 A;  1OPA A;  3KFH A;  5K06 A;  1OBU A;  3AEH A;  4EFG A;  4RUN A;  1SLE B;  2QCB A;  1PEE A;  1CJ5 A;  2RTC B;  1FEL A;  2FLJ A;  3VG3 A;  1CBR A;  1MEP A;  4JO6 A;  4BGF A;  2X45 A;  3FA7 A;  4ORU A;  1IJ8 A;  3ZQ3 A;  5KIC A;  3UEV A;  2NNQ A;  3UEW A;  3D4R A;  4DNE A;  2DJF A;  1YWB A;  3NAD A;  4LZV A;  2OVD A;  1GXA A;  3RDM A;  5EZ2 A;  5L8O A;  1KQX A;  5FAZ A;  5L8I A;  4Z28 A;  1KT3 A;  2QMI A;  2RTB B;  3UAQ A;  2IZG B;  4O9S A;  4ORR A;  2X34 A;  1SWD A;  3ZW1 B;  1KL3 A;  4CSB A;  4ZHH A;  2LBV A;  4O4U A;  2BT9 A;  3APW A;  1YUP A;  2W2F A;  4JNJ A;  1YP7 A;  4KC7 A;  4A8Z A;  4QAE A;  3I17 A;  4QNI A;  1X8O A;  4TKB A;  1HMR A;  5F58 A;  3VHM A;  5HZ8 A;  1BBP A;  3AKN A;  5IRA A;  3RE5 A;  5LKE A;  4ZGU A;  1JJX A;  4GRJ A;  5EED A;  1EAL A;  2IZC B;  4ARH A;  3S5X A;  2OF8 A;  1LIC A;  1SRF A;  1S2P A;  4QYN A;  5FQ8 E;  1D2U A;  1HXL A;  2Q4N A;  2JU8 A;  1G85 A;  1KOI A;  1Y53 X;  2N93 A;  1SWE A;  1EUO A;  2WEW A;  3D9W A;  3FDC A;  4O3X B;  4Y0R A;  2OFR X;  1N9Y A;  1WBI A;  1VWC B;  2PI3 O;  4B55 A;  1HBP A;  1HMS A;  3TGB A;  1SWU A;  2A2G A;  4Z2V A;  1P6P A;  5D47 A;  2VFC A;  3WYQ A;  1BJ7 A;  4CPF A;  3HK1 A;  4Z2O A;  2KD2 A;  4NLI A;  2OY5 O;  4ODD A;  4U46 A;  3FEP A;  1TXL A;  5HCC C;  4TLJ A;  2LFO A;  3VG4 A;  1QY2 A;  2CBR A;  2RQ0 A;  1TVQ A;  3ZI8 A;  3CQN A;  4YCE A;  4FBO A;  2OVS A;  4GUZ A;  1SWO A;  2A2U A;  3VG7 A;  1LCZ A;  1LUQ A;  5AQ6 A;  1IW2 A;  3P6F A;  3VPJ E;  4AZP A;  3H3I A;  3FR4 A;  1PBO A;  1D3S A;  4COT A;  3P6E A;  1KFF A;  1SRH A;  2RTM A;  3N91 A;  4KH8 A;  1SRJ A;  5B5G A;  1GT4 A;  1N0S A;  2RCQ A;  2X32 A;  4GDZ A;  4XMD A;  1YWA A;  2RTF B;  4HPC A;  4AYH A;  2LKK A;  2R74 A;  1VWD B;  2ZAG A;  3FR5 A;  4U3Q A;  2JN3 A;  5B3M O;  1SXU A;  1VWG B;  4XMG A;  4Z27 A;  1OBQ A;  3K3L A;  4IRW A;  5B2A O;  4NP1 A;  1OEJ A;  1MX7 A;  4EQA C;  1I05 A;  1AVE A;  2ZSC A;  1DV9 A;  1SY1 A;  1A3Y A;  3RY2 A;  3BS2 A;  4YKO A;  3P02 A;  1CBS A;  3NX2 A;  2HLV A;  3NQK A;  3STM X;  4U9C A;  4QZT A;  4IMO A;  1X71 A;  1LIE A;  1JMZ A;  4UU2 A;  2QO4 A;  3FMZ A;  2ACO A;  5LJD A;  2RN4 A;  1NGL A;  1EW3 A;  3HWE A;  1VWO B;  4CDE A;  1VWJ B;  3WJC A;  4IB8 A;  4GJV A;  4PJ2 A;  4OS0 A;  1T68 X;  5L8N A;  2Z4I A;  2GC9 A;  1FTP A;  3BX8 A;  3TF6 A;  1FJ1 E;  3OBL A;  1YWC A;  2FHN X;  2X8T A;  1VWF B;  1NP1 A;  3BU1 A;  4ML7 B;  2F01 A;  5HCE C;  4M6S A;  5HZ6 A;  4ZCB A;  1RXJ A;  4QGX A;  3FIQ A;  1HQQ A;  4NNT A;  1T0V A;  4GGZ A;  1B0O A;  4GU8 A;  4IMN A;  3RDS A;  4MVE A;  2LB6 A;  2FKJ A;  2X55 A;  2XST A;  4U8U M;  1E02 A;  3NPO A;  2A3F X;  3D96 A;  3O2Y A;  2QO6 A;  4O49 A;  4WBK A;  3RBY A;  3PH5 A;  4AW8 A;  2AL0 X;  2FS6 A;  2WSJ A;  1RXK A;  1SWS A;  2DJG A;  2RA6 A;  1RST B;  1VWA B;  4OMX A;  4C5P A;  4CV7 A;  2IZK A;  5KID A;  3VG5 A;  4BVM A;  2FKG A;  4BX6 B;  5F7G A;  3CQR A;  1SWP A;  2FT9 A;  3HWF A;  4O3Z A;  4YDA A;  2QO5 A;  3S60 A;  4U8U N;  1GGL A;  3MX7 A;  1SWH A;  1SRE A;  3IA8 A;  5B10 O;  2X4M A;  3LHN A;  1E00 A;  3KFG A;  5H9N A;  4BJ8 A;  2G5L A;  4OEL A;  4NNS A;  2MHD A;  3AUM O;  4CPH A;  3BX7 A;  3KFI A;  1JV4 A;  1W5R A;  1BEB A;  3WZO A;  1FEN A;  3ELZ A;  3VU1 A;  2XKL A;  2X56 A;  1VWB B;  3V8U A;  1MVG A;  1O1V A;  4HFO A;  1JMX A;  1SWQ A;  1GT3 A;  4M7M A;  1ERB A;  1URE A;  5JR8 A;  3SZI A;  2FTB A;  4MEE A;  3T2W A;  2L68 A;  3WBG A;  1VWI B;  5IO6 A;  4O4X A;  5CE4 A;  3PQS A;  4O4O A;  2JW1 A;  5L3Y A;  1KGL A;  2CM4 A;  2IZL B;  1LCW A;  3EBK A;  3IFB A;  3PPT A;  1KXO A;  3UEU A;  4YKM A;  1A18 A;  1DC9 A;  2AT0 X;  4GGR A;  1GKA A;  4BX7 B;  1DFV A;  4ZR2 A;  2AT5 X;  5H9K A;  1RSU B;  3NP1 A;  3SZJ A;  5HZ5 A;  1KT4 A;  3S26 A;  2ALL X;  3JQO A;  5HAE A;  2A13 A;  1K3B A;  2BLG A;  4I9S A;  4AZR A;  1N4J A;  2GJ5 A;  1TOU A;  5FQ6 E;  5B29 A;  2RD7 C;  2VDF A;  1FE3 A;  1VWH B;  1Y9L A;  1N43 A;  5K67 A;  2G78 A;  2WQ9 A;  3FID A;  2MJI A;  2Q2P A;  2RTO B;  4Y59 A;  4ORY A;  3LV4 A;  5B11 O;  1BWY A;  1OPB A;  3EW2 A;  4NW4 A;  4NLJ A;  4NV8 A;  3SLJ A;  5F1E A;  5D45 A;  2X8S A;  4KC8 A;  3STK A;  2I5Z O;  3C78 X;  2RCT A;  5HZQ A;  1IFB A;  1LID A;  3KZA A;  1X8U A;  3APV A;  5D8J A;  1MK5 A;  1LF7 A;  4QZU A;  5D48 A;  5AEO A;  1X8P A;  4YGH A;  3EMM A;  1EII A;  2A0A A;  2CZU A;  3B2J A;  2KTS A;  3O22 A;  1KT7 A;  4KT5 A;  3RE6 A;  2HZQ A;  5IRU A;  4ZHG A;  3PDF A;  4RUU A;  3CBC A;  4HPB A;  2W2A A;  4AZO A;  2F73 A;  3C77 X;  1E5P A;  1QG5 A;  3SOT A;  2BC3 A;  3DSZ A;  4UU3 A;  1K24 A;  2MO5 A;  3RDX A;  3WZQ A;  3WZP A;  1O1U A;  3Q6L A;  1A57 A;  2AKQ A;  5IRW A;  2Q39 A;  2C4I A;  3RDO A;  1G74 A;  4XME A;  1JIW I;  5BYP A;  2JGS A;  5BVQ A;  2QOM A;  2RTG B;  4KCA A;  1TOW A;  2RTQ B;  4HPD A;  4MIR A;  3STN A;  4CDC A;  3NX1 A;  4NYQ A;  3L4R A;  3U9P C;  5B5F A;  3Q34 A;  3BY0 A;  3FEK A;  4IB7 A;  4LKP A;  4FBR A;  4CDD A;  2OF9 A;  4FQB B;  2OZQ A;  1MM9 A;  5AJB A;  2RTH B;  1NBX A;  3FW4 A;  5FFH A;  4I6S A;  1DF8 A;  1LEL A;  1S44 A;  1SWC A;  1VYO A;  1MUP A;  2IFB A;  4WFV A;  3P6H A;  4HPA A;  4YFP A;  4U8U O;  3FA9 A;  5HBS A;  1JJU A;  1YP6 A;  2RTE B;  2PY1 A;  4OKA A;  5EPQ A;  2OL8 O;  5B27 A;  4A1H A;  1ACD A;  3BDR A;  4WHI A;  2IZH B;  3EM0 A;  4YBU A;  5F2B A;  5DPQ A;  1N9M A;  1CRB A;  2MWH A;  1R0U A;  1VYG A;  1SLG B;  2QM9 A;  1STP A;  3U0D A;  4LZU A;  1JYD A;  2RTA A;  4JGL A;  4AZQ A;  4GNW A;  2IZF B;  5C0N A;  4FGI B;  2FWV A;  4ORX A;  3ZWE A;  4L1N A;  4EXZ A;  1QQS A;  3VGW A;  3ZZV A;  1Y0G A;  4PSQ A;  2E4J A;  3T6F A;  4KII A;  1IKJ A;  2X8F A;  4GET A;  1IIU A;  4TJZ A;  3EBW A;  3RWX A;  1LPJ A;  2AT8 X;  3VE1 A;  4QGW A;  4YFQ A;  4YBP A;  3G7X A;  4OS3 A;  3VG2 A;  1QAB E;  1SRG A;  2WUT A;  1UYO X;  2BS6 A;  3O19 A;  5AJC A;  2WWP A;  1HBQ A;  2GTL M;  3FYF A;  4GK9 A;  4IAB A;  1BRQ A;  5CSE A;  3RDU A;  2JMB A;  4ZH6 A;  2ANS A;  4ID2 A;  2WQA E;  4I3D A;  1Y52 X;  2K23 A;  1B56 A;  3B2I A;  3HOL A;  1NC9 A;  4D6A A;  1ZRY A;  2MM3 A;  1VWR B;  4GGT A;  4XMC A;  1OBP A;  1SLD B;  1PM1 X;  2F09 A;  3EC5 A;  1GX3 A;  4WFU A;  1LIF A;  4OMW A;  1JBH A;  5LJE A;  1QFV A;  5FQ7 E;  1OEK A;  2ASN X;  1HQP A;  4GDA A;  1PTS A;  1FEM A;  3WVM A;  1TW4 A;  4BX5 A;  3CBS A;  1GT5 A;  1DZJ A;  2DM5 A;  2RTK A;  1I78 A;  2R73 A;  4FBV A;  3WYP A;  5LJH A;  1EI5 A;  2OFM X;  1RBP A;  1VWL B;  1GM6 A;  2JU3 A;  2KT4 B;  1LDQ A;  1ICN A;  1LFO A;  1KL4 A;  1BRP A;  2RTL A;  3UEX A;  3D97 A;  3WJF A;  1ICM A;  1SWB A;  4YCH A;  5HA1 A;  4ZH9 A;  2HNX A;  2MF6 A;  4Y5D A;  3ZW0 A;  1DZP A;  2QOS C;  1Z24 A;  4N7D A;  1PMP A;  4GZV A;  1I4U A;  3ZUI A;  3JS1 A;  4L3R A;  4LKT A;  1ERX A;  1ZND A;  4TQ2 A;  1ZNK A;  2UZ2 A;  1EPA A;  4ALB A;  4YDB A;  3QKG A;  1JQP A;  1SY0 A;  1XCA A;  3GAQ A;  3X00 A;  3PEC A;  2FHL A;  3EW1 A;  4BOE A;  2Y3F A;  2WPU A;  1SWK A;  1BSO A;  1AEL A;  2OL7 A;  3CKG A;  2FR3 A;  1HY2 A;  1RXH A;  2OVA A;  3BSZ E;  1LDO A;  3HWD A;  2IZD B;  1SWN A;  2Y3E A;  3HPE A;  2YMS A;  4CPH B;  1IKE A;  2OFA A;  1MX8 A;  3NBX X;  3NQ9 A;  3SZH A;  1SLF B;  3NQ3 A;  1CBQ A;  3SLO A;  2Z4H A;  2FRS A;  3VG6 A;  1L6M A;  2A5C A;  1JYJ A;  3JSQ A;  1CBI A;  3PED A;  3PQU A;  3RY1 A;  1PBY A;  1MOY A;  4IB6 A;  1IFC A;  1I04 A;  1UYN X;  1S7D A;  3CKF A;  3BRN A;  4ALO A;  5IXG A;  3B2L A;  5JD2 A;  3RDQ A;  3PK2 A;  1QY1 A;  4NYR A;  2K62 A;  2WR6 A;  4MIS A;  1QY0 A;  5H9A A;  3WZN A;  5HTD A;  4D6B A;  2OY7 A;  3ZW1 A;  5EEE A;  3EYC A;  3B2K A;  3RSW A;  1BSQ A;  2OYB O;  1GKA B;  2BS5 A;  4GNY A;  1T8V A;  2IZJ A;  2RTR B;  2I5V O;  3P6C A;  1MDC A;  2CAM A;  1I9H A;  1HN2 A;  1SWJ A;  2IZE B;  3APU A;  3E3C A;  3KQ0 A;  4O3W A;  4OS8 A;  4R0B A;  5LJB A;  5CYB A;  1DF3 A;  2HYS A;  2LA7 A;  3F9D A;  1AVD A;  2OVE A;  4XMH A;  5KHP A;  4ON1 A;  2FGS A;  4DQ3 A;  2Y32 A;  4MVI A;  1HXZ A;  2AT3 X;  4OEM A;  5F6B A;  4ZHC A;  1AVG I;  2A5B A;  2R56 A;  4CK4 A;  1ALB A;  5IO5 A;  5HZ9 A;  3T6L A;  3MM0 A;  1LIB A;  3U03 A;  4LQZ A;  1KZX A;  1O8V A;  4GJS A;  2LBA A;  2RTI B;  3KVN A;  1U0X A;  4IAX A;  4ORW A;  1U17 A;  2IZA A;  4DCB A;  1KZW A;  3T1D A;  1I06 A;  3CWK A;  5CHK A;  1KL5 A;  3ZW2 A;  4YH0 A;  4BCS A;  2G8C O;  2P8G A;  5D4A A;  3WJG A;  2M4L A;  1HMT A;  3OJY C;  3WXQ A;  2AH7 X;  2FS7 A;  1SY3 A;  1YWD A;  3VHH A;  2YG2 A;  1JJJ A;  1SXW A;  2IZB A;  1U18 A;  4ES7 A;  1STR B;  4IAW A;  4AZM A;  1DZK A;  2IZI A;  1KT5 A;  4ZGF A;  2G79 A;  5HTE A;  1VWE B;  1OSP O;  2FR2 A;  1W6F A;  1SWT A;  2ACP X;  3FR2 A;  4IBA A;  2GTL O;  2POA A;  1GX8 A;  4CPI A;  2OY1 O;  2KTD A;  4TNN A;  3D95 A;  3S5V A;  3CR6 A;  4XMF A;  2C1S A;  1BSY A;  1SWA A;  1AQB A;  2Q9S A;  1X8Q A;  5DG4 A;  2HKD A;  4EDE A;  1LKE A;  5LJG A;  2HMB A;  4GH7 A;  3T2X A;  2ZAI A;  4TKH A;  3OE3 A;  4K19 A;  2NND A;  1NQM A;  1OEE A;  2L5P A;  2AT6 X;  1E06 A;  2OFB A;  3P24 A;  1ZNG A;  1W4T A;  3CMP A;  2NNE A;  4MVL A;  2AF5 A;  4YVB A;  1EQD A;  4NV7 A;  4YGZ A;  2OY8 A;  2W2B A;  4Y0Q A;  4ZFX A;  3F6Z B;  1G7N A;  1GX9 A;  1LNM A;  4MVK A;  2CM9 A;  2NP1 A;  2X46 A;  1SWG A;  1RAV A;  3F8A A;  4I3C A;  1VPR A;  4I60 A;  3HOE A;  3HTY A;  3ZUO A;  2VFB A;  1VYF A;  3P6D A;  3TGC A;  3AKM A;  2RTJ A;  4QYP A;  4DQ4 A;  3APX A;  1QFT A;  1FDQ A;  1YIV A;  3FA8 A;  3VHI A;  1ZNL A;  1STS B;  4ZHD A;  4BBO A;  1SRI A;  1N7Y A;  5EDB A;  4A60 A;  5LJK A;  1KT6 A;  5BVS A;  1VWQ B;  1Y55 X;  1DZM A;  1WUB A;  1EIO A;  3MG5 A;  2GTF X;  1BLR A;  2L9C A;  1A2D A;  4Z6J A;  2CBS A;  3WJB A;  4HWM A;  3MBT A;  5HA0 A;  5FEN A;  1VWM B;  5K68 A;  3BU9 A;  5HWZ A;  4Y0P A;  3WJD A;  1NQN A;  4CPE A;  2GTL N;  3QQ2 A;  3PP6 A;  1G5W A;  4I3B A;  1EPB A;  2OL6 O;  1SXX A;  4ZHF A;  2CZT A;  1XKI A;  3HWG A;  4N7C A;  5EDC A;  3WOV A;  4QGV A;  1ZNE A;  1UZ2 X;  3FLL A;  3SLT A;  2UYW A;  5H8T A;  1KQW A;  2KW1 A;  3TGA A;  2AMM X;  4TKJ A;  3NR3 A;  1LCV A;  2AVI A;  2GH7 A;  2BHV A;  4AZN A;  3FA6 A;  2RTN B;  4QRL A;  1X8N A;  3DTQ A;  4GE1 A;  1Y9T A;  1X89 A;  2HZR A;  3B2H A;  3I0A A;  3RZY A;  5HCD C;  1SXY A;  4O3Y A;  5F6Z A;  4BX6 A;  1SY2 A;  3LTW A;  5LKF A;  1RLB E;  4YMY A;  5LJC A;  2WEX A;  1VWN B;  4O4S A;  2RTD B;  2O62 A;  1SMP I;  4GKC A;  1VWK B;  4EKV A;  5IO7 A;  1GT1 A;  2A8G A;  3P6G A;  3FEN A;  4IB9 A;  1SWR A;  4BQU A;  1BM5 A;  1E2T A;  2BSZ A;  3OD9 A;  1H91 A;  4Y0S A;  3RKG A;  4BX5 B;  4EEJ A;  3WJE A;  4QQ1 A;  4I95 A;  3VE2 A;  1EXS A;  1AB0 A;  1NP4 A;  2EU7 X;  3FEL A;  3FW5 A;  2G7B A;  2RTP B;  4CDF A;  3SAO A;  4I9R A;  3PH6 A;  4YGG A;  1VWP B;  3BLG A;  3ZW0 B;  5H9L A;  4YFR A;  1QWD A;  2L67 A; 
#chains in the Genus database with same CATH homology
 1ML7 A;  4ZJ0 A;  3C76 X;  3GE2 A;  4ORS A;  4INN A;  1ZNH A;  2Q2M A;  2JOZ A;  1SA8 A;  3MVF A;  1B8E A;  3ELX A;  1JZU A;  5BVT A;  1B4M A;  2JU7 A;  3TZS A;  1ADL A;  3KFF A;  4A1Y A;  1OPA A;  3KFH A;  5K06 A;  1OBU A;  4EFG A;  4RUN A;  1PEE A;  1CJ5 A;  1FEL A;  2FLJ A;  3VG3 A;  1CBR A;  2X45 A;  3FA7 A;  4ORU A;  3ZQ3 A;  5KIC A;  3UEV A;  2NNQ A;  3UEW A;  3D4R A;  3NAD A;  1YWB A;  4LZV A;  2OVD A;  1GXA A;  5EZ2 A;  5L8O A;  1KQX A;  5FAZ A;  5L8I A;  1KT3 A;  2QMI A;  3UAQ A;  4O9S A;  4ORR A;  3ZW1 B;  4CSB A;  4ZHH A;  2LBV A;  4O4U A;  2BT9 A;  3APW A;  1YUP A;  2W2F A;  4KC7 A;  1YP7 A;  4A8Z A;  4QAE A;  3I17 A;  4QNI A;  1X8O A;  4TKB A;  1HMR A;  5F58 A;  5HZ8 A;  1BBP A;  3AKN A;  5LKE A;  4ZGU A;  1JJX A;  4GRJ A;  5EED A;  1EAL A;  4ARH A;  3S5X A;  1LIC A;  1S2P A;  4QYN A;  5FQ8 E;  1D2U A;  2Q4N A;  2JU8 A;  1G85 A;  1KOI A;  2N93 A;  4Y0R A;  3WJC A;  1EUO A;  2WEW A;  4O3X B;  2OFR X;  1HBP A;  1HMS A;  3TGB A;  2A2G A;  1P6P A;  5D47 A;  1BJ7 A;  3HK1 A;  2KD2 A;  4NLI A;  4ODD A;  3FEP A;  1TXL A;  5HCC C;  4TLJ A;  2LFO A;  3VG4 A;  1QY2 A;  2CBR A;  2RQ0 A;  1TVQ A;  3ZI8 A;  3CQN A;  4YCE A;  4FBO A;  2OVS A;  3VG7 A;  2A2U A;  3VPJ E;  4AZP A;  4EEJ A;  5AQ6 A;  1IW2 A;  3P6F A;  3H3I A;  3FR4 A;  1PBO A;  1D3S A;  4COT A;  3P6E A;  3N91 A;  4KH8 A;  1GT4 A;  1N0S A;  2RCQ A;  4GDZ A;  4XMD A;  1YWA A;  4HPC A;  4AYH A;  2LKK A;  2R74 A;  2ZAG A;  3FR5 A;  4U3Q A;  2JN3 A;  1SXU A;  4XMG A;  1OBQ A;  3K3L A;  4NP1 A;  1OEJ A;  1MX7 A;  4EQA C;  1I05 A;  1DV9 A;  1SY1 A;  1A3Y A;  3BS2 A;  3P02 A;  1CBS A;  3NX2 A;  2HLV A;  3NQK A;  3STM X;  4U9C A;  4QZT A;  4IMO A;  1X71 A;  1LIE A;  4UU2 A;  2QO4 A;  3FMZ A;  2ACO A;  5LJD A;  2RN4 A;  1NGL A;  1EW3 A;  3HWE A;  4IB8 A;  4PJ2 A;  4OS0 A;  1T68 X;  5L8N A;  2Z4I A;  2GC9 A;  1FTP A;  3BX8 A;  3TF6 A;  3OBL A;  1YWC A;  2X8T A;  3BU1 A;  4ML7 B;  1NP1 A;  5HCE C;  4M6S A;  5HZ6 A;  4ZCB A;  4QGX A;  3FIQ A;  4NNT A;  1T0V A;  1B0O A;  4GU8 A;  4IMN A;  4MVE A;  2LB6 A;  2XST A;  4U8U M;  1E02 A;  3NPO A;  2A3F X;  3D96 A;  3O2Y A;  2QO6 A;  4O49 A;  4WBK A;  3RBY A;  3PH5 A;  4AW8 A;  2AL0 X;  2FS6 A;  2WSJ A;  2RA6 A;  4OMX A;  4CV7 A;  5KID A;  3VG5 A;  4BVM A;  5F7G A;  3CQR A;  2FT9 A;  3HWF A;  4O3Z A;  4YDA A;  2QO5 A;  3S60 A;  4U8U N;  1GGL A;  3MX7 A;  3IA8 A;  3LHN A;  1E00 A;  3KFG A;  5H9N A;  4NNS A;  2MHD A;  3BX7 A;  3KFI A;  1JV4 A;  1BEB A;  1FEN A;  3ELZ A;  3VU1 A;  2XKL A;  3V8U A;  1MVG A;  1O1V A;  4HFO A;  1GT3 A;  4M7M A;  1ERB A;  1URE A;  5JR8 A;  2FTB A;  2L68 A;  3WBG A;  5IO6 A;  4O4X A;  5CE4 A;  3PQS A;  4O4O A;  2JW1 A;  1KGL A;  2CM4 A;  3EBK A;  3IFB A;  3PPT A;  1KXO A;  4YKM A;  1A18 A;  1DC9 A;  2AT0 X;  1GKA A;  1DFV A;  4ZR2 A;  2AT5 X;  5H9K A;  3NP1 A;  5HZ5 A;  1KT4 A;  3S26 A;  2ALL X;  3JQO A;  5HAE A;  2A13 A;  2BLG A;  4I9S A;  4AZR A;  2GJ5 A;  1TOU A;  5FQ6 E;  5B29 A;  2RD7 C;  1FE3 A;  1Y9L A;  2G78 A;  2WQ9 A;  2MJI A;  2Q2P A;  4ORY A;  3LV4 A;  1BWY A;  1OPB A;  4NW4 A;  4NLJ A;  5F1E A;  5D45 A;  2X8S A;  4KC8 A;  3STK A;  3C78 X;  2RCT A;  5HZQ A;  1IFB A;  1LID A;  3KZA A;  1X8U A;  3APV A;  5D8J A;  1LF7 A;  4QZU A;  5D48 A;  5AEO A;  1X8P A;  4YGH A;  3EMM A;  1EII A;  2A0A A;  2CZU A;  3B2J A;  2KTS A;  3O22 A;  1KT7 A;  4KT5 A;  2HZQ A;  4ZHG A;  4RUU A;  3CBC A;  4HPB A;  2W2A A;  4AZO A;  2F73 A;  3C77 X;  1E5P A;  1QG5 A;  3SOT A;  3DSZ A;  4UU3 A;  2MO5 A;  1A57 A;  1O1U A;  3Q6L A;  2AKQ A;  2Q39 A;  1G74 A;  4XME A;  1JIW I;  5BYP A;  3UEU A;  5BVQ A;  4KCA A;  1TOW A;  4MIR A;  4HPD A;  3STN A;  3NX1 A;  4NYQ A;  3L4R A;  3U9P C;  3BY0 A;  3FEK A;  4IB7 A;  4LKP A;  4FBR A;  4FQB B;  2OZQ A;  5AJB A;  3FW4 A;  5FFH A;  4I6S A;  1S44 A;  4WFV A;  1MUP A;  2IFB A;  4YFP A;  3P6H A;  4HPA A;  4U8U O;  3FA9 A;  5HBS A;  1YP6 A;  2PY1 A;  5EPQ A;  5B27 A;  4A1H A;  1ACD A;  3BDR A;  4WHI A;  3EM0 A;  4YBU A;  5DPQ A;  1CRB A;  2MWH A;  1R0U A;  1VYG A;  2QM9 A;  3U0D A;  4LZU A;  1JYD A;  4JGL A;  4AZQ A;  5C0N A;  4GNW A;  4FGI B;  2FWV A;  4ORX A;  3ZWE A;  4L1N A;  4EXZ A;  1QQS A;  3ZZV A;  4PSQ A;  2E4J A;  4KII A;  1IKJ A;  2X8F A;  4GET A;  1IIU A;  4TJZ A;  3EBW A;  3RWX A;  1LPJ A;  2AT8 X;  3VE1 A;  4QGW A;  4YFQ A;  4YBP A;  3G7X A;  4OS3 A;  3VG2 A;  1QAB E;  2WUT A;  2BS6 A;  3O19 A;  5AJC A;  2WWP A;  1HBQ A;  2GTL M;  3FYF A;  4GK9 A;  4IAB A;  1BRQ A;  2JMB A;  2ANS A;  4ID2 A;  2WQA E;  4I3D A;  2K23 A;  1B56 A;  3B2I A;  3HOL A;  4D6A A;  1ZRY A;  2MM3 A;  4XMC A;  1OBP A;  2F09 A;  1PM1 X;  4WFU A;  1LIF A;  4OMW A;  1JBH A;  5LJE A;  1QFV A;  5FQ7 E;  1OEK A;  2ASN X;  1HQP A;  1FEM A;  3WVM A;  1TW4 A;  3CBS A;  1GT5 A;  1DZJ A;  2DM5 A;  5LJH A;  2R73 A;  4FBV A;  1EI5 A;  2OFM X;  1RBP A;  2JU3 A;  1GM6 A;  2KT4 B;  1LFO A;  1ICN A;  3WJF A;  1BRP A;  3UEX A;  3D97 A;  1ICM A;  4YCH A;  5HA1 A;  4ZH9 A;  2HNX A;  3ZW0 A;  1DZP A;  2QOS C;  1Z24 A;  4N7D A;  1PMP A;  4GZV A;  1I4U A;  3ZUI A;  3JS1 A;  4L3R A;  4LKT A;  1ERX A;  1ZND A;  4TQ2 A;  1ZNK A;  1EPA A;  4ALB A;  4YDB A;  3QKG A;  1SY0 A;  1XCA A;  3GAQ A;  3PEC A;  4BOE A;  1BSO A;  1AEL A;  4ZH6 A;  2FR3 A;  3BSZ E;  2OVA A;  3HWD A;  2YMS A;  1IKE A;  1MX8 A;  3NBX X;  3NQ9 A;  3NQ3 A;  1CBQ A;  2Z4H A;  2FRS A;  3VG6 A;  1L6M A;  1JYJ A;  3JSQ A;  1CBI A;  3PED A;  3PQU A;  4IB6 A;  1IFC A;  1I04 A;  4ALO A;  1S7D A;  3BRN A;  3B2L A;  1QY1 A;  4NYR A;  2K62 A;  2WR6 A;  4MIS A;  1QY0 A;  5H9A A;  5HTD A;  4D6B A;  3ZW1 A;  5EEE A;  3EYC A;  3B2K A;  3RSW A;  1BSQ A;  1GKA B;  2BS5 A;  4GNY A;  1T8V A;  3P6C A;  1MDC A;  4YKO A;  3APU A;  1HN2 A;  4OS8 A;  3E3C A;  3KQ0 A;  4O3W A;  4R0B A;  5LJB A;  5CYB A;  1DF3 A;  2HYS A;  2LA7 A;  3F9D A;  2OVE A;  4XMH A;  5KHP A;  4ON1 A;  4DQ3 A;  4MVI A;  2AT3 X;  5F6B A;  4ZHC A;  1AVG I;  2R56 A;  4CK4 A;  1ALB A;  5IO5 A;  5HZ9 A;  1LIB A;  3U03 A;  4LQZ A;  1KZX A;  1O8V A;  2LBA A;  4IAX A;  1U0X A;  4ORW A;  1KZW A;  1U17 A;  3T1D A;  1I06 A;  3CWK A;  3ZW2 A;  4YH0 A;  2P8G A;  5D4A A;  3WJG A;  2M4L A;  1HMT A;  3OJY C;  3WXQ A;  2AH7 X;  2FS7 A;  1SY3 A;  1YWD A;  1JJJ A;  2YG2 A;  1SXW A;  1U18 A;  4ES7 A;  4IAW A;  4AZM A;  1DZK A;  1KT5 A;  4ZGF A;  2G79 A;  5HTE A;  4IBA A;  2FR2 A;  2ACP X;  3FR2 A;  2GTL O;  2POA A;  1GX8 A;  2KTD A;  4TNN A;  3D95 A;  3S5V A;  3CR6 A;  4XMF A;  1BSY A;  2Q9S A;  1AQB A;  5DG4 A;  1X8Q A;  4EDE A;  1LKE A;  5LJG A;  2HMB A;  4GH7 A;  2ZAI A;  4TKH A;  3OE3 A;  4K19 A;  2NND A;  1OEE A;  2L5P A;  2AT6 X;  1E06 A;  3P24 A;  1ZNG A;  4MVL A;  3CMP A;  2NNE A;  1EQD A;  4YGZ A;  2W2B A;  4Y0Q A;  4ZFX A;  3F6Z B;  1G7N A;  1GX9 A;  1LNM A;  4MVK A;  2CM9 A;  2NP1 A;  2X46 A;  3F8A A;  4I3C A;  1VPR A;  3HOE A;  3HTY A;  3ZUO A;  1VYF A;  3P6D A;  3TGC A;  3AKM A;  4QYP A;  4DQ4 A;  3APX A;  1QFT A;  1FDQ A;  1YIV A;  3FA8 A;  1ZNL A;  4ZHD A;  4A60 A;  5EDB A;  5LJK A;  1KT6 A;  5BVS A;  1DZM A;  1EIO A;  1BLR A;  2GTF X;  2L9C A;  1A2D A;  2CBS A;  3WJB A;  4HWM A;  3MBT A;  5HA0 A;  5FEN A;  3BU9 A;  5HWZ A;  4Y0P A;  3WJD A;  2GTL N;  3PP6 A;  1G5W A;  4I3B A;  1EPB A;  1SXX A;  4ZHF A;  2CZT A;  1XKI A;  3HWG A;  4N7C A;  5EDC A;  3WOV A;  4QGV A;  1ZNE A;  1UZ2 X;  3FLL A;  5H8T A;  1KQW A;  2KW1 A;  3TGA A;  2AMM X;  4TKJ A;  3NR3 A;  2BHV A;  4AZN A;  3FA6 A;  4QRL A;  1X8N A;  3DTQ A;  4GE1 A;  1Y9T A;  1X89 A;  2HZR A;  3B2H A;  3I0A A;  3RZY A;  5HCD C;  1SXY A;  4O3Y A;  5F6Z A;  1SY2 A;  5LKF A;  1RLB E;  4YMY A;  5LJC A;  2WEX A;  4O4S A;  2O62 A;  1SMP I;  4GKC A;  5IO7 A;  1GT1 A;  3P6G A;  3FEN A;  4IB9 A;  4BQU A;  1BM5 A;  3OD9 A;  4Y0S A;  1H91 A;  3RKG A;  3WJE A;  4QQ1 A;  4I95 A;  3VE2 A;  1EXS A;  1AB0 A;  1NP4 A;  2EU7 X;  3FEL A;  3FW5 A;  2G7B A;  3SAO A;  4I9R A;  3PH6 A;  4YGG A;  3BLG A;  3ZW0 B;  5H9L A;  4YFR A;  1QWD A;  2L67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...