1BM5A

The solution structure of a site-directed mutant (r111m) of human cellular retionic acid binding protein-type ii, nmr, 31 structures
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
137
structure length
137
Chain Sequence
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTMELTNDGELILTMTADDVVCTRVYVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Retinoic-acid transport
molecule keywords CELLULAR RETINOIC ACID BINDING PROTEIN-TYPE II
publication title NMR study suggests a major role for Arg111 in maintaining the structure and dynamical properties of type II human cellular retinoic acid binding protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 1998-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1bm5A00
1LFOA 1YWDA 4RUNA 4KIIA 1ZNKA 2FLJA 1HMTA 3P6EA 2FR3A 3VG7A 4I9RA 4XMCA 4ZH6A 5HWZA 3Q6LA 5LJKA 1HQPA 2L68A 3P6GA 4GE1A 1KT4A 2Q9SA 4HPBA 1SY2A 1CBSA 5K06A 2MM3A 4GNWA 4XMFA 4ZHFA 1FENA 2KTDA 2CM4A 2K62A 2HYSA 1FE3A 4M6SA 1TOWA 1G85A 2F73A 4N7CA 1ZNLA 1IW2A 1CBQA 3BX7A 1T8VA 2CBRA 2WEWA 5HZ6A 3BX8A 3C76X 3ZUIA 1YWAA 1B8EA 1OEKA 3PEDA 1GX8A 1GT3A 2ACOA 4ZHDA 4ORSA 3PH5A 1L6MA 1PEEA 4HFOA 1MX8A 1GT5A 5H9AA 5D47A 1E06A 4Y0PA 4A1HA 5CE4A 1G5WA 1T0VA 1I4UA 3C78X 2AH7X 1OBQA 2L5PA 4QGVA 3CMPA 1YUPA 3KFIA 4ODDA 3WJEA 2CZTA 3PP6A 3IFBA 4UU3A 4GNYA 3BU9A 5L8NA 3EBKA 4GKCA 2NNQA 2W2FA 2ASNX 3PECA 4YGZA 2HMBA 1DV9A 2A2GA 1NP1A 1KT3A 5C0NA 3CBSA 1TOUA 1QFVA 1RLBE 2A2UA 4LZVA 4ORYA 1OPAA 3RZYA 4TJZA 1H91A 1Z24A 3U0DA 2W2AA 5EZ2A 5F1EA 3VG4A 4I3CA 1GM6A 5D45A 4AZMA 2NP1A 1QQSA 1MX7A 3OJYC 3VG2A 3HWEA 4O9SA 5EDBA 3G7XA 3PH6A 1AB0A 1KZXA 1VPRA 4AZPA 1JBHA 1GXAA 1KZWA 4LKPA 1BRQA 2WUTA 3FR2A 3NP1A 1XCAA 2LB6A 4EDEA 1ZRYA 1FDQA 2YG2A 3I0AA 4ZCBA 2LBVA 4A8ZA 1KQXA 1MVGA 4HPAA 4TKJA 4TNNA 4GETA 5BVSA 2P8GA 3TGCA 4LZUA 4MVLA 3APWA 4Y0SA 5L8OA 4EXZA 3BS2A 4ARHA 3C77X 1ICMA 1JJJA 4HPCA 2G7BA 4YCHA 5FFHA 2JU3A 1X8OA 3ELZA 3P6HA 4OS3A 1SY0A 1IFBA 3AKNA 1QG5A 1S7DA 3MVFA 4D6BA 1D3SA 4IB8A 1OPBA 4IMNA 2R73A 3SAOA 1BLRA 1E5PA 2FRSA 1SXUA 5LKEA 1GKAA 1A57A 2R56A 5FENA 1OBUA 5HZ8A 1LIFA 3FEPA 1A2DA 2RCQA 2QO6A 3IA8A 1X89A 1KT5A 3O2YA 4NP1A 5H8TA 1I05A 4DQ3A 4AZQA 2HNXA 2CM9A 1UREA 5IO6A 4GRJA 1CRBA 1ZNDA 1FELA 2WSJA 3BSZE 2Q2PA 4A1YA 2JN3A 4IB7A 1BRPA 1YP6A 5H9LA 4ALOA 4HPDA 2PY1A 3APXA 1LIDA 3NX1A 3KFFA 2POAA 4YGHA 3WJDA 1YWBA 1U18A 1BEBA 2AKQA 1D2UA 2FS6A 5HTDA 5LJBA 1OEJA 3STMX 3KZAA 3GAQA 1LNMA 5IO7A 4ORUA 1BSOA 1DFVA 1MDCA 4TLJA 2RD7C 2JOZA 4ZFXA 3FW5A 1DZPA 3CBCA 2XKLA 3BDRA 1KXOA 2IFBA 2OVEA 1A3YA 1EIIA 2L67A 2NNEA 4XMGA 5LJEA 1LPJA 4YKMA 2A3FX 1LIEA 2MO5A 4NLIA 1DF3A 1ERBA 4QZUA 5F7GA 2R74A 1GT4A 4YDAA 5BVTA 1GT1A 1BBPA 1EIOA 1QFTA 1QY0A 3T1DA 3BY0A 2A13A 3FEKA 1O1VA 5H9KA 5L8IA 4NYRA 3L4RA 4QYNA 3TGBA 2JU7A 5HAEA 3HWFA 1ML7A 2WQ9A 2FTBA 1RBPA 3WBGA 1JJXA 1DZJA 2ACPX 3UEWA 1U0XA 1BWYA 2E4JA 4OS8A 4OMWA 1ADLA 1NGLA 1IFCA 4IAXA 3STKA 1GX9A 1I06A 2CZUA 1FEMA 4NLJA 4QAEA 4MVIA 4R0BA 1X71A 3O19A 1DC9A 3FR4A 5HZ9A 3TF6A 3K3LA 1IKEA 1BSQA 4XMEA 3B2HA 4TKHA 1SY3A 2XSTA 5F58A 5F6ZA 1ALBA 5D48A 1EW3A 2BLGA 4YFPA 1X8UA 1TXLA 1X8PA 3VG3A 3D97A 1S2PA 4QGXA 1B56A 5EDCA 1FTPA 2CBSA 4WFUA 5F6BA 3UEXA 4ZHGA 3FENA 3RSWA 2AT5X 2X46A 1XKIA 2GJ5A 4K19A 5HTEA 1ZNEA 1SXXA 3CQNA 1EPAA 1QWDA 2AT6X 3U03A 1BSYA 2EU7X 2WEXA 5B27A 4ZGUA 1EUOA 4IMOA 1YP7A 3VG6A 3HWGA 4YKOA 4UU2A 2QO4A 1YIVA 1UZ2X 2MJIA 2Q39A 1SA8A 2OVDA 4YH0A 2RA6A 1IKJA 3ELXA 1S44A 3NQ9A 1JV4A 3B2LA 3FMZA 2HLVA 4AZNA 1CJ5A 3JSQA 3KQ0A 3CR6A 5LKFA 2AMMX 4EFGA 1P6PA 2OVAA 3EM0A 4YBUA 5H9NA 2RQ0A 2WQAE 2AT8X 3UEUA 3WVMA 4AYHA 4ZR2A 5HA1A 1EXSA 3KFHA 4AW8A 4MVKA 3ZUOA 4YBPA 2QM9A 3FELA 1ZNGA 2N93A 1OBPA 4M7MA 3CQRA 3B2KA 3P6CA 2A0AA 4A60A 1QABE 3P6DA 1ICNA 1HMRA 4NNSA 3EYCA 3S26A 1X8NA 4TQ2A 4N7DA 1O8VA 1N0SA 5D8JA 4ORRA 4YFRA 4OS0A 1GGLA 3TZSA 1IIUA 1JYJA 1X8QA 3P6FA 4ES7A 4QZTA 5DG4A 1LICA 1YWCA 2K23A 4WBKA 4I3DA 1HBQA 4NNTA 2WR6A 2X45A 3HK1A 4YCEA 5KIDA 2AL0X 4OMXA 2KT4B 3D96A 3WJGA 3NR3A 4QGWA 4ALBA 1E02A 3STNA 3VG5A 4D6AA 4IAWA 4PSQA 5EEDA 5DPQA 2OZQA 1U17A 2QOSC 3KFGA 3D95A 3BU1A 3I17A 1A18A 1BJ7A 4IB9A 1VYGA 5KICA 5BVQA 3NQ3A 3U9PC 4YGGA 5HZ5A 5KHPA 4CK4A 1TW4A 2LKKA 4LKTA 4RUUA 4ZJ0A 3WXQA 1B4MA 1KT6A 4QYPA 3WJBA 1JZUA 3FIQA 2AT3X 3BRNA 1AVGI 2WWPA 3B2IA 1SY1A 4BVMA 1KT7A 2L9CA 1E00A 3MBTA 3FA9A 4NYQA 1QY2A 1ZNHA 3HWDA 5LJDA 5HCDC 5HCEC 1SXYA 3QKGA 3TGAA 2ANSA 3NADA 5D4AA 2GTFX 1DZKA 1MUPA 2DM5A 5AQ6A 4YFQA 1CBRA 1G74A 2JU8A 3NX2A 2GC9A 5IO5A 2QO5A 4ORWA 2RCTA 3F8AA 5HZQA 4DQ4A 2AT0X 1EALA 4AZOA 1HMSA 3FA6A 4GH7A 3WJFA 3F9DA 1HN2A 2FT9A 4AZRA 1AELA 1O1UA 1LF7A 3DTQA 1LIBA 4I9SA 2FS7A 1ACDA 5HBSA 1PMPA 5LJCA 1DZMA 5HCCC 4Y0RA 3ZQ3A 1G7NA 4Y0QA 1KGLA 3FW4A 4ZHHA 5B29A 3WJCA 2NNDA 1SXWA 5HA0A 3DSZA 2O62A 3FA8A 1JYDA 2LBAA 5LJHA 5LJGA 4BQUA 1I04A 1PM1X 1ERXA 2HZQA 3EBWA 3CWKA 4ORXA 1CBIA 1EQDA 3AKMA 1HBPA 3APVA 3FLLA 3NPOA 5EEEA 2Q4NA 4IB6A 5EPQA 4BOEA 4XMDA 4XMHA 1KOIA 1PBOA 3BLGA 4EEJA 2G78A 1EPBA 3EMMA 2FR2A 3O22A 3PPTA 3B2JA 2Q2MA 3FR5A 4ZHCA 1B0OA 1T68X 4WFVA 4IBAA 2FWVA 3UEVA 1R0UA 1AQBA 2LFOA 1OEEA 4YDBA 5JR8A 1TVQA 2ALLX 1VYFA 2W2BA 3FA7A 1QY1A 3JS1A 1KQWA 2G79A 4I3BA 4YMYA 1LKEA 2OFRX 2OFMX 4TKBA 1BM5A 1NP4A 5FAZA 3APUA 1GKAB 2HZRA 4ZH9A
chains in the Genus database with same CATH superfamily
1LFOA 1YWDA 4RUNA 4BX5A 4KIIA 1ZNKA 2RTLA 2FLJA 1HMTA 3P6EA 2FR3A 4JNJA 1HY2A 4I9RA 1W5RA 3HOLA 3Q6LA 4XMCA 1HQPA 2L68A 3P6GA 4GE1A 4ZH6A 1KT4A 2Q9SA 4HPBA 1SY2A 2F01A 4BCSA 1CBSA 3VE1A 5K06A 2MM3A 4GNWA 2X8FA 2RTGB 1VYOA 2ZAGA 3D4RA 4U8UM 4XMFA 4ZHFA 1FENA 2KTDA 2CM4A 3ZW1A 2K62A 2HYSA 4NV7A 1FE3A 4M6SA 4BX5B 1TOWA 1G85A 1SWLA 1Y9LA 1ZNLA 2F73A 4N7CA 1IW2A 1CBQA 3BX7A 1T8VA 1SWSA 2CBRA 2WEWA 5CYBA 5HZ6A 1N9YA 2HKDA 3BX8A 3C76X 3ZUIA 1YWAA 1B8EA 1OEKA 3PEDA 1GT3A 1GX8A 3SZIA 1LUQA 3ZW1B 2ACOA 3S5VA 4ZHDA 4ORSA 3PH5A 1L6MA 1PEEA 1KL5A 4HFOA 1MX8A 1GT5A 2IZEB 5H9AA 5D47A 1E06A 4Y0PA 4Y5DA 4A1HA 5CE4A 1G5WA 1T0VA 4FGIB 1I4UA 3C78X 2AH7X 1OBQA 3EW1A 5FQ7E 2L5PA 1I9HA 4QGVA 3CMPA 1YUPA 3KFIA 4ODDA 3WJEA 2CZTA 3PP6A 3IFBA 4UU3A 2OY1O 1KFFA 1PTSA 2G5LA 4GNYA 3BU9A 4CDFA 3VU1A 2C1SA 3EBKA 4GKCA 5L8NA 1NQMA 2DJGA 2NNQA 2W2FA 5AEOA 2ASNX 3PECA 4YGZA 2HMBA 1DV9A 2X8TA 2A2GA 2I5ZO 1NP1A 1KT3A 2AVIA 2OYBO 4C5PA 5C0NA 3CBSA 4GD9A 4GGTA 1TOUA 1QFVA 2Y3EA 1RLBE 4KH8A 2A2UA 3SZJA 1HXLA 4LZVA 4ORYA 1OPAA 3RZYA 4TJZA 5IXGA 4ID2A 2VDFA 3CKFA 1H91A 3SLOA 2RTEB 1K3BA 1Z24A 1LDOA 3U0DA 2W2AA 1W6FA 5EZ2A 4O4XA 4PJ2A 5F1EA 1VWAB 2X34A 4I3CA 3VG4A 1GM6A 3VG7A 2IZFB 5D45A 1SWEA 4EKVA 3T6FA 4AZMA 2NP1A 1QQSA 1SWRA 1MX7A 3OJYC 3VG2A 3HWEA 4O9SA 3Q34A 5EDBA 3WZNA 2VFCA 3G7XA 3PH6A 1AB0A 3ZW2A 1KZXA 2BT9A 1VPRA 2FHLA 4AZPA 1JBHA 1GXAA 2FKJA 1KZWA 4LKPA 1BRQA 4GU8A 1Y53X 2X56A 2WUTA 3WYPA 3FR2A 4Z27A 5B10O 3NP1A 1SWHA 1XCAA 2LB6A 2RTNB 2RTIB 3EC5A 1ZRYA 1AVDA 1FDQA 2YG2A 2X8SA 3I0AA 4ZCBA 1KQXA 1MVGA 3P24A 2LBVA 4A8ZA 4HPAA 4TKJA 4TNNA 4GETA 1MOYA 5LJKA 3SOTA 5BVSA 2P8GA 3TGCA 2WPUA 4LZUA 4MVLA 3APWA 4NV8A 1N4JA 1VWMB 2RTOB 1I78A 4Y0SA 4OEMA 2RN4A 2ZSCA 5L8OA 1MEPA 4EXZA 3BS2A 4ARHA 3C77X 1ICMA 4ZGFA 1JJJA 4HPCA 2G7BA 4YCHA 3JQOA 2RTPB 5FFHA 1X8OA 2JU3A 3ELZA 1VWOB 3P6HA 4OS3A 1SY0A 1IFBA 1SLDB 3AKNA 1QG5A 1S7DA 3RDOA 3MVFA 4D6BA 1D3SA 4IB8A 1OPBA 4IMNA 2R73A 3VHMA 3SAOA 1BLRA 1E5PA 2FRSA 1SXUA 3WZOA 5LKEA 1GKAA 1LCVA 1A57A 2R56A 5B3MO 5FENA 3P02A 4Z6JA 3OD9A 1OBUA 3GE2A 5HZ8A 1LIFA 1VWRB 3FEPA 1A2DA 1SRGA 2OY8A 4FBVA 4BBOA 2RCQA 2QO6A 3MG5A 4QRLA 4Z2PA 3IA8A 1X89A 4U3QA 1KT5A 2I5VO 3O2YA 4INNA 1NBXA 4NP1A 2OY5O 5H8TA 1I05A 4DQ3A 4AZQA 2HNXA 2CM9A 1UREA 5IO6A 4GRJA 1CRBA 1ZNDA 1FELA 2WSJA 3BSZE 1SRIA 2Q2PA 4A1YA 1JQPA 2JN3A 4IB7A 1BRPA 4QQ1A 1YP6A 5H9LA 2OVSA 4WHIA 4ALOA 1RXKA 4HPDA 4CDDA 2PY1A 3NQKA 4BX7A 4Z2VA 2RTAA 3APXA 1LIDA 1EI5A 3NX1A 4L3RA 3KFFA 2POAA 3CKGA 4O49A 4YGHA 3LHNA 3RDSA 3RWXA 1LELA 3WJDA 1YWBA 1U18A 1BEBA 2AKQA 1D2UA 2FS6A 4ML7B 5HTDA 5LJBA 1OEJA 3T2WA 3STMX 1HXZA 3GAQA 1LNMA 3KZAA 2GTLM 4ORUA 5IO7A 2FKGA 2OL7A 1BSOA 1DFVA 1SWPA 1MDCA 4TLJA 2RD7C 2JOZA 1SWGA 4U8UN 4BX7B 3FW5A 1DZPA 3CBCA 4MEEA 4ZFXA 2XKLA 3BDRA 4BJ8A 1KXOA 2FGSA 2GTLN 2IFBA 3WYQA 2OVEA 1A3YA 1EIIA 2L67A 2NNEA 4XMGA 5LJEA 4CPFA 1LPJA 4GZVA 3RE6A 1SLFB 3D9WA 1SWKA 3H3IA 4YKMA 2A3FX 1UYOX 1LIEA 1SREA 2MO5A 4NLIA 1DF3A 1ERBA 1VWBB 4GUZA 4QZUA 5F7GA 2R74A 4LQZA 4O4OA 1DF8A 1GT4A 3PDFA 2RTCB 4YDAA 3FDCA 5BVTA 3RY1A 1GT1A 1BBPA 1EIOA 1QFTA 2RTRB 1QY0A 4DNEA 3T1DA 1STRB 2QMIA 3BY0A 4DCBA 2A13A 3FEKA 5IRAA 1O1VA 5H9KA 5L8IA 1WUBA 3L4RA 4NYRA 4QYNA 5B11O 3TGBA 4O3ZA 2JU7A 5FQ6E 3RDUA 2YMSA 3ZZVA 5HAEA 3HWFA 1ML7A 1SWDA 3SZHA 2WQ9A 2FTBA 4EDEA 1RBPA 1KL4A 4GK9A 3WBGA 4Z28A 1JJXA 2X55A 4QNIA 1DZJA 4GDZA 4GGZA 3OBLA 5AJBA 2ACPX 3E3CA 3UEWA 1U0XA 1BWYA 2E4JA 4OS8A 3ZW0B 3OE3A 4OMWA 2JGSA 3X00A 1ADLA 1NGLA 1IFCA 4NW4A 2MF6A 4IAXA 5FQ8E 1SMPI 4CDEA 1PBYA 4CPHB 3STKA 3AUMO 1GX9A 1I06A 2CZUA 1FEMA 4NLJA 4QAEA 4BX6B 4MVIA 2VFBA 4R0BA 3FIDA 1X71A 3VHIA 3O19A 1DC9A 3T2XA 2RTQB 5K67A 4JO6A 3FR4A 5HZ9A 3TF6A 1Y52X 3K3LA 3VHHA 1VWHB 5L3YA 1IKEA 1BSQA 2KTSA 4XMEA 3B2HA 4GJVA 4TKHA 1SY3A 2XSTA 4O4UA 5F6ZA 1ALBA 2OF9A 5D48A 1EW3A 5F58A 2C1QA 2BLGA 4YFPA 1X8UA 4U9CA 1TXLA 1RAVA 1X8PA 4U8UO 3VG3A 4BGFA 3D97A 1S2PA 3LTWA 2IZGB 4QGXA 1B56A 5EDCA 1FTPA 2CBSA 4WFUA 1VWFB 4O3WA 5F6BA 3UEXA 4ZHGA 1NQNA 3FENA 3RSWA 2AT5X 1VWCB 2X46A 3QQ2A 1XKIA 2GJ5A 2IZLB 4K19A 5HTEA 1E2TA 1ZNEA 3S60A 4I95A 1SXXA 3CQNA 3FYFA 3V8UA 1EPAA 1QWDA 1Y9TA 2A5CA 2AT6X 3U03A 2RTHB 1SLGB 3LV4A 1BSYA 2EU7X 2WEXA 4OELA 5B27A 4ZGUA 1EUOA 2OL8O 4IMOA 1YP7A 3VG6A 2RTJA 3HWGA 4YKOA 4UU2A 2QO4A 1YIVA 1WBIA 4MISA 4CV7A 1UZ2X 2MJIA 1N9MA 1GX3A 2Q39A 1SA8A 4OKAA 2OVDA 4YH0A 2RA6A 4CPIA 1IKJA 4Z2OA 2Z4IA 3ELXA 4KC7A 1S44A 3NQ9A 1SWJA 1VWNB 1AVEA 1JV4A 3B2LA 3FMZA 2HLVA 4AZNA 1CJ5A 2IZIA 2MWHA 1UYNX 3JSQA 3RBYA 3KQ0A 3CR6A 5LKFA 2AMMX 4EFGA 1P6PA 4CDCA 2OVAA 2Y3FA 3EM0A 2OY7A 4YBUA 5H9NA 5B5FA 1JJUA 2RQ0A 2RTBB 2WQAE 4I6SA 5IRUA 2AT8X 1VWLB 2DJFA 3UEUA 3WVMA 4AYHA 2RTMA 4ZR2A 1NC9A 5HA1A 1W4TA 3WZQA 3SLTA 1EXSA 2BHVA 3KFHA 4MVKA 5AJCA 3ZUOA 4AW8A 4YBPA 4YVBA 2QM9A 2RTFB 3FELA 1SWTA 1ZNGA 2N93A 1OBPA 4HWMA 3CQRA 4M7MA 3B2KA 4EQAC 3P6CA 2A0AA 4A60A 2IZKA 5IRWA 1QABE 1RXJA 3P6DA 1ICNA 1HMRA 1RXHA 4NNSA 3EYCA 3S26A 5K68A 1X8NA 4TQ2A 4N7DA 2X4MA 1O8VA 1N0SA 5D8JA 4ORRA 4YFRA 4KT5A 4OS0A 1RSUB 1GGLA 3TZSA 1IIUA 1JYJA 1X8QA 3P6FA 4ES7A 4QZTA 5DG4A 2CAMA 1LICA 1YWCA 2K23A 4WBKA 1SLEB 4I3DA 1HBQA 2IZBA 4NNTA 1SWNA 2WR6A 2X45A 3HK1A 4YCEA 3VPJE 5KIDA 2AL0X 4OMXA 1JMXA 2KT4B 3D96A 4O3XB 1LCWA 3WJGA 2OL6O 3NR3A 4QGWA 1HQQA 2BS5A 3RDMA 1E02A 3HPEA 4L1NA 3RE5A 1KL3A 1JMZA 3STNA 3VG5A 5CHKA 4D6AA 2X32A 1SWQA 4GGRA 4IAWA 3AEHA 4PSQA 5EEDA 1IJ8A 5DPQA 2OZQA 1SWOA 1U17A 2QOSC 4ON1A 3KFGA 3D95A 3BU1A 5CSEA 3I17A 2JW1A 3N91A 3PK2A 1RSTB 1A18A 1BJ7A 3HOEA 1VYGA 2BSZA 4IB9A 1VWKB 2BC3A 5KICA 5BVQA 3ZW0A 3NQ3A 3U9PC 2M4LA 4YGGA 2MHDA 5B5GA 2AF5A 3ZI8A 5HZ5A 3HTYA 4IRWA 1VWGB 5KHPA 4CPHA 4CK4A 1TW4A 2G8CO 2OFAA 2LKKA 2OF8A 4LKTA 4RUUA 3WZPA 1OSPO 4BX6A 1Y0GA 4ZJ0A 3WXQA 1B4MA 1KT6A 4QYPA 3WJBA 4ALBA 1STSB 1JZUA 3FIQA 1Y55X 4GDAA 2AT3X 3F6ZB 1VWJB 3BRNA 1AVGI 2WWPA 3B2IA 1MM9A 3MX7A 1SY1A 4BVMA 1KT7A 2L9CA 1E00A 3MBTA 3FA9A 4NYQA 1QY2A 1ZNHA 3HWDA 5LJDA 3SLJA 5HCDC 2PI3O 4JGLA 5HCEC 4Y59A 1SXYA 3QKGA 3TGAA 2ANSA 2IZDB 3NADA 4CPEA 5D4AA 2GTFX 2IZJA 1VWQB 1DZKA 1MUPA 2DM5A 3T6LA 3VGWA 5AQ6A 4YFQA 1CBRA 1G74A 2JU8A 1MK5A 2GC9A 3NX2A 4IABA 5IO5A 4B55A 1SRJA 2QO5A 3ZWEA 5F2BA 2F09A 1SWUA 2RTDB 4ORWA 2RCTA 3F8AA 1SWCA 5HZQA 4DQ4A 2AT0X 1EALA 4AZOA 1N7YA 1HMSA 2LA7A 3FA6A 4FQBB 4GH7A 3WJFA 3F9DA 1HN2A 2FT9A 4AZRA 5HWZA 1AELA 1O1UA 1LF7A 1SWAA 2IZHB 3DTQA 1LIBA 3MM0A 2FS7A 1ACDA 1VWPB 4I9SA 1PMPA 4O3YA 5HBSA 1DZMA 2GTLO 5HCCC 4Y0RA 5LJCA 1VWEB 2GH7A 4FBOA 1G7NA 3ZQ3A 4Y0QA 1KGLA 3FW4A 3UAQA 4ZHHA 5B29A 3WJCA 2NNDA 1SXWA 5HA0A 3DSZA 1SRFA 4MVEA 3RY2A 1SWFA 2O62A 3FA8A 4MIRA 2BS6A 1JYDA 2LBAA 5LJHA 5LJGA 4BQUA 1I04A 1PM1X 1ERXA 2HZQA 2ZAIA 3EBWA 3RDXA 3CWKA 4ORXA 5B2AO 1CBIA 1EQDA 3AKMA 1HBPA 1K24A 3APVA 3FLLA 3NPOA 5EEEA 2Q4NA 4IB6A 5EPQA 4COTA 4CSBA 4BOEA 4XMDA 4XMHA 1KOIA 1PBOA 3BLGA 4EEJA 4O4SA 2G78A 3RDQA 2A5BA 2OFBA 1EPBA 3EMMA 2FR2A 2QOMA 2IZAA 3EW2A 3O22A 3PPTA 3B2JA 2Q2MA 5BYPA 3FR5A 4ZHCA 2UZ2A 1B0OA 1T68X 4WFVA 3VE2A 4IBAA 3RKGA 2FHNX 4FBRA 2QCBA 2JMBA 3NBXX 1STPA 1FJ1E 2FWVA 3UEVA 4I60A 2KD2A 1R0UA 4KC8A 5JD2A 1AQBA 2LFOA 1OEEA 1JIWI 4GJSA 4YDBA 4KCAA 2Y32A 1TVQA 2ALLX 5JR8A 4JHQA 1N43A 2RTKA 1SWBA 1VWIB 1VYFA 1QY1A 2C4IA 2W2BA 3FA7A 3PQSA 3JS1A 4U46A 1KQWA 2Z4HA 1LCZA 2G79A 4I3BA 2UYWA 1LDQA 4YMYA 1LKEA 1SRHA 1VWDB 2OFRX 2OFMX 2IZCB 3WOVA 4TKBA 1BM5A 1NDJA 1NP4A 2A8GA 5FAZA 3KVNA 3APUA 3S5XA 1GKAB 2HZRA 2KW1A 3PQUA 4ZH9A
chains in the Genus database with same CATH topology
1LFOA 1YWDA 4RUNA 4KIIA 1ZNKA 2FLJA 1HMTA 3P6EA 2FR3A 3VG7A 4I9RA 4XMCA 4ZH6A 3HOLA 3Q6LA 5HWZA 1HQPA 2L68A 3P6GA 4GE1A 1KT4A 2Q9SA 4HPBA 1SY2A 1CBSA 3VE1A 5K06A 2MM3A 4GNWA 2X8FA 2ZAGA 3D4RA 4U8UM 4XMFA 4ZHFA 1FENA 2KTDA 2CM4A 3ZW1A 2K62A 2HYSA 1FE3A 4M6SA 1TOWA 1G85A 1Y9LA 2F73A 1ZNLA 4N7CA 1IW2A 1CBQA 3BX7A 1T8VA 2CBRA 2WEWA 5CYBA 5HZ6A 3BX8A 3C76X 3ZUIA 1YWAA 1B8EA 1OEKA 3PEDA 1GX8A 1GT3A 3ZW1B 2ACOA 3S5VA 4ZHDA 4ORSA 3PH5A 1L6MA 1PEEA 4HFOA 1MX8A 1GT5A 5H9AA 5D47A 1E06A 4Y0PA 4A1HA 5CE4A 1G5WA 1T0VA 4FGIB 1I4UA 3C78X 2AH7X 1OBQA 5FQ7E 2L5PA 4QGVA 3CMPA 1YUPA 3KFIA 4ODDA 3WJEA 2CZTA 3PP6A 3IFBA 4UU3A 4GNYA 3BU9A 3VU1A 5L8NA 3EBKA 4GKCA 2NNQA 2W2FA 5AEOA 2ASNX 3PECA 4YGZA 2HMBA 1DV9A 2X8TA 2A2GA 1NP1A 1KT3A 5C0NA 3CBSA 1TOUA 1QFVA 1RLBE 4KH8A 2A2UA 4LZVA 4ORYA 1OPAA 3RZYA 4TJZA 4ID2A 1H91A 1Z24A 3U0DA 2W2AA 5EZ2A 4O4XA 4PJ2A 5F1EA 3VG4A 4I3CA 1GM6A 5D45A 4AZMA 2NP1A 1QQSA 1MX7A 3OJYC 3VG2A 3HWEA 4O9SA 5EDBA 3G7XA 3PH6A 1AB0A 3ZW2A 1KZXA 2BT9A 1VPRA 4AZPA 1JBHA 1GXAA 1KZWA 4LKPA 1BRQA 4GU8A 2WUTA 3FR2A 3NP1A 1XCAA 2LB6A 4EDEA 1ZRYA 1FDQA 2YG2A 3I0AA 2X8SA 4ZCBA 2LBVA 1KQXA 1MVGA 3P24A 4A8ZA 4HPAA 4TKJA 4TNNA 4GETA 5LJKA 3SOTA 5BVSA 2P8GA 3TGCA 4LZUA 4MVLA 3APWA 4Y0SA 5L8OA 2RN4A 4EXZA 3BS2A 4ARHA 3C77X 1ICMA 4ZGFA 1JJJA 4HPCA 2G7BA 4YCHA 3JQOA 5FFHA 2JU3A 1X8OA 3ELZA 3P6HA 4OS3A 1SY0A 1IFBA 3AKNA 1QG5A 1S7DA 3MVFA 4D6BA 1D3SA 4IB8A 1OPBA 4IMNA 2R73A 3SAOA 1BLRA 1E5PA 2FRSA 1SXUA 5LKEA 1GKAA 1A57A 2R56A 5FENA 3P02A 3OD9A 1OBUA 3GE2A 5HZ8A 1LIFA 3FEPA 1A2DA 4FBVA 2RCQA 2QO6A 4QRLA 3IA8A 1X89A 4U3QA 1KT5A 3O2YA 4INNA 4NP1A 5H8TA 1I05A 4DQ3A 4AZQA 2HNXA 2CM9A 1UREA 5IO6A 4GRJA 1CRBA 1ZNDA 1FELA 2WSJA 3BSZE 2Q2PA 4A1YA 2JN3A 4IB7A 1BRPA 4QQ1A 1YP6A 5H9LA 2OVSA 4WHIA 4ALOA 4HPDA 2PY1A 3NQKA 3APXA 1LIDA 1EI5A 3NX1A 4L3RA 3KFFA 2POAA 4O49A 4YGHA 3WJDA 3LHNA 3RWXA 1YWBA 1U18A 1BEBA 2AKQA 1D2UA 2FS6A 4ML7B 5HTDA 5LJBA 1OEJA 3STMX 3KZAA 3GAQA 1LNMA 5IO7A 2GTLM 4ORUA 1BSOA 1DFVA 1MDCA 4TLJA 2RD7C 2JOZA 4U8UN 4ZFXA 3FW5A 1DZPA 3CBCA 2XKLA 3BDRA 1KXOA 2GTLN 2IFBA 2OVEA 1A3YA 1EIIA 2L67A 2NNEA 4XMGA 5LJEA 1LPJA 4GZVA 3H3IA 4YKMA 2A3FX 1LIEA 2MO5A 4NLIA 1DF3A 1ERBA 4QZUA 5F7GA 2R74A 4LQZA 4O4OA 1GT4A 4YDAA 5BVTA 1GT1A 1BBPA 1EIOA 1QFTA 1QY0A 3T1DA 3BY0A 2QMIA 2A13A 3FEKA 1O1VA 5H9KA 5L8IA 4NYRA 3L4RA 4QYNA 3TGBA 4O3ZA 2JU7A 5FQ6E 2YMSA 3ZZVA 5HAEA 3HWFA 1ML7A 2WQ9A 2FTBA 1RBPA 4GK9A 3WBGA 1JJXA 4QNIA 1DZJA 4GDZA 3OBLA 5AJBA 2ACPX 3E3CA 3UEWA 1U0XA 1BWYA 2E4JA 4OS8A 3ZW0B 3OE3A 4OMWA 1ADLA 1NGLA 1IFCA 4NW4A 4IAXA 5FQ8E 1SMPI 3STKA 1GX9A 1I06A 2CZUA 1FEMA 4NLJA 4QAEA 4MVIA 4R0BA 1X71A 3O19A 1DC9A 3FR4A 5HZ9A 3TF6A 3K3LA 1IKEA 1BSQA 2KTSA 4XMEA 3B2HA 4TKHA 1SY3A 2XSTA 4O4UA 5F6ZA 1ALBA 5D48A 5F58A 1EW3A 2BLGA 4YFPA 1X8UA 4U9CA 1TXLA 1X8PA 4U8UO 3VG3A 3D97A 1S2PA 4QGXA 1B56A 5EDCA 1FTPA 2CBSA 4WFUA 4O3WA 5F6BA 3UEXA 4ZHGA 3FENA 3RSWA 2AT5X 2X46A 1XKIA 2GJ5A 4K19A 5HTEA 1ZNEA 3S60A 4I95A 1SXXA 3CQNA 3FYFA 3V8UA 1EPAA 1QWDA 1Y9TA 2AT6X 3U03A 3LV4A 1BSYA 2EU7X 2WEXA 5B27A 4ZGUA 1EUOA 4IMOA 1YP7A 3VG6A 3HWGA 4YKOA 4UU2A 2QO4A 1YIVA 4MISA 4CV7A 1UZ2X 2MJIA 2Q39A 1SA8A 2OVDA 4YH0A 2RA6A 1IKJA 2Z4IA 3ELXA 4KC7A 1S44A 3NQ9A 1JV4A 3B2LA 3FMZA 2HLVA 4AZNA 1CJ5A 2MWHA 3JSQA 3RBYA 3KQ0A 3CR6A 5LKFA 2AMMX 4EFGA 1P6PA 2OVAA 3EM0A 4YBUA 5H9NA 2RQ0A 2WQAE 4I6SA 2AT8X 3UEUA 3WVMA 4AYHA 4ZR2A 5HA1A 1EXSA 2BHVA 3KFHA 4MVKA 5AJCA 3ZUOA 4AW8A 4YBPA 2QM9A 3FELA 1ZNGA 2N93A 1OBPA 4HWMA 3CQRA 4M7MA 3B2KA 4EQAC 3P6CA 2A0AA 4A60A 1QABE 3P6DA 1ICNA 1HMRA 4NNSA 3EYCA 3S26A 1X8NA 4TQ2A 4N7DA 1O8VA 1N0SA 5D8JA 4ORRA 4YFRA 4KT5A 4OS0A 1GGLA 3TZSA 1IIUA 1JYJA 1X8QA 3P6FA 4ES7A 4QZTA 5DG4A 1LICA 1YWCA 2K23A 4WBKA 4I3DA 1HBQA 4NNTA 2WR6A 2X45A 3HK1A 4YCEA 3VPJE 5KIDA 2AL0X 4OMXA 2KT4B 3D96A 4O3XB 3WJGA 3NR3A 4QGWA 4ALBA 2BS5A 1E02A 3STNA 4L1NA 3VG5A 4D6AA 4IAWA 4PSQA 5EEDA 5DPQA 2OZQA 4ON1A 1U17A 2QOSC 3KFGA 3D95A 3BU1A 3I17A 2JW1A 3N91A 1A18A 1BJ7A 3HOEA 1VYGA 4IB9A 5KICA 5BVQA 3ZW0A 3NQ3A 3U9PC 2M4LA 4YGGA 2MHDA 3ZI8A 5HZ5A 3HTYA 5KHPA 4CK4A 1TW4A 2LKKA 4LKTA 4RUUA 4ZJ0A 3WXQA 1B4MA 1KT6A 4QYPA 3WJBA 1JZUA 3FIQA 2AT3X 3F6ZB 3BRNA 1AVGI 2WWPA 3B2IA 3MX7A 1SY1A 4BVMA 1KT7A 2L9CA 1E00A 3MBTA 3FA9A 4NYQA 1QY2A 1ZNHA 3HWDA 5LJDA 5HCDC 4JGLA 5HCEC 1SXYA 3QKGA 3TGAA 2ANSA 3NADA 5D4AA 2GTFX 1DZKA 1MUPA 2DM5A 5AQ6A 4YFQA 1CBRA 1G74A 2JU8A 3NX2A 2GC9A 4IABA 5IO5A 2QO5A 3ZWEA 2F09A 4ORWA 2RCTA 3F8AA 5HZQA 4DQ4A 2AT0X 1EALA 4AZOA 1HMSA 2LA7A 3FA6A 4FQBB 4GH7A 3WJFA 3F9DA 1HN2A 2FT9A 4AZRA 1AELA 1O1UA 1LF7A 3DTQA 4O3YA 1LIBA 4I9SA 2FS7A 1ACDA 5HBSA 1PMPA 5LJCA 1DZMA 2GTLO 5HCCC 4Y0RA 3ZQ3A 4FBOA 1G7NA 4Y0QA 1KGLA 3FW4A 3UAQA 4ZHHA 5B29A 3WJCA 2NNDA 1SXWA 5HA0A 3DSZA 4MVEA 2O62A 3FA8A 4MIRA 2BS6A 1JYDA 2LBAA 5LJHA 5LJGA 4BQUA 1I04A 1PM1X 1ERXA 2HZQA 2ZAIA 3EBWA 3CWKA 4ORXA 1CBIA 1EQDA 3AKMA 1HBPA 3APVA 3FLLA 3NPOA 5EEEA 2Q4NA 4IB6A 5EPQA 4COTA 4CSBA 4BOEA 4XMDA 4XMHA 1KOIA 1PBOA 3BLGA 4EEJA 4O4SA 2G78A 1EPBA 3EMMA 2FR2A 3O22A 3PPTA 3B2JA 2Q2MA 5BYPA 3FR5A 4ZHCA 1B0OA 1T68X 4WFVA 3VE2A 4IBAA 3RKGA 4FBRA 2JMBA 3NBXX 2FWVA 3UEVA 2KD2A 1R0UA 4KC8A 1AQBA 2LFOA 1OEEA 1JIWI 4YDBA 4KCAA 5JR8A 1TVQA 2ALLX 1VYFA 2W2BA 3FA7A 1QY1A 3PQSA 3JS1A 1KQWA 2Z4HA 2G79A 4I3BA 4YMYA 1LKEA 2OFRX 2OFMX 3WOVA 4TKBA 1BM5A 1NP4A 5FAZA 3S5XA 3APUA 1GKAB 2HZRA 2KW1A 3PQUA 4ZH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LFO A;  1YWD A;  4RUN A;  4KII A;  1ZNK A;  2FLJ A;  1HMT A;  3P6E A;  2FR3 A;  3VG7 A;  4I9R A;  4XMC A;  4ZH6 A;  5HWZ A;  3Q6L A;  5LJK A;  1HQP A;  2L68 A;  3P6G A;  4GE1 A;  1KT4 A;  2Q9S A;  4HPB A;  1SY2 A;  1CBS A;  5K06 A;  2MM3 A;  4GNW A;  4XMF A;  4ZHF A;  1FEN A;  2KTD A;  2CM4 A;  2K62 A;  2HYS A;  1FE3 A;  4M6S A;  1TOW A;  1G85 A;  2F73 A;  4N7C A;  1ZNL A;  1IW2 A;  1CBQ A;  3BX7 A;  1T8V A;  2CBR A;  2WEW A;  5HZ6 A;  3BX8 A;  3C76 X;  3ZUI A;  1YWA A;  1B8E A;  1OEK A;  3PED A;  1GX8 A;  1GT3 A;  2ACO A;  4ZHD A;  4ORS A;  3PH5 A;  1L6M A;  1PEE A;  4HFO A;  1MX8 A;  1GT5 A;  5H9A A;  5D47 A;  1E06 A;  4Y0P A;  4A1H A;  5CE4 A;  1G5W A;  1T0V A;  1I4U A;  3C78 X;  2AH7 X;  1OBQ A;  2L5P A;  4QGV A;  3CMP A;  1YUP A;  3KFI A;  4ODD A;  3WJE A;  2CZT A;  3PP6 A;  3IFB A;  4UU3 A;  4GNY A;  3BU9 A;  5L8N A;  3EBK A;  4GKC A;  2NNQ A;  2W2F A;  2ASN X;  3PEC A;  4YGZ A;  2HMB A;  1DV9 A;  2A2G A;  1NP1 A;  1KT3 A;  5C0N A;  3CBS A;  1TOU A;  1QFV A;  1RLB E;  2A2U A;  4LZV A;  4ORY A;  1OPA A;  3RZY A;  4TJZ A;  1H91 A;  1Z24 A;  3U0D A;  2W2A A;  5EZ2 A;  5F1E A;  3VG4 A;  4I3C A;  1GM6 A;  5D45 A;  4AZM A;  2NP1 A;  1QQS A;  1MX7 A;  3OJY C;  3VG2 A;  3HWE A;  4O9S A;  5EDB A;  3G7X A;  3PH6 A;  1AB0 A;  1KZX A;  1VPR A;  4AZP A;  1JBH A;  1GXA A;  1KZW A;  4LKP A;  1BRQ A;  2WUT A;  3FR2 A;  3NP1 A;  1XCA A;  2LB6 A;  4EDE A;  1ZRY A;  1FDQ A;  2YG2 A;  3I0A A;  4ZCB A;  2LBV A;  4A8Z A;  1KQX A;  1MVG A;  4HPA A;  4TKJ A;  4TNN A;  4GET A;  5BVS A;  2P8G A;  3TGC A;  4LZU A;  4MVL A;  3APW A;  4Y0S A;  5L8O A;  4EXZ A;  3BS2 A;  4ARH A;  3C77 X;  1ICM A;  1JJJ A;  4HPC A;  2G7B A;  4YCH A;  5FFH A;  2JU3 A;  1X8O A;  3ELZ A;  3P6H A;  4OS3 A;  1SY0 A;  1IFB A;  3AKN A;  1QG5 A;  1S7D A;  3MVF A;  4D6B A;  1D3S A;  4IB8 A;  1OPB A;  4IMN A;  2R73 A;  3SAO A;  1BLR A;  1E5P A;  2FRS A;  1SXU A;  5LKE A;  1GKA A;  1A57 A;  2R56 A;  5FEN A;  1OBU A;  5HZ8 A;  1LIF A;  3FEP A;  1A2D A;  2RCQ A;  2QO6 A;  3IA8 A;  1X89 A;  1KT5 A;  3O2Y A;  4NP1 A;  5H8T A;  1I05 A;  4DQ3 A;  4AZQ A;  2HNX A;  2CM9 A;  1URE A;  5IO6 A;  4GRJ A;  1CRB A;  1ZND A;  1FEL A;  2WSJ A;  3BSZ E;  2Q2P A;  4A1Y A;  2JN3 A;  4IB7 A;  1BRP A;  1YP6 A;  5H9L A;  4ALO A;  4HPD A;  2PY1 A;  3APX A;  1LID A;  3NX1 A;  3KFF A;  2POA A;  4YGH A;  3WJD A;  1YWB A;  1U18 A;  1BEB A;  2AKQ A;  1D2U A;  2FS6 A;  5HTD A;  5LJB A;  1OEJ A;  3STM X;  3KZA A;  3GAQ A;  1LNM A;  5IO7 A;  4ORU A;  1BSO A;  1DFV A;  1MDC A;  4TLJ A;  2RD7 C;  2JOZ A;  4ZFX A;  3FW5 A;  1DZP A;  3CBC A;  2XKL A;  3BDR A;  1KXO A;  2IFB A;  2OVE A;  1A3Y A;  1EII A;  2L67 A;  2NNE A;  4XMG A;  5LJE A;  1LPJ A;  4YKM A;  2A3F X;  1LIE A;  2MO5 A;  4NLI A;  1DF3 A;  1ERB A;  4QZU A;  5F7G A;  2R74 A;  1GT4 A;  4YDA A;  5BVT A;  1GT1 A;  1BBP A;  1EIO A;  1QFT A;  1QY0 A;  3T1D A;  3BY0 A;  2A13 A;  3FEK A;  1O1V A;  5H9K A;  5L8I A;  4NYR A;  3L4R A;  4QYN A;  3TGB A;  2JU7 A;  5HAE A;  3HWF A;  1ML7 A;  2WQ9 A;  2FTB A;  1RBP A;  3WBG A;  1JJX A;  1DZJ A;  2ACP X;  3UEW A;  1U0X A;  1BWY A;  2E4J A;  4OS8 A;  4OMW A;  1ADL A;  1NGL A;  1IFC A;  4IAX A;  3STK A;  1GX9 A;  1I06 A;  2CZU A;  1FEM A;  4NLJ A;  4QAE A;  4MVI A;  4R0B A;  1X71 A;  3O19 A;  1DC9 A;  3FR4 A;  5HZ9 A;  3TF6 A;  3K3L A;  1IKE A;  1BSQ A;  4XME A;  3B2H A;  4TKH A;  1SY3 A;  2XST A;  5F58 A;  5F6Z A;  1ALB A;  5D48 A;  1EW3 A;  2BLG A;  4YFP A;  1X8U A;  1TXL A;  1X8P A;  3VG3 A;  3D97 A;  1S2P A;  4QGX A;  1B56 A;  5EDC A;  1FTP A;  2CBS A;  4WFU A;  5F6B A;  3UEX A;  4ZHG A;  3FEN A;  3RSW A;  2AT5 X;  2X46 A;  1XKI A;  2GJ5 A;  4K19 A;  5HTE A;  1ZNE A;  1SXX A;  3CQN A;  1EPA A;  1QWD A;  2AT6 X;  3U03 A;  1BSY A;  2EU7 X;  2WEX A;  5B27 A;  4ZGU A;  1EUO A;  4IMO A;  1YP7 A;  3VG6 A;  3HWG A;  4YKO A;  4UU2 A;  2QO4 A;  1YIV A;  1UZ2 X;  2MJI A;  2Q39 A;  1SA8 A;  2OVD A;  4YH0 A;  2RA6 A;  1IKJ A;  3ELX A;  1S44 A;  3NQ9 A;  1JV4 A;  3B2L A;  3FMZ A;  2HLV A;  4AZN A;  1CJ5 A;  3JSQ A;  3KQ0 A;  3CR6 A;  5LKF A;  2AMM X;  4EFG A;  1P6P A;  2OVA A;  3EM0 A;  4YBU A;  5H9N A;  2RQ0 A;  2WQA E;  2AT8 X;  3UEU A;  3WVM A;  4AYH A;  4ZR2 A;  5HA1 A;  1EXS A;  3KFH A;  4AW8 A;  4MVK A;  3ZUO A;  4YBP A;  2QM9 A;  3FEL A;  1ZNG A;  2N93 A;  1OBP A;  4M7M A;  3CQR A;  3B2K A;  3P6C A;  2A0A A;  4A60 A;  1QAB E;  3P6D A;  1ICN A;  1HMR A;  4NNS A;  3EYC A;  3S26 A;  1X8N A;  4TQ2 A;  4N7D A;  1O8V A;  1N0S A;  5D8J A;  4ORR A;  4YFR A;  4OS0 A;  1GGL A;  3TZS A;  1IIU A;  1JYJ A;  1X8Q A;  3P6F A;  4ES7 A;  4QZT A;  5DG4 A;  1LIC A;  1YWC A;  2K23 A;  4WBK A;  4I3D A;  1HBQ A;  4NNT A;  2WR6 A;  2X45 A;  3HK1 A;  4YCE A;  5KID A;  2AL0 X;  4OMX A;  2KT4 B;  3D96 A;  3WJG A;  3NR3 A;  4QGW A;  4ALB A;  1E02 A;  3STN A;  3VG5 A;  4D6A A;  4IAW A;  4PSQ A;  5EED A;  5DPQ A;  2OZQ A;  1U17 A;  2QOS C;  3KFG A;  3D95 A;  3BU1 A;  3I17 A;  1A18 A;  1BJ7 A;  4IB9 A;  1VYG A;  5KIC A;  5BVQ A;  3NQ3 A;  3U9P C;  4YGG A;  5HZ5 A;  5KHP A;  4CK4 A;  1TW4 A;  2LKK A;  4LKT A;  4RUU A;  4ZJ0 A;  3WXQ A;  1B4M A;  1KT6 A;  4QYP A;  3WJB A;  1JZU A;  3FIQ A;  2AT3 X;  3BRN A;  1AVG I;  2WWP A;  3B2I A;  1SY1 A;  4BVM A;  1KT7 A;  2L9C A;  1E00 A;  3MBT A;  3FA9 A;  4NYQ A;  1QY2 A;  1ZNH A;  3HWD A;  5LJD A;  5HCD C;  5HCE C;  1SXY A;  3QKG A;  3TGA A;  2ANS A;  3NAD A;  5D4A A;  2GTF X;  1DZK A;  1MUP A;  2DM5 A;  5AQ6 A;  4YFQ A;  1CBR A;  1G74 A;  2JU8 A;  3NX2 A;  2GC9 A;  5IO5 A;  2QO5 A;  4ORW A;  2RCT A;  3F8A A;  5HZQ A;  4DQ4 A;  2AT0 X;  1EAL A;  4AZO A;  1HMS A;  3FA6 A;  4GH7 A;  3WJF A;  3F9D A;  1HN2 A;  2FT9 A;  4AZR A;  1AEL A;  1O1U A;  1LF7 A;  3DTQ A;  1LIB A;  4I9S A;  2FS7 A;  1ACD A;  5HBS A;  1PMP A;  5LJC A;  1DZM A;  5HCC C;  4Y0R A;  3ZQ3 A;  1G7N A;  4Y0Q A;  1KGL A;  3FW4 A;  4ZHH A;  5B29 A;  3WJC A;  2NND A;  1SXW A;  5HA0 A;  3DSZ A;  2O62 A;  3FA8 A;  1JYD A;  2LBA A;  5LJH A;  5LJG A;  4BQU A;  1I04 A;  1PM1 X;  1ERX A;  2HZQ A;  3EBW A;  3CWK A;  4ORX A;  1CBI A;  1EQD A;  3AKM A;  1HBP A;  3APV A;  3FLL A;  3NPO A;  5EEE A;  2Q4N A;  4IB6 A;  5EPQ A;  4BOE A;  4XMD A;  4XMH A;  1KOI A;  1PBO A;  3BLG A;  4EEJ A;  2G78 A;  1EPB A;  3EMM A;  2FR2 A;  3O22 A;  3PPT A;  3B2J A;  2Q2M A;  3FR5 A;  4ZHC A;  1B0O A;  1T68 X;  4WFV A;  4IBA A;  2FWV A;  3UEV A;  1R0U A;  1AQB A;  2LFO A;  1OEE A;  4YDB A;  5JR8 A;  1TVQ A;  2ALL X;  1VYF A;  2W2B A;  3FA7 A;  1QY1 A;  3JS1 A;  1KQW A;  2G79 A;  4I3B A;  4YMY A;  1LKE A;  2OFR X;  2OFM X;  4TKB A;  1BM5 A;  1NP4 A;  5FAZ A;  3APU A;  1GKA B;  2HZR A;  4ZH9 A; 
#chains in the Genus database with same CATH topology
 1LFO A;  1YWD A;  4RUN A;  4BX5 A;  4KII A;  1ZNK A;  2RTL A;  2FLJ A;  1HMT A;  3P6E A;  2FR3 A;  4JNJ A;  1HY2 A;  4I9R A;  1W5R A;  3HOL A;  3Q6L A;  4XMC A;  1HQP A;  2L68 A;  3P6G A;  4GE1 A;  4ZH6 A;  1KT4 A;  2Q9S A;  4HPB A;  1SY2 A;  2F01 A;  4BCS A;  1CBS A;  3VE1 A;  5K06 A;  2MM3 A;  4GNW A;  2X8F A;  2RTG B;  1VYO A;  2ZAG A;  3D4R A;  4U8U M;  4XMF A;  4ZHF A;  1FEN A;  2KTD A;  2CM4 A;  3ZW1 A;  2K62 A;  2HYS A;  4NV7 A;  1FE3 A;  4M6S A;  4BX5 B;  1TOW A;  1G85 A;  1SWL A;  1Y9L A;  1ZNL A;  2F73 A;  4N7C A;  1IW2 A;  1CBQ A;  3BX7 A;  1T8V A;  1SWS A;  2CBR A;  2WEW A;  5CYB A;  5HZ6 A;  1N9Y A;  2HKD A;  3BX8 A;  3C76 X;  3ZUI A;  1YWA A;  1B8E A;  1OEK A;  3PED A;  1GT3 A;  1GX8 A;  3SZI A;  1LUQ A;  3ZW1 B;  2ACO A;  3S5V A;  4ZHD A;  4ORS A;  3PH5 A;  1L6M A;  1PEE A;  1KL5 A;  4HFO A;  1MX8 A;  1GT5 A;  2IZE B;  5H9A A;  5D47 A;  1E06 A;  4Y0P A;  4Y5D A;  4A1H A;  5CE4 A;  1G5W A;  1T0V A;  4FGI B;  1I4U A;  3C78 X;  2AH7 X;  1OBQ A;  3EW1 A;  5FQ7 E;  2L5P A;  1I9H A;  4QGV A;  3CMP A;  1YUP A;  3KFI A;  4ODD A;  3WJE A;  2CZT A;  3PP6 A;  3IFB A;  4UU3 A;  2OY1 O;  1KFF A;  1PTS A;  2G5L A;  4GNY A;  3BU9 A;  4CDF A;  3VU1 A;  2C1S A;  3EBK A;  4GKC A;  5L8N A;  1NQM A;  2DJG A;  2NNQ A;  2W2F A;  5AEO A;  2ASN X;  3PEC A;  4YGZ A;  2HMB A;  1DV9 A;  2X8T A;  2A2G A;  2I5Z O;  1NP1 A;  1KT3 A;  2AVI A;  2OYB O;  4C5P A;  5C0N A;  3CBS A;  4GD9 A;  4GGT A;  1TOU A;  1QFV A;  2Y3E A;  1RLB E;  4KH8 A;  2A2U A;  3SZJ A;  1HXL A;  4LZV A;  4ORY A;  1OPA A;  3RZY A;  4TJZ A;  5IXG A;  4ID2 A;  2VDF A;  3CKF A;  1H91 A;  3SLO A;  2RTE B;  1K3B A;  1Z24 A;  1LDO A;  3U0D A;  2W2A A;  1W6F A;  5EZ2 A;  4O4X A;  4PJ2 A;  5F1E A;  1VWA B;  2X34 A;  4I3C A;  3VG4 A;  1GM6 A;  3VG7 A;  2IZF B;  5D45 A;  1SWE A;  4EKV A;  3T6F A;  4AZM A;  2NP1 A;  1QQS A;  1SWR A;  1MX7 A;  3OJY C;  3VG2 A;  3HWE A;  4O9S A;  3Q34 A;  5EDB A;  3WZN A;  2VFC A;  3G7X A;  3PH6 A;  1AB0 A;  3ZW2 A;  1KZX A;  2BT9 A;  1VPR A;  2FHL A;  4AZP A;  1JBH A;  1GXA A;  2FKJ A;  1KZW A;  4LKP A;  1BRQ A;  4GU8 A;  1Y53 X;  2X56 A;  2WUT A;  3WYP A;  3FR2 A;  4Z27 A;  5B10 O;  3NP1 A;  1SWH A;  1XCA A;  2LB6 A;  2RTN B;  2RTI B;  3EC5 A;  1ZRY A;  1AVD A;  1FDQ A;  2YG2 A;  2X8S A;  3I0A A;  4ZCB A;  1KQX A;  1MVG A;  3P24 A;  2LBV A;  4A8Z A;  4HPA A;  4TKJ A;  4TNN A;  4GET A;  1MOY A;  5LJK A;  3SOT A;  5BVS A;  2P8G A;  3TGC A;  2WPU A;  4LZU A;  4MVL A;  3APW A;  4NV8 A;  1N4J A;  1VWM B;  2RTO B;  1I78 A;  4Y0S A;  4OEM A;  2RN4 A;  2ZSC A;  5L8O A;  1MEP A;  4EXZ A;  3BS2 A;  4ARH A;  3C77 X;  1ICM A;  4ZGF A;  1JJJ A;  4HPC A;  2G7B A;  4YCH A;  3JQO A;  2RTP B;  5FFH A;  1X8O A;  2JU3 A;  3ELZ A;  1VWO B;  3P6H A;  4OS3 A;  1SY0 A;  1IFB A;  1SLD B;  3AKN A;  1QG5 A;  1S7D A;  3RDO A;  3MVF A;  4D6B A;  1D3S A;  4IB8 A;  1OPB A;  4IMN A;  2R73 A;  3VHM A;  3SAO A;  1BLR A;  1E5P A;  2FRS A;  1SXU A;  3WZO A;  5LKE A;  1GKA A;  1LCV A;  1A57 A;  2R56 A;  5B3M O;  5FEN A;  3P02 A;  4Z6J A;  3OD9 A;  1OBU A;  3GE2 A;  5HZ8 A;  1LIF A;  1VWR B;  3FEP A;  1A2D A;  1SRG A;  2OY8 A;  4FBV A;  4BBO A;  2RCQ A;  2QO6 A;  3MG5 A;  4QRL A;  4Z2P A;  3IA8 A;  1X89 A;  4U3Q A;  1KT5 A;  2I5V O;  3O2Y A;  4INN A;  1NBX A;  4NP1 A;  2OY5 O;  5H8T A;  1I05 A;  4DQ3 A;  4AZQ A;  2HNX A;  2CM9 A;  1URE A;  5IO6 A;  4GRJ A;  1CRB A;  1ZND A;  1FEL A;  2WSJ A;  3BSZ E;  1SRI A;  2Q2P A;  4A1Y A;  1JQP A;  2JN3 A;  4IB7 A;  1BRP A;  4QQ1 A;  1YP6 A;  5H9L A;  2OVS A;  4WHI A;  4ALO A;  1RXK A;  4HPD A;  4CDD A;  2PY1 A;  3NQK A;  4BX7 A;  4Z2V A;  2RTA A;  3APX A;  1LID A;  1EI5 A;  3NX1 A;  4L3R A;  3KFF A;  2POA A;  3CKG A;  4O49 A;  4YGH A;  3LHN A;  3RDS A;  3RWX A;  1LEL A;  3WJD A;  1YWB A;  1U18 A;  1BEB A;  2AKQ A;  1D2U A;  2FS6 A;  4ML7 B;  5HTD A;  5LJB A;  1OEJ A;  3T2W A;  3STM X;  1HXZ A;  3GAQ A;  1LNM A;  3KZA A;  2GTL M;  4ORU A;  5IO7 A;  2FKG A;  2OL7 A;  1BSO A;  1DFV A;  1SWP A;  1MDC A;  4TLJ A;  2RD7 C;  2JOZ A;  1SWG A;  4U8U N;  4BX7 B;  3FW5 A;  1DZP A;  3CBC A;  4MEE A;  4ZFX A;  2XKL A;  3BDR A;  4BJ8 A;  1KXO A;  2FGS A;  2GTL N;  2IFB A;  3WYQ A;  2OVE A;  1A3Y A;  1EII A;  2L67 A;  2NNE A;  4XMG A;  5LJE A;  4CPF A;  1LPJ A;  4GZV A;  3RE6 A;  1SLF B;  3D9W A;  1SWK A;  3H3I A;  4YKM A;  2A3F X;  1UYO X;  1LIE A;  1SRE A;  2MO5 A;  4NLI A;  1DF3 A;  1ERB A;  1VWB B;  4GUZ A;  4QZU A;  5F7G A;  2R74 A;  4LQZ A;  4O4O A;  1DF8 A;  1GT4 A;  3PDF A;  2RTC B;  4YDA A;  3FDC A;  5BVT A;  3RY1 A;  1GT1 A;  1BBP A;  1EIO A;  1QFT A;  2RTR B;  1QY0 A;  4DNE A;  3T1D A;  1STR B;  2QMI A;  3BY0 A;  4DCB A;  2A13 A;  3FEK A;  5IRA A;  1O1V A;  5H9K A;  5L8I A;  1WUB A;  3L4R A;  4NYR A;  4QYN A;  5B11 O;  3TGB A;  4O3Z A;  2JU7 A;  5FQ6 E;  3RDU A;  2YMS A;  3ZZV A;  5HAE A;  3HWF A;  1ML7 A;  1SWD A;  3SZH A;  2WQ9 A;  2FTB A;  4EDE A;  1RBP A;  1KL4 A;  4GK9 A;  3WBG A;  4Z28 A;  1JJX A;  2X55 A;  4QNI A;  1DZJ A;  4GDZ A;  4GGZ A;  3OBL A;  5AJB A;  2ACP X;  3E3C A;  3UEW A;  1U0X A;  1BWY A;  2E4J A;  4OS8 A;  3ZW0 B;  3OE3 A;  4OMW A;  2JGS A;  3X00 A;  1ADL A;  1NGL A;  1IFC A;  4NW4 A;  2MF6 A;  4IAX A;  5FQ8 E;  1SMP I;  4CDE A;  1PBY A;  4CPH B;  3STK A;  3AUM O;  1GX9 A;  1I06 A;  2CZU A;  1FEM A;  4NLJ A;  4QAE A;  4BX6 B;  4MVI A;  2VFB A;  4R0B A;  3FID A;  1X71 A;  3VHI A;  3O19 A;  1DC9 A;  3T2X A;  2RTQ B;  5K67 A;  4JO6 A;  3FR4 A;  5HZ9 A;  3TF6 A;  1Y52 X;  3K3L A;  3VHH A;  1VWH B;  5L3Y A;  1IKE A;  1BSQ A;  2KTS A;  4XME A;  3B2H A;  4GJV A;  4TKH A;  1SY3 A;  2XST A;  4O4U A;  5F6Z A;  1ALB A;  2OF9 A;  5D48 A;  1EW3 A;  5F58 A;  2C1Q A;  2BLG A;  4YFP A;  1X8U A;  4U9C A;  1TXL A;  1RAV A;  1X8P A;  4U8U O;  3VG3 A;  4BGF A;  3D97 A;  1S2P A;  3LTW A;  2IZG B;  4QGX A;  1B56 A;  5EDC A;  1FTP A;  2CBS A;  4WFU A;  1VWF B;  4O3W A;  5F6B A;  3UEX A;  4ZHG A;  1NQN A;  3FEN A;  3RSW A;  2AT5 X;  1VWC B;  2X46 A;  3QQ2 A;  1XKI A;  2GJ5 A;  2IZL B;  4K19 A;  5HTE A;  1E2T A;  1ZNE A;  3S60 A;  4I95 A;  1SXX A;  3CQN A;  3FYF A;  3V8U A;  1EPA A;  1QWD A;  1Y9T A;  2A5C A;  2AT6 X;  3U03 A;  2RTH B;  1SLG B;  3LV4 A;  1BSY A;  2EU7 X;  2WEX A;  4OEL A;  5B27 A;  4ZGU A;  1EUO A;  2OL8 O;  4IMO A;  1YP7 A;  3VG6 A;  2RTJ A;  3HWG A;  4YKO A;  4UU2 A;  2QO4 A;  1YIV A;  1WBI A;  4MIS A;  4CV7 A;  1UZ2 X;  2MJI A;  1N9M A;  1GX3 A;  2Q39 A;  1SA8 A;  4OKA A;  2OVD A;  4YH0 A;  2RA6 A;  4CPI A;  1IKJ A;  4Z2O A;  2Z4I A;  3ELX A;  4KC7 A;  1S44 A;  3NQ9 A;  1SWJ A;  1VWN B;  1AVE A;  1JV4 A;  3B2L A;  3FMZ A;  2HLV A;  4AZN A;  1CJ5 A;  2IZI A;  2MWH A;  1UYN X;  3JSQ A;  3RBY A;  3KQ0 A;  3CR6 A;  5LKF A;  2AMM X;  4EFG A;  1P6P A;  4CDC A;  2OVA A;  2Y3F A;  3EM0 A;  2OY7 A;  4YBU A;  5H9N A;  5B5F A;  1JJU A;  2RQ0 A;  2RTB B;  2WQA E;  4I6S A;  5IRU A;  2AT8 X;  1VWL B;  2DJF A;  3UEU A;  3WVM A;  4AYH A;  2RTM A;  4ZR2 A;  1NC9 A;  5HA1 A;  1W4T A;  3WZQ A;  3SLT A;  1EXS A;  2BHV A;  3KFH A;  4MVK A;  5AJC A;  3ZUO A;  4AW8 A;  4YBP A;  4YVB A;  2QM9 A;  2RTF B;  3FEL A;  1SWT A;  1ZNG A;  2N93 A;  1OBP A;  4HWM A;  3CQR A;  4M7M A;  3B2K A;  4EQA C;  3P6C A;  2A0A A;  4A60 A;  2IZK A;  5IRW A;  1QAB E;  1RXJ A;  3P6D A;  1ICN A;  1HMR A;  1RXH A;  4NNS A;  3EYC A;  3S26 A;  5K68 A;  1X8N A;  4TQ2 A;  4N7D A;  2X4M A;  1O8V A;  1N0S A;  5D8J A;  4ORR A;  4YFR A;  4KT5 A;  4OS0 A;  1RSU B;  1GGL A;  3TZS A;  1IIU A;  1JYJ A;  1X8Q A;  3P6F A;  4ES7 A;  4QZT A;  5DG4 A;  2CAM A;  1LIC A;  1YWC A;  2K23 A;  4WBK A;  1SLE B;  4I3D A;  1HBQ A;  2IZB A;  4NNT A;  1SWN A;  2WR6 A;  2X45 A;  3HK1 A;  4YCE A;  3VPJ E;  5KID A;  2AL0 X;  4OMX A;  1JMX A;  2KT4 B;  3D96 A;  4O3X B;  1LCW A;  3WJG A;  2OL6 O;  3NR3 A;  4QGW A;  1HQQ A;  2BS5 A;  3RDM A;  1E02 A;  3HPE A;  4L1N A;  3RE5 A;  1KL3 A;  1JMZ A;  3STN A;  3VG5 A;  5CHK A;  4D6A A;  2X32 A;  1SWQ A;  4GGR A;  4IAW A;  3AEH A;  4PSQ A;  5EED A;  1IJ8 A;  5DPQ A;  2OZQ A;  1SWO A;  1U17 A;  2QOS C;  4ON1 A;  3KFG A;  3D95 A;  3BU1 A;  5CSE A;  3I17 A;  2JW1 A;  3N91 A;  3PK2 A;  1RST B;  1A18 A;  1BJ7 A;  3HOE A;  1VYG A;  2BSZ A;  4IB9 A;  1VWK B;  2BC3 A;  5KIC A;  5BVQ A;  3ZW0 A;  3NQ3 A;  3U9P C;  2M4L A;  4YGG A;  2MHD A;  5B5G A;  2AF5 A;  3ZI8 A;  5HZ5 A;  3HTY A;  4IRW A;  1VWG B;  5KHP A;  4CPH A;  4CK4 A;  1TW4 A;  2G8C O;  2OFA A;  2LKK A;  2OF8 A;  4LKT A;  4RUU A;  3WZP A;  1OSP O;  4BX6 A;  1Y0G A;  4ZJ0 A;  3WXQ A;  1B4M A;  1KT6 A;  4QYP A;  3WJB A;  4ALB A;  1STS B;  1JZU A;  3FIQ A;  1Y55 X;  4GDA A;  2AT3 X;  3F6Z B;  1VWJ B;  3BRN A;  1AVG I;  2WWP A;  3B2I A;  1MM9 A;  3MX7 A;  1SY1 A;  4BVM A;  1KT7 A;  2L9C A;  1E00 A;  3MBT A;  3FA9 A;  4NYQ A;  1QY2 A;  1ZNH A;  3HWD A;  5LJD A;  3SLJ A;  5HCD C;  2PI3 O;  4JGL A;  5HCE C;  4Y59 A;  1SXY A;  3QKG A;  3TGA A;  2ANS A;  2IZD B;  3NAD A;  4CPE A;  5D4A A;  2GTF X;  2IZJ A;  1VWQ B;  1DZK A;  1MUP A;  2DM5 A;  3T6L A;  3VGW A;  5AQ6 A;  4YFQ A;  1CBR A;  1G74 A;  2JU8 A;  1MK5 A;  2GC9 A;  3NX2 A;  4IAB A;  5IO5 A;  4B55 A;  1SRJ A;  2QO5 A;  3ZWE A;  5F2B A;  2F09 A;  1SWU A;  2RTD B;  4ORW A;  2RCT A;  3F8A A;  1SWC A;  5HZQ A;  4DQ4 A;  2AT0 X;  1EAL A;  4AZO A;  1N7Y A;  1HMS A;  2LA7 A;  3FA6 A;  4FQB B;  4GH7 A;  3WJF A;  3F9D A;  1HN2 A;  2FT9 A;  4AZR A;  5HWZ A;  1AEL A;  1O1U A;  1LF7 A;  1SWA A;  2IZH B;  3DTQ A;  1LIB A;  3MM0 A;  2FS7 A;  1ACD A;  1VWP B;  4I9S A;  1PMP A;  4O3Y A;  5HBS A;  1DZM A;  2GTL O;  5HCC C;  4Y0R A;  5LJC A;  1VWE B;  2GH7 A;  4FBO A;  1G7N A;  3ZQ3 A;  4Y0Q A;  1KGL A;  3FW4 A;  3UAQ A;  4ZHH A;  5B29 A;  3WJC A;  2NND A;  1SXW A;  5HA0 A;  3DSZ A;  1SRF A;  4MVE A;  3RY2 A;  1SWF A;  2O62 A;  3FA8 A;  4MIR A;  2BS6 A;  1JYD A;  2LBA A;  5LJH A;  5LJG A;  4BQU A;  1I04 A;  1PM1 X;  1ERX A;  2HZQ A;  2ZAI A;  3EBW A;  3RDX A;  3CWK A;  4ORX A;  5B2A O;  1CBI A;  1EQD A;  3AKM A;  1HBP A;  1K24 A;  3APV A;  3FLL A;  3NPO A;  5EEE A;  2Q4N A;  4IB6 A;  5EPQ A;  4COT A;  4CSB A;  4BOE A;  4XMD A;  4XMH A;  1KOI A;  1PBO A;  3BLG A;  4EEJ A;  4O4S A;  2G78 A;  3RDQ A;  2A5B A;  2OFB A;  1EPB A;  3EMM A;  2FR2 A;  2QOM A;  2IZA A;  3EW2 A;  3O22 A;  3PPT A;  3B2J A;  2Q2M A;  5BYP A;  3FR5 A;  4ZHC A;  2UZ2 A;  1B0O A;  1T68 X;  4WFV A;  3VE2 A;  4IBA A;  3RKG A;  2FHN X;  4FBR A;  2QCB A;  2JMB A;  3NBX X;  1STP A;  1FJ1 E;  2FWV A;  3UEV A;  4I60 A;  2KD2 A;  1R0U A;  4KC8 A;  5JD2 A;  1AQB A;  2LFO A;  1OEE A;  1JIW I;  4GJS A;  4YDB A;  4KCA A;  2Y32 A;  1TVQ A;  2ALL X;  5JR8 A;  4JHQ A;  1N43 A;  2RTK A;  1SWB A;  1VWI B;  1VYF A;  1QY1 A;  2C4I A;  2W2B A;  3FA7 A;  3PQS A;  3JS1 A;  4U46 A;  1KQW A;  2Z4H A;  1LCZ A;  2G79 A;  4I3B A;  2UYW A;  1LDQ A;  4YMY A;  1LKE A;  1SRH A;  1VWD B;  2OFR X;  2OFM X;  2IZC B;  3WOV A;  4TKB A;  1BM5 A;  1NDJ A;  1NP4 A;  2A8G A;  5FAZ A;  3KVN A;  3APU A;  3S5X A;  1GKA B;  2HZR A;  2KW1 A;  3PQU A;  4ZH9 A; 
#chains in the Genus database with same CATH homology
 1LFO A;  1YWD A;  4RUN A;  4KII A;  1ZNK A;  2FLJ A;  1HMT A;  3P6E A;  2FR3 A;  3VG7 A;  4I9R A;  4XMC A;  4ZH6 A;  3HOL A;  3Q6L A;  5HWZ A;  1HQP A;  2L68 A;  3P6G A;  4GE1 A;  1KT4 A;  2Q9S A;  4HPB A;  1SY2 A;  1CBS A;  3VE1 A;  5K06 A;  2MM3 A;  4GNW A;  2X8F A;  2ZAG A;  3D4R A;  4U8U M;  4XMF A;  4ZHF A;  1FEN A;  2KTD A;  2CM4 A;  3ZW1 A;  2K62 A;  2HYS A;  1FE3 A;  4M6S A;  1TOW A;  1G85 A;  1Y9L A;  2F73 A;  1ZNL A;  4N7C A;  1IW2 A;  1CBQ A;  3BX7 A;  1T8V A;  2CBR A;  2WEW A;  5CYB A;  5HZ6 A;  3BX8 A;  3C76 X;  3ZUI A;  1YWA A;  1B8E A;  1OEK A;  3PED A;  1GX8 A;  1GT3 A;  3ZW1 B;  2ACO A;  3S5V A;  4ZHD A;  4ORS A;  3PH5 A;  1L6M A;  1PEE A;  4HFO A;  1MX8 A;  1GT5 A;  5H9A A;  5D47 A;  1E06 A;  4Y0P A;  4A1H A;  5CE4 A;  1G5W A;  1T0V A;  4FGI B;  1I4U A;  3C78 X;  2AH7 X;  1OBQ A;  5FQ7 E;  2L5P A;  4QGV A;  3CMP A;  1YUP A;  3KFI A;  4ODD A;  3WJE A;  2CZT A;  3PP6 A;  3IFB A;  4UU3 A;  4GNY A;  3BU9 A;  3VU1 A;  5L8N A;  3EBK A;  4GKC A;  2NNQ A;  2W2F A;  5AEO A;  2ASN X;  3PEC A;  4YGZ A;  2HMB A;  1DV9 A;  2X8T A;  2A2G A;  1NP1 A;  1KT3 A;  5C0N A;  3CBS A;  1TOU A;  1QFV A;  1RLB E;  4KH8 A;  2A2U A;  4LZV A;  4ORY A;  1OPA A;  3RZY A;  4TJZ A;  4ID2 A;  1H91 A;  1Z24 A;  3U0D A;  2W2A A;  5EZ2 A;  4O4X A;  4PJ2 A;  5F1E A;  3VG4 A;  4I3C A;  1GM6 A;  5D45 A;  4AZM A;  2NP1 A;  1QQS A;  1MX7 A;  3OJY C;  3VG2 A;  3HWE A;  4O9S A;  5EDB A;  3G7X A;  3PH6 A;  1AB0 A;  3ZW2 A;  1KZX A;  2BT9 A;  1VPR A;  4AZP A;  1JBH A;  1GXA A;  1KZW A;  4LKP A;  1BRQ A;  4GU8 A;  2WUT A;  3FR2 A;  3NP1 A;  1XCA A;  2LB6 A;  4EDE A;  1ZRY A;  1FDQ A;  2YG2 A;  3I0A A;  2X8S A;  4ZCB A;  2LBV A;  1KQX A;  1MVG A;  3P24 A;  4A8Z A;  4HPA A;  4TKJ A;  4TNN A;  4GET A;  5LJK A;  3SOT A;  5BVS A;  2P8G A;  3TGC A;  4LZU A;  4MVL A;  3APW A;  4Y0S A;  5L8O A;  2RN4 A;  4EXZ A;  3BS2 A;  4ARH A;  3C77 X;  1ICM A;  4ZGF A;  1JJJ A;  4HPC A;  2G7B A;  4YCH A;  3JQO A;  5FFH A;  2JU3 A;  1X8O A;  3ELZ A;  3P6H A;  4OS3 A;  1SY0 A;  1IFB A;  3AKN A;  1QG5 A;  1S7D A;  3MVF A;  4D6B A;  1D3S A;  4IB8 A;  1OPB A;  4IMN A;  2R73 A;  3SAO A;  1BLR A;  1E5P A;  2FRS A;  1SXU A;  5LKE A;  1GKA A;  1A57 A;  2R56 A;  5FEN A;  3P02 A;  3OD9 A;  1OBU A;  3GE2 A;  5HZ8 A;  1LIF A;  3FEP A;  1A2D A;  4FBV A;  2RCQ A;  2QO6 A;  4QRL A;  3IA8 A;  1X89 A;  4U3Q A;  1KT5 A;  3O2Y A;  4INN A;  4NP1 A;  5H8T A;  1I05 A;  4DQ3 A;  4AZQ A;  2HNX A;  2CM9 A;  1URE A;  5IO6 A;  4GRJ A;  1CRB A;  1ZND A;  1FEL A;  2WSJ A;  3BSZ E;  2Q2P A;  4A1Y A;  2JN3 A;  4IB7 A;  1BRP A;  4QQ1 A;  1YP6 A;  5H9L A;  2OVS A;  4WHI A;  4ALO A;  4HPD A;  2PY1 A;  3NQK A;  3APX A;  1LID A;  1EI5 A;  3NX1 A;  4L3R A;  3KFF A;  2POA A;  4O49 A;  4YGH A;  3WJD A;  3LHN A;  3RWX A;  1YWB A;  1U18 A;  1BEB A;  2AKQ A;  1D2U A;  2FS6 A;  4ML7 B;  5HTD A;  5LJB A;  1OEJ A;  3STM X;  3KZA A;  3GAQ A;  1LNM A;  5IO7 A;  2GTL M;  4ORU A;  1BSO A;  1DFV A;  1MDC A;  4TLJ A;  2RD7 C;  2JOZ A;  4U8U N;  4ZFX A;  3FW5 A;  1DZP A;  3CBC A;  2XKL A;  3BDR A;  1KXO A;  2GTL N;  2IFB A;  2OVE A;  1A3Y A;  1EII A;  2L67 A;  2NNE A;  4XMG A;  5LJE A;  1LPJ A;  4GZV A;  3H3I A;  4YKM A;  2A3F X;  1LIE A;  2MO5 A;  4NLI A;  1DF3 A;  1ERB A;  4QZU A;  5F7G A;  2R74 A;  4LQZ A;  4O4O A;  1GT4 A;  4YDA A;  5BVT A;  1GT1 A;  1BBP A;  1EIO A;  1QFT A;  1QY0 A;  3T1D A;  3BY0 A;  2QMI A;  2A13 A;  3FEK A;  1O1V A;  5H9K A;  5L8I A;  4NYR A;  3L4R A;  4QYN A;  3TGB A;  4O3Z A;  2JU7 A;  5FQ6 E;  2YMS A;  3ZZV A;  5HAE A;  3HWF A;  1ML7 A;  2WQ9 A;  2FTB A;  1RBP A;  4GK9 A;  3WBG A;  1JJX A;  4QNI A;  1DZJ A;  4GDZ A;  3OBL A;  5AJB A;  2ACP X;  3E3C A;  3UEW A;  1U0X A;  1BWY A;  2E4J A;  4OS8 A;  3ZW0 B;  3OE3 A;  4OMW A;  1ADL A;  1NGL A;  1IFC A;  4NW4 A;  4IAX A;  5FQ8 E;  1SMP I;  3STK A;  1GX9 A;  1I06 A;  2CZU A;  1FEM A;  4NLJ A;  4QAE A;  4MVI A;  4R0B A;  1X71 A;  3O19 A;  1DC9 A;  3FR4 A;  5HZ9 A;  3TF6 A;  3K3L A;  1IKE A;  1BSQ A;  2KTS A;  4XME A;  3B2H A;  4TKH A;  1SY3 A;  2XST A;  4O4U A;  5F6Z A;  1ALB A;  5D48 A;  5F58 A;  1EW3 A;  2BLG A;  4YFP A;  1X8U A;  4U9C A;  1TXL A;  1X8P A;  4U8U O;  3VG3 A;  3D97 A;  1S2P A;  4QGX A;  1B56 A;  5EDC A;  1FTP A;  2CBS A;  4WFU A;  4O3W A;  5F6B A;  3UEX A;  4ZHG A;  3FEN A;  3RSW A;  2AT5 X;  2X46 A;  1XKI A;  2GJ5 A;  4K19 A;  5HTE A;  1ZNE A;  3S60 A;  4I95 A;  1SXX A;  3CQN A;  3FYF A;  3V8U A;  1EPA A;  1QWD A;  1Y9T A;  2AT6 X;  3U03 A;  3LV4 A;  1BSY A;  2EU7 X;  2WEX A;  5B27 A;  4ZGU A;  1EUO A;  4IMO A;  1YP7 A;  3VG6 A;  3HWG A;  4YKO A;  4UU2 A;  2QO4 A;  1YIV A;  4MIS A;  4CV7 A;  1UZ2 X;  2MJI A;  2Q39 A;  1SA8 A;  2OVD A;  4YH0 A;  2RA6 A;  1IKJ A;  2Z4I A;  3ELX A;  4KC7 A;  1S44 A;  3NQ9 A;  1JV4 A;  3B2L A;  3FMZ A;  2HLV A;  4AZN A;  1CJ5 A;  2MWH A;  3JSQ A;  3RBY A;  3KQ0 A;  3CR6 A;  5LKF A;  2AMM X;  4EFG A;  1P6P A;  2OVA A;  3EM0 A;  4YBU A;  5H9N A;  2RQ0 A;  2WQA E;  4I6S A;  2AT8 X;  3UEU A;  3WVM A;  4AYH A;  4ZR2 A;  5HA1 A;  1EXS A;  2BHV A;  3KFH A;  4MVK A;  5AJC A;  3ZUO A;  4AW8 A;  4YBP A;  2QM9 A;  3FEL A;  1ZNG A;  2N93 A;  1OBP A;  4HWM A;  3CQR A;  4M7M A;  3B2K A;  4EQA C;  3P6C A;  2A0A A;  4A60 A;  1QAB E;  3P6D A;  1ICN A;  1HMR A;  4NNS A;  3EYC A;  3S26 A;  1X8N A;  4TQ2 A;  4N7D A;  1O8V A;  1N0S A;  5D8J A;  4ORR A;  4YFR A;  4KT5 A;  4OS0 A;  1GGL A;  3TZS A;  1IIU A;  1JYJ A;  1X8Q A;  3P6F A;  4ES7 A;  4QZT A;  5DG4 A;  1LIC A;  1YWC A;  2K23 A;  4WBK A;  4I3D A;  1HBQ A;  4NNT A;  2WR6 A;  2X45 A;  3HK1 A;  4YCE A;  3VPJ E;  5KID A;  2AL0 X;  4OMX A;  2KT4 B;  3D96 A;  4O3X B;  3WJG A;  3NR3 A;  4QGW A;  4ALB A;  2BS5 A;  1E02 A;  3STN A;  4L1N A;  3VG5 A;  4D6A A;  4IAW A;  4PSQ A;  5EED A;  5DPQ A;  2OZQ A;  4ON1 A;  1U17 A;  2QOS C;  3KFG A;  3D95 A;  3BU1 A;  3I17 A;  2JW1 A;  3N91 A;  1A18 A;  1BJ7 A;  3HOE A;  1VYG A;  4IB9 A;  5KIC A;  5BVQ A;  3ZW0 A;  3NQ3 A;  3U9P C;  2M4L A;  4YGG A;  2MHD A;  3ZI8 A;  5HZ5 A;  3HTY A;  5KHP A;  4CK4 A;  1TW4 A;  2LKK A;  4LKT A;  4RUU A;  4ZJ0 A;  3WXQ A;  1B4M A;  1KT6 A;  4QYP A;  3WJB A;  1JZU A;  3FIQ A;  2AT3 X;  3F6Z B;  3BRN A;  1AVG I;  2WWP A;  3B2I A;  3MX7 A;  1SY1 A;  4BVM A;  1KT7 A;  2L9C A;  1E00 A;  3MBT A;  3FA9 A;  4NYQ A;  1QY2 A;  1ZNH A;  3HWD A;  5LJD A;  5HCD C;  4JGL A;  5HCE C;  1SXY A;  3QKG A;  3TGA A;  2ANS A;  3NAD A;  5D4A A;  2GTF X;  1DZK A;  1MUP A;  2DM5 A;  5AQ6 A;  4YFQ A;  1CBR A;  1G74 A;  2JU8 A;  3NX2 A;  2GC9 A;  4IAB A;  5IO5 A;  2QO5 A;  3ZWE A;  2F09 A;  4ORW A;  2RCT A;  3F8A A;  5HZQ A;  4DQ4 A;  2AT0 X;  1EAL A;  4AZO A;  1HMS A;  2LA7 A;  3FA6 A;  4FQB B;  4GH7 A;  3WJF A;  3F9D A;  1HN2 A;  2FT9 A;  4AZR A;  1AEL A;  1O1U A;  1LF7 A;  3DTQ A;  4O3Y A;  1LIB A;  4I9S A;  2FS7 A;  1ACD A;  5HBS A;  1PMP A;  5LJC A;  1DZM A;  2GTL O;  5HCC C;  4Y0R A;  3ZQ3 A;  4FBO A;  1G7N A;  4Y0Q A;  1KGL A;  3FW4 A;  3UAQ A;  4ZHH A;  5B29 A;  3WJC A;  2NND A;  1SXW A;  5HA0 A;  3DSZ A;  4MVE A;  2O62 A;  3FA8 A;  4MIR A;  2BS6 A;  1JYD A;  2LBA A;  5LJH A;  5LJG A;  4BQU A;  1I04 A;  1PM1 X;  1ERX A;  2HZQ A;  2ZAI A;  3EBW A;  3CWK A;  4ORX A;  1CBI A;  1EQD A;  3AKM A;  1HBP A;  3APV A;  3FLL A;  3NPO A;  5EEE A;  2Q4N A;  4IB6 A;  5EPQ A;  4COT A;  4CSB A;  4BOE A;  4XMD A;  4XMH A;  1KOI A;  1PBO A;  3BLG A;  4EEJ A;  4O4S A;  2G78 A;  1EPB A;  3EMM A;  2FR2 A;  3O22 A;  3PPT A;  3B2J A;  2Q2M A;  5BYP A;  3FR5 A;  4ZHC A;  1B0O A;  1T68 X;  4WFV A;  3VE2 A;  4IBA A;  3RKG A;  4FBR A;  2JMB A;  3NBX X;  2FWV A;  3UEV A;  2KD2 A;  1R0U A;  4KC8 A;  1AQB A;  2LFO A;  1OEE A;  1JIW I;  4YDB A;  4KCA A;  5JR8 A;  1TVQ A;  2ALL X;  1VYF A;  2W2B A;  3FA7 A;  1QY1 A;  3PQS A;  3JS1 A;  1KQW A;  2Z4H A;  2G79 A;  4I3B A;  4YMY A;  1LKE A;  2OFR X;  2OFM X;  3WOV A;  4TKB A;  1BM5 A;  1NP4 A;  5FAZ A;  3S5X A;  3APU A;  1GKA B;  2HZR A;  2KW1 A;  3PQU A;  4ZH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...