1BWYA

Nmr study of bovine heart fatty acid binding protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
132
structure length
132
Chain Sequence
VDAFVGTWKLVDSKNFDDYMKSLGVGFATRQVGNMTKPTTIIEVNGDTVIIKTQSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHVQKWNGQETSLVREMVDGKLILTLTHGTAVCTRTYEKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords PROTEIN (HEART FATTY ACID BINDING PROTEIN)
publication title Three-dimensional structure of bovine heart fatty-acid-binding protein with bound palmitic acid, determined by multidimensional NMR spectroscopy.
pubmed doi rcsb
source organism Bos taurus
total genus 33
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 1998-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1bwyA00
2QM9A 3FA6A 5EEEA 1A57A 1LIEA 1BEBA 3C77X 4IB9A 5HWZA 4NP1A 5HZ5A 3ZUOA 3KFHA 3VG6A 2HLVA 2WSJA 1XKIA 2NNQA 1X8NA 1B0OA 3P6HA 4XMGA 5D4AA 3FW4A 1EUOA 1G5WA 1NP1A 1SY1A 5BVSA 3P6CA 1ADLA 4QYPA 3C76X 3MVFA 4YGGA 3JS1A 2FRSA 2Q2PA 2G78A 3O19A 1KOIA 4YFRA 1LPJA 1FENA 1E02A 3CMPA 2BLGA 4HFOA 4UU2A 2CBSA 5LJCA 1CBQA 3B2LA 2L5PA 1IIUA 1MVGA 1IKJA 1QY1A 3U03A 2N93A 2RCTA 2QO4A 4EDEA 4ZH6A 2OFRX 4A8ZA 1HN2A 4NNTA 2MO5A 2NNDA 4TNNA 3WJCA 3B2IA 4NLIA 1KT6A 4KIIA 5HTDA 1QG5A 4QGWA 5LJDA 5H9NA 1ZNGA 1LIFA 5DPQA 1A2DA 2QOSC 2X45A 1ML7A 1H91A 4TKHA 1X71A 1DC9A 1DFVA 1SA8A 2PY1A 4MVKA 3PH6A 4NYQA 3O2YA 5HTEA 2CM4A 1ERXA 2K23A 1DV9A 1ZNLA 5B29A 1BRQA 1EW3A 1VPRA 1I4UA 2LBAA 4DQ3A 1FELA 1U18A 1N0SA 1HQPA 1EIIA 4Y0QA 3KZAA 1T68X 5LJBA 2A0AA 1T0VA 3B2JA 2G79A 1UZ2X 2ALLX 1AB0A 1EQDA 1B56A 1GT5A 3L4RA 3FW5A 2DM5A 2X46A 1G85A 1OPBA 3F8AA 2MM3A 3FEKA 3CQNA 2WUTA 4TQ2A 4YBPA 2QO6A 2HZRA 4ZJ0A 1IFBA 1LNMA 3UEXA 1SXWA 4D6BA 3FIQA 5HBSA 3BLGA 3KFFA 1X8UA 1B8EA 4I9RA 5H9AA 4M7MA 4ZHGA 4YDBA 2Q9SA 3KFIA 5HA0A 3HWFA 1ACDA 3U0DA 1X8PA 4UU3A 5IO6A 5HA1A 1IFCA 2W2FA 5LKFA 1HMRA 2LFOA 5HCEC 5HAEA 3CBSA 4BQUA 1NP4A 4AZOA 4YDAA 2ACPX 2YG2A 4YBUA 4HPDA 1OEKA 1BSYA 1XCAA 3PECA 2R74A 4YCHA 1PMPA 2P8GA 1ERBA 3BDRA 5B27A 2F73A 3TGBA 1S7DA 1JBHA 5D47A 2FS7A 1GKAA 3G7XA 5L8NA 3BU9A 3BX8A 1EIOA 1ALBA 1JJJA 2AH7X 4YMYA 1GKAB 2AT3X 3NQ9A 1YP7A 2WQ9A 1O8VA 4Y0PA 4ES7A 1YWCA 3HWGA 1GX8A 4QZTA 5EDBA 5EPQA 1A3YA 3WBGA 2CZUA 2Q2MA 3ELXA 3ZQ3A 1LIBA 4GETA 3AKMA 4YH0A 4ZHDA 3WJFA 1PBOA 4BVMA 4I3CA 4HPCA 2FT9A 1HMTA 1FTPA 1YUPA 3HWEA 4ZHFA 5DG4A 5LJEA 4XMFA 4GH7A 3AKNA 3B2KA 1EXSA 1LFOA 2A2GA 4GNYA 4YCEA 5F58A 1OEEA 1BWYA 1QY0A 2R73A 1LF7A 1D2UA 3UEWA 2A13A 1OBQA 4LKPA 1QFTA 3QKGA 1FE3A 1RLBE 3SAOA 1GT1A 3P6DA 4IAWA 2A2UA 5HCDC 2AT6X 2MJIA 4LZVA 1EPAA 1JYDA 1S2PA 1LICA 2FTBA 5JR8A 2FWVA 4TJZA 4MVLA 2KTDA 2RA6A 3EM0A 2GJ5A 4A1HA 5HZ8A 1KGLA 3WJGA 1YWAA 3EYCA 4ORSA 5HZQA 1DZKA 1O1UA 1A18A 5LJGA 2AT8X 3PP6A 3NX2A 1CBSA 3IFBA 2CM9A 4QGXA 4ALOA 4BOEA 2LB6A 3FELA 1BM5A 5EEDA 4AW8A 5FENA 1KZWA 3IA8A 3TGAA 3FEPA 1Z24A 5L8OA 1TVQA 3TF6A 5F7GA 1GT4A 1JV4A 3HWDA 2JU8A 4IB8A 4NNSA 2FS6A 1S44A 3DSZA 4ZHHA 3BSZE 2OZQA 1GM6A 4IB7A 1U17A 4ZFXA 2W2AA 3U9PC 5H9LA 4I9SA 2QO5A 4EFGA 5CE4A 1BBPA 5BVTA 2RD7C 1SY0A 2EU7X 3PEDA 4N7DA 1JJXA 2L68A 4QAEA 4XMDA 1FEMA 2OVDA 1HMSA 2OVEA 4YKOA 4ODDA 5D48A 1KXOA 1NGLA 3VG5A 4WBKA 1SXUA 1R0UA 1IKEA 3P6FA 4NYRA 1BLRA 3FLLA 2NP1A 4PSQA 2RCQA 1E06A 1ZRYA 1AELA 3APXA 4TLJA 3FR2A 1QFVA 4I3DA 3EBKA 4IAXA 1I06A 1KT7A 3F9DA 3UEVA 4YKMA 4D6AA 1LIDA 1QABE 4XMEA 2ANSA 2G7BA 1QWDA 4TKJA 3OJYC 2CZTA 4YGHA 4YFPA 2AT5X 2AL0X 3RZYA 3WXQA 5D8JA 2AT0X 2HNXA 2OFMX 4ORXA 3K3LA 2LBVA 1KT4A 2XKLA 2R56A 1BSQA 1QY2A 4IB6A 3FR5A 3DTQA 3EMMA 4XMHA 1CBRA 4NLJA 1UREA 4ORYA 4IBAA 4M6SA 4OMWA 3NR3A 3FA9A 2NNEA 5H9KA 4OS0A 2HYSA 1DZMA 5FAZA 2OVAA 1PEEA 3WJEA 1DF3A 4QGVA 3C78X 1ICNA 3I0AA 1KZXA 1BSOA 3S26A 2ACOA 1AVGI 4O9SA 3FR4A 4ZCBA 1KQXA 5LJHA 3NADA 5KICA 1ZNDA 2KT4B 3JSQA 2WEWA 2AMMX 2JU3A 4AZNA 1O1VA 2CBRA 1PM1X 3VG2A 1JZUA 5F6ZA 2HZQA 3VG4A 3VG3A 4AYHA 3D95A 1MX8A 3MBTA 5HZ9A 3BU1A 3CQRA 2FR2A 2W2BA 1GGLA 3WVMA 1SXYA 3EBWA 3BY0A 4ORWA 3RSWA 1B4MA 4MVIA 3D97A 1OEJA 3WJDA 4OS8A 1YWDA 4K19A 3VG7A 3BRNA 3CR6A 1TOUA 5H8TA 4LKTA 4IMOA 3GAQA 3PPTA 4ORRA 1X89A 1OBUA 1FDQA 2JU7A 5HZ6A 3NQ3A 1L6MA 3D96A 2WEXA 3FENA 3FMZA 2GC9A 3P6EA 1I05A 4Y0SA 3PH5A 3I17A 1I04A 2WWPA 3CWKA 5D45A 3ZUIA 2IFBA 4TKBA 1D3SA 2AKQA 1RBPA 4A60A 4RUNA 1YIVA 2JN3A 1LKEA 1VYGA 5F6BA 1X8QA 1OBPA 4GKCA 4DQ4A 1U0XA 3NX1A 3HK1A 1E00A 1TXLA 2K62A 4N7CA 5LJKA 2Q4NA 4ALBA 2WQAE 4WFUA 2WR6A 1DZJA 3STKA 1VYFA 2POAA 2A3FX 4QYNA 1KT5A 5L8IA 1EPBA 4YGZA 5C0NA 5BVQA 2E4JA 3FA7A 3T1DA 5AQ6A 1GT3A 3Q6LA 4ZHCA 4YFQA 3APVA 5EZ2A 4AZMA 3STNA 4GRJA 5FFHA 1ICMA 1MX7A 1JYJA 3ELZA 1IW2A 1TW4A 4QZUA 4R0BA 4GNWA 4CK4A 1GX9A 2GTFX 3KQ0A 1X8OA 4ARHA 5KIDA 4ORUA 1ZNKA 1G7NA 2FR3A 2O62A 1AQBA 4AZRA 1SXXA 4RUUA 5IO7A 5EDCA 1DZPA 1MUPA 1CBIA 1HBQA 3KFGA 1P6PA 1TOWA 5KHPA 4ZR2A 4A1YA 2RQ0A 3NPOA 2FLJA 3APUA 4XMCA 1ZNEA 4OS3A 2L67A 4Y0RA 3O22A 2ASNX 1HBPA 1SY3A 3UEUA 2HMBA 3FA8A 2LKKA 4AZPA 4EEJA 4EXZA 5IO5A 1YP6A 3STMX 3TGCA 3BS2A 3P6GA 5LKEA 1SY2A 1G74A 1BJ7A 1OPAA 4ZGUA 1KT3A 5K06A 3B2HA 1QQSA 1E5PA 2XSTA 4OMXA 2JOZA 3APWA 4WFVA 1CJ5A 4HPBA 4LZUA 2Q39A 5HCCC 1T8VA 1ZNHA 3BX7A 3CBCA 1KQWA 1CRBA 4ZH9A 3WJBA 1BRPA 1EALA 4IMNA 1GXAA 3NP1A 5F1EA 2L9CA 1MDCA 4HPAA 4AZQA 4I3BA 4GE1A 1YWBA 3TZSA
chains in the Genus database with same CATH superfamily
4GD9A 2QM9A 3FA6A 1VWOB 5EEEA 1A57A 4GJSA 2RTNB 1LIEA 1BEBA 3C77X 4IB9A 5HWZA 4NP1A 5HZ5A 3ZUOA 3KFHA 3VG6A 2HLVA 2WSJA 4U8UM 1XKIA 2NNQA 1X8NA 1B0OA 3P6HA 2IZCB 3F6ZB 4XMGA 5D4AA 3FW4A 1EUOA 3T2WA 1Y52X 1G5WA 1NP1A 2GTLM 1SY1A 1KL3A 5BVSA 1VWPB 3P6CA 1STPA 3EW2A 1ADLA 4QYPA 3C76X 3MVFA 1SLEB 4YGGA 4FGIB 3JS1A 2FRSA 2Q2PA 4U9CA 2G78A 3O19A 1KOIA 5K68A 3X00A 4YFRA 4Z2OA 1LPJA 3SLTA 1FENA 1SWFA 1E02A 3CMPA 2BLGA 2RTQB 4HFOA 1KFFA 4UU2A 2CBSA 3SLOA 5LJCA 1CBQA 3B2LA 2L5PA 1IIUA 3AUMO 1SMPI 1MVGA 1N9YA 1IKJA 3WZPA 1QY1A 1W5RA 3U03A 2N93A 2RCTA 2QO4A 4EDEA 2DJGA 4ZH6A 2OFRX 4A8ZA 3VU1A 1HN2A 4NNTA 2MO5A 2NNDA 4TNNA 3WJCA 2IZHB 1STRB 3B2IA 4NLIA 4OEMA 2I5ZO 1KT6A 4KIIA 5HTDA 4QQ1A 1QG5A 4QGWA 5LJDA 3RE6A 5H9NA 1ZNGA 1LIFA 5DPQA 4CPHA 1SLGB 1SRFA 4L1NA 4CPEA 2RTBB 1A2DA 5JD2A 2OY1O 2QOSC 2X45A 1ML7A 1H91A 4TKHA 1X71A 1DC9A 1DFVA 3LV4A 5FQ6E 5FQ7E 1SWSA 1K24A 1SA8A 2PY1A 4MVKA 3PH6A 4NYQA 3O2YA 5HTEA 2IZIA 1VWEB 1PBYA 2CM4A 1ERXA 1NBXA 2K23A 1DV9A 3HOLA 2OY8A 4JGLA 1ZNLA 2RTOB 5B29A 3JQOA 1BRQA 1EW3A 1VWRB 1VPRA 1VWGB 2BS5A 1I4UA 1JQPA 2LBAA 4DQ3A 2IZGB 5B2AO 1FELA 1U18A 1N0SA 1VWMB 1K3BA 1HQPA 1EIIA 1SWEA 4Y0QA 3KZAA 3WZOA 1T68X 5LJBA 1VYOA 1LDQA 2A0AA 3VPJE 1T0VA 3B2JA 2G79A 1UZ2X 2ALLX 1VWAB 1AB0A 4CDDA 2IZBA 1EQDA 2BHVA 2RTFB 2IZLB 4O4UA 1B56A 1I9HA 3RBYA 3VE2A 4BX5A 1GT5A 4ON1A 3L4RA 3FW5A 1LUQA 2DM5A 4BX5B 2RTDB 4JO6A 3S60A 4BX6B 2X46A 1G85A 3RDXA 3WOVA 2OF8A 1OPBA 3F8AA 2X55A 1Y9LA 2MM3A 1Y0GA 2KTSA 1N9MA 3CQNA 3FEKA 2WUTA 4TQ2A 4YBPA 2ZSCA 1SWRA 2QO6A 2HZRA 2X8FA 4ZJ0A 1JJUA 1IFBA 4I95A 1LNMA 3UEXA 1SXWA 4D6BA 3FIQA 3HOEA 4GU8A 3D9WA 4KC7A 5FQ8E 5HBSA 3BLGA 3RDOA 3KFFA 1X8UA 2IZJA 1B8EA 3S5XA 4I9RA 4O3WA 4U8UO 5H9AA 4M7MA 4ZHGA 4YDBA 5B5GA 2Q9SA 2OVSA 2GTLO 2RTRB 1VWHB 2QCBA 3MM0A 1SRIA 3KFIA 4HWMA 1Y9TA 5HA0A 3FYFA 3HWFA 1ACDA 1HY2A 3U0DA 1X8PA 4UU3A 1GX3A 5HA1A 1IFCA 2W2FA 5IO6A 5LKFA 1HMRA 3NQKA 2LFOA 5HCEC 1UYNX 4L3RA 5HAEA 3CBSA 2OF9A 4BQUA 1NP4A 4AZOA 4YDAA 5B3MO 2ACPX 3HTYA 1AVDA 1VWCB 2YG2A 4YBUA 4HPDA 1OEKA 1BSYA 1XCAA 4I60A 3PECA 3PQSA 2R74A 1LCWA 4YCHA 1PMPA 2P8GA 1ERBA 3WZNA 3BDRA 5B27A 3OD9A 2F73A 3TGBA 1S7DA 1JBHA 3MG5A 4ML7B 5D47A 2GH7A 2FS7A 1GKAA 2Y3EA 3G7XA 3BU9A 4INNA 3BX8A 5L8NA 1EIOA 1ALBA 1VWJB 4CV7A 1JJJA 2AH7X 4YMYA 1GKAB 2ZAIA 2AT3X 3NQ9A 1N43A 1YP7A 2UYWA 1O8VA 1SWBA 2WQ9A 4JHQA 4Y0PA 1YWCA 1W4TA 4ES7A 3HWGA 2F01A 1GX8A 4QZTA 2QOMA 5CYBA 5EDBA 5EPQA 3SZIA 1VWIB 1A3YA 3WBGA 4BCSA 4BGFA 2CZUA 2Q2MA 3ELXA 5IRUA 1SRJA 3ZQ3A 2BSZA 1VWQB 2CAMA 2RTLA 1LIBA 3GE2A 3OE3A 3AKMA 4GETA 1KL5A 4GGZA 4YH0A 3WJFA 4ZHDA 1N4JA 1PBOA 2BS6A 4BVMA 4CPIA 2X32A 1SREA 1KL4A 4I3CA 4HPCA 2FT9A 1HMTA 1FTPA 1YUPA 2A5CA 3HWEA 4LQZA 4KT5A 4ZHFA 5DG4A 3VHMA 5LJEA 4XMFA 4MEEA 4GH7A 1RXJA 3AKNA 2FKGA 3B2KA 3H3IA 1EXSA 1LFOA 2A2GA 4GNYA 4YCEA 5F58A 4KCAA 3WYPA 4COTA 1OEEA 4EKVA 1BWYA 1QY0A 2R73A 1LF7A 1D2UA 3UEWA 2A13A 3RY1A 1OBQA 4LKPA 1JMXA 1QFTA 2Y32A 3QKGA 5BYPA 1FE3A 2WPUA 1RLBE 3SAOA 1SWJA 1GT1A 3P6DA 4U3QA 1SRHA 4IAWA 2HKDA 2A2UA 2RTMA 5HCDC 2AT6X 2MJIA 4MISA 4LZVA 4CSBA 3RDQA 1MEPA 1EPAA 1JYDA 1S2PA 1LICA 1SWUA 2FTBA 5JR8A 2FWVA 4GDAA 2LA7A 4MVLA 4TJZA 3SOTA 2KTDA 2RA6A 3EM0A 1LDOA 4Y5DA 2GJ5A 5AJCA 4A1HA 5HZ8A 1KGLA 3WJGA 4WHIA 1RSUB 1YWAA 1HQQA 1LCVA 3EYCA 4ORSA 1DZKA 1O1UA 5HZQA 3VGWA 3RKGA 1A18A 5LJGA 2AT8X 3PP6A 3NX2A 2FHNX 1CBSA 3IFBA 5IRWA 1JMZA 2AF5A 2CM9A 4QGXA 4ALOA 4BOEA 2LB6A 3FELA 1BM5A 5EEDA 4AW8A 1FJ1E 4Z2VA 5FENA 1KZWA 3IA8A 3TGAA 4C5PA 4CDCA 3FEPA 2GTLN 1Z24A 5L8OA 2X8TA 1TVQA 3TF6A 5F7GA 2X56A 1GT4A 1JV4A 3QQ2A 3HWDA 2JU8A 4IB8A 4NNSA 2FS6A 1S44A 2X4MA 2A5BA 3MX7A 4O4SA 4FQBB 3DSZA 1SWLA 3RWXA 4ZHHA 3SZJA 3BSZE 4MIRA 2Z4IA 3ZZVA 5L3YA 2RTGB 2OZQA 1GM6A 4IB7A 4OELA 1U17A 4ZFXA 2W2AA 3U9PC 5H9LA 4I9SA 2QO5A 4BX6A 4EFGA 1LCZA 1BBPA 3T2XA 5CE4A 5BVTA 3AEHA 2RD7C 1SY0A 2EU7X 3PEDA 4N7DA 1NQNA 2L68A 1JJXA 4QAEA 4XMDA 3S5VA 5CSEA 1FEMA 1SWDA 1HMSA 2OVEA 2G8CO 2OVDA 4YKOA 4ODDA 5D48A 4ORYA 1KXOA 1N7YA 1NGLA 3PK2A 3VG5A 4WBKA 1SXUA 1R0UA 1IKEA 1Y53X 3P6FA 4NYRA 1BLRA 3FLLA 2NP1A 4PSQA 2RCQA 4GGTA 1E06A 3EC5A 1VWLB 1ZRYA 5B5FA 1AELA 3APXA 3WYQA 4TLJA 3FR2A 5CHKA 1QFVA 4I3DA 3VHHA 1VWDB 1OSPO 3EBKA 4IAXA 3VE1A 1IJ8A 1I06A 1KT7A 3ZW2A 3F9DA 3UEVA 4IRWA 4YKMA 2I5VO 4D6AA 1LIDA 1QABE 2AVIA 4XMEA 2A8GA 2ANSA 2G7BA 1QWDA 1DF8A 4TKJA 3PQUA 3OJYC 4I6SA 1MK5A 2CZTA 4YGHA 4YFPA 2AT5X 2AL0X 3RE5A 3RZYA 3WXQA 4Z2PA 2Y3FA 2JGSA 5D8JA 3FDCA 2AT0X 2HNXA 2OFMX 3HPEA 4NW4A 4ORXA 5B11O 3K3LA 2LBVA 1KT4A 5K67A 2XKLA 2R56A 4Y59A 1BSQA 1SWGA 3KVNA 1QY2A 4IB6A 3FR5A 3CKFA 3DTQA 1Y55X 3EMMA 4XMHA 4ZGFA 4O3YA 1CBRA 4NLJA 1UREA 4O3ZA 2BC3A 4IBAA 2RTAA 2ZAGA 2BT9A 4M6SA 3NR3A 4MVEA 4OMWA 4YVBA 3FA9A 2NNEA 3P02A 5H9KA 3N91A 3OBLA 4OS0A 2HYSA 1DZMA 2RTHB 2F09A 2OFAA 2JW1A 2OVAA 1VWFB 5FAZA 3VHIA 4GK9A 2C1SA 1VWBB 1E2TA 1PEEA 3WJEA 1DF3A 4QGVA 3C78X 1ICNA 2IZEB 3I0AA 1KZXA 1BSOA 4KH8A 3S26A 2ACOA 1EI5A 1AVGI 3P24A 4O9SA 3FR4A 4ZCBA 4Z6JA 1KQXA 2FGSA 3LTWA 4CDEA 4IABA 5LJHA 2JMBA 3NADA 4CDFA 4Z27A 5KICA 1ZNDA 2KT4B 2X34A 2WEWA 2C1QA 2AMMX 2G5LA 2JU3A 3JSQA 4AZNA 1JIWI 1O1VA 1PM1X 2CBRA 3VG2A 5B10O 1SWAA 4FBOA 3D4RA 1JZUA 5F6ZA 2HZQA 3VG4A 3FIDA 3VG3A 2FHLA 4AYHA 1SWOA 1PTSA 2RTJA 3D95A 4O4OA 3WZQA 1MX8A 3MBTA 5HZ9A 1SLFB 3BU1A 4O4XA 3CQRA 1HXZA 3UAQA 2FR2A 2W2BA 1W6FA 3SZHA 1GGLA 3WVMA 1SXYA 3EBWA 3BY0A 4GZVA 1WUBA 4ORWA 3RSWA 1B4MA 2C4IA 2Z4HA 4MVIA 3D97A 2MWHA 1SWCA 1NQMA 1OEJA 3WJDA 4OS8A 1YWDA 4K19A 3VG7A 2OL8O 3ZI8A 3BRNA 3CR6A 1TOUA 5H8TA 4LKTA 4GJVA 1VWKB 1UYOX 1RXKA 4IMOA 3GAQA 1SWKA 3PPTA 4ORRA 1X89A 1OBUA 1FDQA 1NC9A 2JU7A 2OFBA 2UZ2A 5HZ6A 2VDFA 3LHNA 3NQ3A 3ZWEA 1L6MA 1SWNA 2WEXA 3D96A 1I78A 2GC9A 3FENA 3FMZA 4U8UN 3P6EA 1I05A 2M4LA 2RTKA 4Y0SA 3PH5A 3I17A 1I04A 1RXHA 2WWPA 3CWKA 1SWTA 2KD2A 1WBIA 2YMSA 5D45A 2IFBA 3SLJA 3ZUIA 4TKBA 1D3SA 3T6LA 2AKQA 1RBPA 4A60A 4RUNA 2OL6O 1YIVA 2JN3A 1LKEA 1VWNB 1VYGA 5F6BA 1X8QA 1OBPA 2RTIB 4GKCA 2RTPB 4CPHB 4DQ4A 1U0XA 1MM9A 3T6FA 3NX1A 3HK1A 1E00A 2KW1A 3NBXX 1TXLA 2K62A 4N7CA 4FBRA 2Q4NA 5LJKA 4ALBA 2WQAE 4BJ8A 1AVEA 4WFUA 4BX7A 2WR6A 1DZJA 3STKA 1VYFA 2POAA 2MF6A 2A3FX 4QYNA 1KT5A 2OL7A 2RTEB 4NV7A 1EPBA 2X8SA 1STSB 4OKAA 4YGZA 5L8IA 5BVQA 2VFBA 3RDUA 3V8UA 2E4JA 4BX7B 5C0NA 3ZW1A 2MHDA 3FA7A 1SLDB 3T1DA 5AQ6A 5F2BA 1GT3A 2RN4A 3Q6LA 4ZHCA 2OY5O 3ZW1B 4YFQA 3APVA 2OYBO 4GGRA 5EZ2A 3STNA 4AZMA 3EW1A 4GRJA 5FFHA 1RSTB 1RAVA 1ICMA 4PJ2A 1LELA 3E3CA 1MX7A 1SWPA 4GUZA 1JYJA 3ELZA 4NV8A 2IZDB 1IW2A 4O3XB 5AEOA 1TW4A 2QMIA 4QZUA 4EQAC 4ID2A 4R0BA 4GNWA 4CK4A 1GX9A 2GTFX 2IZKA 3KQ0A 1X8OA 2RTCB 4ARHA 5KIDA 4ORUA 1ZNKA 3RDMA 1G7NA 2FR3A 2O62A 1AQBA 4B55A 4AZRA 4DNEA 1SXXA 4RUUA 1MOYA 5IO7A 4CPFA 5EDCA 1DZPA 1MUPA 3CKGA 4BBOA 3ZW0A 1CBIA 1HBQA 3KFGA 1P6PA 1TOWA 3Q34A 5KHPA 4QNIA 2OY7A 2PI3O 2DJFA 4ZR2A 4Z28A 3ZW0B 4A1YA 2RQ0A 3NPOA 2FLJA 3APUA 4XMCA 1ZNEA 4OS3A 2L67A 4U46A 3O22A 3PDFA 2ASNX 1HBPA 4Y0RA 1SY3A 3UEUA 2HMBA 3FA8A 2LKKA 4AZPA 4EEJA 2VFCA 4EXZA 1SWHA 1YP6A 2IZFB 3STMX 5IO5A 3TGCA 2FKJA 3BS2A 3P6GA 5LKEA 1SY2A 1NDJA 1G74A 1BJ7A 4FBVA 1OPAA 4KC8A 1KT3A 5IRAA 4ZGUA 5K06A 3B2HA 1QQSA 3RDSA 1E5PA 1SWQA 2XSTA 2IZAA 4OMXA 2JOZA 3APWA 4WFVA 1CJ5A 1SRGA 4HPBA 4O49A 4LZUA 2Q39A 1HXLA 3RY2A 4JNJA 1T8VA 5HCCC 4QRLA 1ZNHA 3BX7A 3CBCA 1KQWA 1CRBA 4ZH9A 3WJBA 1BRPA 1EALA 5AJBA 4IMNA 4GDZA 4DCBA 1GXAA 5IXGA 3NP1A 5F1EA 2L9CA 1MDCA 4HPAA 4AZQA 4I3BA 4GE1A 1YWBA 3TZSA
chains in the Genus database with same CATH topology
2QM9A 3FA6A 5EEEA 1A57A 1LIEA 1BEBA 3C77X 4IB9A 5HWZA 4NP1A 5HZ5A 3ZUOA 3KFHA 3VG6A 2HLVA 2WSJA 4U8UM 1XKIA 2NNQA 1X8NA 1B0OA 3P6HA 3F6ZB 4XMGA 5D4AA 3FW4A 1EUOA 1G5WA 1NP1A 2GTLM 1SY1A 5BVSA 3P6CA 1ADLA 4QYPA 3C76X 3MVFA 4YGGA 4FGIB 3JS1A 2FRSA 2Q2PA 4U9CA 2G78A 3O19A 1KOIA 4YFRA 1LPJA 1FENA 1E02A 3CMPA 2BLGA 4HFOA 4UU2A 2CBSA 5LJCA 1CBQA 3B2LA 2L5PA 1IIUA 1SMPI 1MVGA 1IKJA 1QY1A 3U03A 2N93A 2RCTA 2QO4A 4EDEA 4ZH6A 2OFRX 4A8ZA 3VU1A 1HN2A 4NNTA 2MO5A 2NNDA 4TNNA 3WJCA 3B2IA 4NLIA 1KT6A 4KIIA 5HTDA 4QQ1A 1QG5A 4QGWA 5LJDA 5H9NA 1ZNGA 1LIFA 5DPQA 4L1NA 1A2DA 2QOSC 2X45A 1ML7A 1H91A 4TKHA 1X71A 1DC9A 1DFVA 3LV4A 5FQ6E 5FQ7E 1SA8A 2PY1A 4MVKA 3PH6A 4NYQA 3O2YA 5HTEA 2K23A 1ERXA 2CM4A 1DV9A 3HOLA 4JGLA 1ZNLA 5B29A 3JQOA 1BRQA 1EW3A 1VPRA 2BS5A 1I4UA 2LBAA 4DQ3A 1FELA 1U18A 1N0SA 1HQPA 1EIIA 4Y0QA 3KZAA 1T68X 5LJBA 2A0AA 3VPJE 1T0VA 3B2JA 2G79A 1UZ2X 2ALLX 1AB0A 1EQDA 2BHVA 4O4UA 3RBYA 3VE2A 1B56A 1GT5A 4ON1A 3L4RA 3FW5A 2DM5A 3S60A 2X46A 1G85A 3WOVA 1OPBA 3F8AA 1Y9LA 2MM3A 2KTSA 3CQNA 3FEKA 2WUTA 4TQ2A 4YBPA 2QO6A 2X8FA 2HZRA 4ZJ0A 4I95A 1IFBA 1LNMA 3UEXA 1SXWA 4D6BA 3FIQA 3HOEA 4GU8A 4KC7A 5FQ8E 5HBSA 3BLGA 3KFFA 1X8UA 1B8EA 3S5XA 4I9RA 4O3WA 4U8UO 5H9AA 4M7MA 4ZHGA 4YDBA 2Q9SA 2OVSA 2GTLO 3KFIA 4HWMA 1Y9TA 5HA0A 3FYFA 3HWFA 1ACDA 3U0DA 1X8PA 4UU3A 5IO6A 5HA1A 1IFCA 2W2FA 5LKFA 1HMRA 3NQKA 2LFOA 5HCEC 4L3RA 5HAEA 3CBSA 4BQUA 1NP4A 4AZOA 4YDAA 2ACPX 3HTYA 2YG2A 4YBUA 4HPDA 1OEKA 1BSYA 1XCAA 3PECA 3PQSA 2R74A 4YCHA 1PMPA 2P8GA 1ERBA 3BDRA 5B27A 3OD9A 2F73A 3TGBA 1S7DA 1JBHA 4ML7B 5D47A 2FS7A 1GKAA 3G7XA 5L8NA 3BU9A 4INNA 3BX8A 1EIOA 1ALBA 4CV7A 1JJJA 2AH7X 4YMYA 1GKAB 2ZAIA 2AT3X 3NQ9A 1YP7A 2WQ9A 1O8VA 4Y0PA 4ES7A 1YWCA 3HWGA 1GX8A 4QZTA 5CYBA 5EDBA 5EPQA 1A3YA 3WBGA 2CZUA 2Q2MA 3ELXA 3ZQ3A 3OE3A 1LIBA 3GE2A 4GETA 3AKMA 4YH0A 4ZHDA 3WJFA 1PBOA 2BS6A 4BVMA 4I3CA 4HPCA 2FT9A 1HMTA 1FTPA 1YUPA 3HWEA 4LQZA 4ZHFA 4KT5A 5DG4A 5LJEA 4XMFA 4GH7A 3AKNA 3B2KA 3H3IA 1EXSA 1LFOA 2A2GA 4GNYA 4YCEA 5F58A 4KCAA 4COTA 1OEEA 1BWYA 1QY0A 2R73A 1LF7A 1D2UA 3UEWA 2A13A 1OBQA 4LKPA 1QFTA 3QKGA 5BYPA 1FE3A 1RLBE 3SAOA 1GT1A 3P6DA 4U3QA 4IAWA 2A2UA 5HCDC 2AT6X 2MJIA 4MISA 4LZVA 4CSBA 1EPAA 1JYDA 1S2PA 1LICA 2FTBA 5JR8A 2FWVA 4TJZA 2LA7A 4MVLA 3SOTA 2KTDA 2RA6A 3EM0A 2GJ5A 5AJCA 4A1HA 5HZ8A 1KGLA 3WJGA 4WHIA 1YWAA 3EYCA 4ORSA 5HZQA 1DZKA 1O1UA 3RKGA 1A18A 5LJGA 2AT8X 3PP6A 3NX2A 1CBSA 3IFBA 2CM9A 4QGXA 4ALOA 4BOEA 2LB6A 3FELA 1BM5A 5EEDA 4AW8A 5FENA 1KZWA 3IA8A 3TGAA 3FEPA 2GTLN 1Z24A 5L8OA 2X8TA 1TVQA 3TF6A 5F7GA 1GT4A 1JV4A 3HWDA 2JU8A 4IB8A 4NNSA 2FS6A 1S44A 3MX7A 4O4SA 4FQBB 3DSZA 3RWXA 4ZHHA 3BSZE 4MIRA 2Z4IA 3ZZVA 2OZQA 1GM6A 4IB7A 1U17A 4ZFXA 2W2AA 3U9PC 5H9LA 4I9SA 2QO5A 4EFGA 5CE4A 1BBPA 5BVTA 2RD7C 1SY0A 2EU7X 3PEDA 4N7DA 1JJXA 2L68A 4QAEA 4XMDA 3S5VA 1FEMA 2OVDA 1HMSA 2OVEA 4YKOA 4ODDA 5D48A 1KXOA 1NGLA 3VG5A 4WBKA 1SXUA 1R0UA 1IKEA 3P6FA 4NYRA 1BLRA 3FLLA 2NP1A 4PSQA 2RCQA 1E06A 1ZRYA 1AELA 3APXA 4TLJA 3FR2A 1QFVA 4I3DA 3EBKA 4IAXA 3VE1A 1I06A 1KT7A 3ZW2A 3F9DA 3UEVA 4YKMA 4D6AA 1LIDA 1QABE 4XMEA 2ANSA 2G7BA 1QWDA 4TKJA 3PQUA 3OJYC 4I6SA 2CZTA 4YGHA 4YFPA 2AT5X 2AL0X 3RZYA 3WXQA 5D8JA 2AT0X 2HNXA 2OFMX 4NW4A 4ORXA 3K3LA 2LBVA 1KT4A 2XKLA 2R56A 1BSQA 1QY2A 4IB6A 3FR5A 3DTQA 3EMMA 4XMHA 4ZGFA 4O3YA 1CBRA 4NLJA 1UREA 4O3ZA 4IBAA 4M6SA 4OMWA 2ZAGA 2BT9A 4ORYA 3NR3A 4MVEA 3FA9A 2NNEA 3P02A 5H9KA 3N91A 3OBLA 4OS0A 2HYSA 1DZMA 2F09A 5FAZA 2JW1A 2OVAA 4GK9A 1PEEA 3WJEA 1DF3A 4QGVA 3C78X 1ICNA 3I0AA 1KZXA 1BSOA 4KH8A 3S26A 2ACOA 1EI5A 1AVGI 3P24A 4O9SA 3FR4A 4ZCBA 1KQXA 4IABA 5LJHA 2JMBA 3NADA 5KICA 1ZNDA 2KT4B 3JSQA 2WEWA 2AMMX 2JU3A 4AZNA 1JIWI 1O1VA 1PM1X 2CBRA 3VG2A 4FBOA 3D4RA 1JZUA 5F6ZA 2HZQA 3VG4A 3VG3A 4AYHA 3D95A 4O4OA 1MX8A 3MBTA 5HZ9A 3BU1A 4O4XA 3CQRA 3UAQA 2FR2A 2W2BA 1GGLA 3WVMA 1SXYA 3EBWA 3BY0A 4GZVA 4ORWA 3RSWA 1B4MA 2Z4HA 4MVIA 3D97A 2MWHA 1OEJA 3WJDA 4OS8A 1YWDA 4K19A 3VG7A 3ZI8A 3BRNA 3CR6A 1TOUA 5H8TA 4LKTA 4IMOA 3GAQA 3PPTA 4ORRA 1X89A 1OBUA 1FDQA 2JU7A 5HZ6A 3LHNA 3NQ3A 3ZWEA 1L6MA 3D96A 2WEXA 3FENA 3FMZA 2GC9A 4U8UN 3P6EA 1I05A 2M4LA 4Y0SA 3PH5A 3I17A 1I04A 2WWPA 3CWKA 2KD2A 5D45A 2YMSA 3ZUIA 2IFBA 4TKBA 1D3SA 2AKQA 1RBPA 4A60A 4RUNA 1YIVA 2JN3A 1LKEA 1VYGA 5F6BA 1X8QA 1OBPA 4GKCA 4DQ4A 1U0XA 3NX1A 3HK1A 1E00A 2KW1A 3NBXX 1TXLA 2K62A 4N7CA 4FBRA 2Q4NA 5LJKA 4ALBA 2WQAE 4WFUA 2WR6A 1DZJA 3STKA 1VYFA 2POAA 2A3FX 4QYNA 1KT5A 5L8IA 1EPBA 2X8SA 3V8UA 4YGZA 5C0NA 5BVQA 2E4JA 3ZW1A 2MHDA 3FA7A 3T1DA 5AQ6A 1GT3A 2RN4A 3Q6LA 4ZHCA 3ZW1B 4YFQA 3APVA 5EZ2A 4AZMA 3STNA 4GRJA 5FFHA 1ICMA 4PJ2A 3E3CA 1MX7A 1JYJA 3ELZA 1IW2A 4O3XB 5AEOA 1TW4A 2QMIA 4QZUA 4EQAC 4ID2A 4R0BA 4GNWA 4CK4A 1GX9A 2GTFX 3KQ0A 1X8OA 4ARHA 5KIDA 4ORUA 1ZNKA 1G7NA 2FR3A 2O62A 1AQBA 4AZRA 1SXXA 4RUUA 5IO7A 5EDCA 1DZPA 1MUPA 3ZW0A 1CBIA 1HBQA 3KFGA 1P6PA 1TOWA 5KHPA 4QNIA 4ZR2A 3ZW0B 4A1YA 2RQ0A 3NPOA 2FLJA 3APUA 4XMCA 1ZNEA 4OS3A 2L67A 4Y0RA 3O22A 2ASNX 1HBPA 1SY3A 3UEUA 2HMBA 3FA8A 2LKKA 4AZPA 4EEJA 4EXZA 5IO5A 1YP6A 3STMX 3TGCA 3BS2A 3P6GA 5LKEA 1SY2A 1G74A 1BJ7A 4FBVA 1OPAA 4KC8A 1KT3A 4ZGUA 5K06A 3B2HA 1QQSA 1E5PA 2XSTA 4OMXA 2JOZA 3APWA 4WFVA 1CJ5A 4HPBA 4O49A 4LZUA 2Q39A 5HCCC 1T8VA 4QRLA 1ZNHA 3BX7A 3CBCA 1KQWA 1CRBA 4ZH9A 3WJBA 1BRPA 1EALA 5AJBA 4IMNA 4GDZA 1GXAA 3NP1A 5F1EA 2L9CA 1MDCA 4HPAA 4AZQA 4I3BA 4GE1A 1YWBA 3TZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QM9 A;  3FA6 A;  5EEE A;  1A57 A;  1LIE A;  1BEB A;  3C77 X;  4IB9 A;  5HWZ A;  4NP1 A;  5HZ5 A;  3ZUO A;  3KFH A;  3VG6 A;  2HLV A;  2WSJ A;  1XKI A;  2NNQ A;  1X8N A;  1B0O A;  3P6H A;  4XMG A;  5D4A A;  3FW4 A;  1EUO A;  1G5W A;  1NP1 A;  1SY1 A;  5BVS A;  3P6C A;  1ADL A;  4QYP A;  3C76 X;  3MVF A;  4YGG A;  3JS1 A;  2FRS A;  2Q2P A;  2G78 A;  3O19 A;  1KOI A;  4YFR A;  1LPJ A;  1FEN A;  1E02 A;  3CMP A;  2BLG A;  4HFO A;  4UU2 A;  2CBS A;  5LJC A;  1CBQ A;  3B2L A;  2L5P A;  1IIU A;  1MVG A;  1IKJ A;  1QY1 A;  3U03 A;  2N93 A;  2RCT A;  2QO4 A;  4EDE A;  4ZH6 A;  2OFR X;  4A8Z A;  1HN2 A;  4NNT A;  2MO5 A;  2NND A;  4TNN A;  3WJC A;  3B2I A;  4NLI A;  1KT6 A;  4KII A;  5HTD A;  1QG5 A;  4QGW A;  5LJD A;  5H9N A;  1ZNG A;  1LIF A;  5DPQ A;  1A2D A;  2QOS C;  2X45 A;  1ML7 A;  1H91 A;  4TKH A;  1X71 A;  1DC9 A;  1DFV A;  1SA8 A;  2PY1 A;  4MVK A;  3PH6 A;  4NYQ A;  3O2Y A;  5HTE A;  2CM4 A;  1ERX A;  2K23 A;  1DV9 A;  1ZNL A;  5B29 A;  1BRQ A;  1EW3 A;  1VPR A;  1I4U A;  2LBA A;  4DQ3 A;  1FEL A;  1U18 A;  1N0S A;  1HQP A;  1EII A;  4Y0Q A;  3KZA A;  1T68 X;  5LJB A;  2A0A A;  1T0V A;  3B2J A;  2G79 A;  1UZ2 X;  2ALL X;  1AB0 A;  1EQD A;  1B56 A;  1GT5 A;  3L4R A;  3FW5 A;  2DM5 A;  2X46 A;  1G85 A;  1OPB A;  3F8A A;  2MM3 A;  3FEK A;  3CQN A;  2WUT A;  4TQ2 A;  4YBP A;  2QO6 A;  2HZR A;  4ZJ0 A;  1IFB A;  1LNM A;  3UEX A;  1SXW A;  4D6B A;  3FIQ A;  5HBS A;  3BLG A;  3KFF A;  1X8U A;  1B8E A;  4I9R A;  5H9A A;  4M7M A;  4ZHG A;  4YDB A;  2Q9S A;  3KFI A;  5HA0 A;  3HWF A;  1ACD A;  3U0D A;  1X8P A;  4UU3 A;  5IO6 A;  5HA1 A;  1IFC A;  2W2F A;  5LKF A;  1HMR A;  2LFO A;  5HCE C;  5HAE A;  3CBS A;  4BQU A;  1NP4 A;  4AZO A;  4YDA A;  2ACP X;  2YG2 A;  4YBU A;  4HPD A;  1OEK A;  1BSY A;  1XCA A;  3PEC A;  2R74 A;  4YCH A;  1PMP A;  2P8G A;  1ERB A;  3BDR A;  5B27 A;  2F73 A;  3TGB A;  1S7D A;  1JBH A;  5D47 A;  2FS7 A;  1GKA A;  3G7X A;  5L8N A;  3BU9 A;  3BX8 A;  1EIO A;  1ALB A;  1JJJ A;  2AH7 X;  4YMY A;  1GKA B;  2AT3 X;  3NQ9 A;  1YP7 A;  2WQ9 A;  1O8V A;  4Y0P A;  4ES7 A;  1YWC A;  3HWG A;  1GX8 A;  4QZT A;  5EDB A;  5EPQ A;  1A3Y A;  3WBG A;  2CZU A;  2Q2M A;  3ELX A;  3ZQ3 A;  1LIB A;  4GET A;  3AKM A;  4YH0 A;  4ZHD A;  3WJF A;  1PBO A;  4BVM A;  4I3C A;  4HPC A;  2FT9 A;  1HMT A;  1FTP A;  1YUP A;  3HWE A;  4ZHF A;  5DG4 A;  5LJE A;  4XMF A;  4GH7 A;  3AKN A;  3B2K A;  1EXS A;  1LFO A;  2A2G A;  4GNY A;  4YCE A;  5F58 A;  1OEE A;  1BWY A;  1QY0 A;  2R73 A;  1LF7 A;  1D2U A;  3UEW A;  2A13 A;  1OBQ A;  4LKP A;  1QFT A;  3QKG A;  1FE3 A;  1RLB E;  3SAO A;  1GT1 A;  3P6D A;  4IAW A;  2A2U A;  5HCD C;  2AT6 X;  2MJI A;  4LZV A;  1EPA A;  1JYD A;  1S2P A;  1LIC A;  2FTB A;  5JR8 A;  2FWV A;  4TJZ A;  4MVL A;  2KTD A;  2RA6 A;  3EM0 A;  2GJ5 A;  4A1H A;  5HZ8 A;  1KGL A;  3WJG A;  1YWA A;  3EYC A;  4ORS A;  5HZQ A;  1DZK A;  1O1U A;  1A18 A;  5LJG A;  2AT8 X;  3PP6 A;  3NX2 A;  1CBS A;  3IFB A;  2CM9 A;  4QGX A;  4ALO A;  4BOE A;  2LB6 A;  3FEL A;  1BM5 A;  5EED A;  4AW8 A;  5FEN A;  1KZW A;  3IA8 A;  3TGA A;  3FEP A;  1Z24 A;  5L8O A;  1TVQ A;  3TF6 A;  5F7G A;  1GT4 A;  1JV4 A;  3HWD A;  2JU8 A;  4IB8 A;  4NNS A;  2FS6 A;  1S44 A;  3DSZ A;  4ZHH A;  3BSZ E;  2OZQ A;  1GM6 A;  4IB7 A;  1U17 A;  4ZFX A;  2W2A A;  3U9P C;  5H9L A;  4I9S A;  2QO5 A;  4EFG A;  5CE4 A;  1BBP A;  5BVT A;  2RD7 C;  1SY0 A;  2EU7 X;  3PED A;  4N7D A;  1JJX A;  2L68 A;  4QAE A;  4XMD A;  1FEM A;  2OVD A;  1HMS A;  2OVE A;  4YKO A;  4ODD A;  5D48 A;  1KXO A;  1NGL A;  3VG5 A;  4WBK A;  1SXU A;  1R0U A;  1IKE A;  3P6F A;  4NYR A;  1BLR A;  3FLL A;  2NP1 A;  4PSQ A;  2RCQ A;  1E06 A;  1ZRY A;  1AEL A;  3APX A;  4TLJ A;  3FR2 A;  1QFV A;  4I3D A;  3EBK A;  4IAX A;  1I06 A;  1KT7 A;  3F9D A;  3UEV A;  4YKM A;  4D6A A;  1LID A;  1QAB E;  4XME A;  2ANS A;  2G7B A;  1QWD A;  4TKJ A;  3OJY C;  2CZT A;  4YGH A;  4YFP A;  2AT5 X;  2AL0 X;  3RZY A;  3WXQ A;  5D8J A;  2AT0 X;  2HNX A;  2OFM X;  4ORX A;  3K3L A;  2LBV A;  1KT4 A;  2XKL A;  2R56 A;  1BSQ A;  1QY2 A;  4IB6 A;  3FR5 A;  3DTQ A;  3EMM A;  4XMH A;  1CBR A;  4NLJ A;  1URE A;  4ORY A;  4IBA A;  4M6S A;  4OMW A;  3NR3 A;  3FA9 A;  2NNE A;  5H9K A;  4OS0 A;  2HYS A;  1DZM A;  5FAZ A;  2OVA A;  1PEE A;  3WJE A;  1DF3 A;  4QGV A;  3C78 X;  1ICN A;  3I0A A;  1KZX A;  1BSO A;  3S26 A;  2ACO A;  1AVG I;  4O9S A;  3FR4 A;  4ZCB A;  1KQX A;  5LJH A;  3NAD A;  5KIC A;  1ZND A;  2KT4 B;  3JSQ A;  2WEW A;  2AMM X;  2JU3 A;  4AZN A;  1O1V A;  2CBR A;  1PM1 X;  3VG2 A;  1JZU A;  5F6Z A;  2HZQ A;  3VG4 A;  3VG3 A;  4AYH A;  3D95 A;  1MX8 A;  3MBT A;  5HZ9 A;  3BU1 A;  3CQR A;  2FR2 A;  2W2B A;  1GGL A;  3WVM A;  1SXY A;  3EBW A;  3BY0 A;  4ORW A;  3RSW A;  1B4M A;  4MVI A;  3D97 A;  1OEJ A;  3WJD A;  4OS8 A;  1YWD A;  4K19 A;  3VG7 A;  3BRN A;  3CR6 A;  1TOU A;  5H8T A;  4LKT A;  4IMO A;  3GAQ A;  3PPT A;  4ORR A;  1X89 A;  1OBU A;  1FDQ A;  2JU7 A;  5HZ6 A;  3NQ3 A;  1L6M A;  3D96 A;  2WEX A;  3FEN A;  3FMZ A;  2GC9 A;  3P6E A;  1I05 A;  4Y0S A;  3PH5 A;  3I17 A;  1I04 A;  2WWP A;  3CWK A;  5D45 A;  3ZUI A;  2IFB A;  4TKB A;  1D3S A;  2AKQ A;  1RBP A;  4A60 A;  4RUN A;  1YIV A;  2JN3 A;  1LKE A;  1VYG A;  5F6B A;  1X8Q A;  1OBP A;  4GKC A;  4DQ4 A;  1U0X A;  3NX1 A;  3HK1 A;  1E00 A;  1TXL A;  2K62 A;  4N7C A;  5LJK A;  2Q4N A;  4ALB A;  2WQA E;  4WFU A;  2WR6 A;  1DZJ A;  3STK A;  1VYF A;  2POA A;  2A3F X;  4QYN A;  1KT5 A;  5L8I A;  1EPB A;  4YGZ A;  5C0N A;  5BVQ A;  2E4J A;  3FA7 A;  3T1D A;  5AQ6 A;  1GT3 A;  3Q6L A;  4ZHC A;  4YFQ A;  3APV A;  5EZ2 A;  4AZM A;  3STN A;  4GRJ A;  5FFH A;  1ICM A;  1MX7 A;  1JYJ A;  3ELZ A;  1IW2 A;  1TW4 A;  4QZU A;  4R0B A;  4GNW A;  4CK4 A;  1GX9 A;  2GTF X;  3KQ0 A;  1X8O A;  4ARH A;  5KID A;  4ORU A;  1ZNK A;  1G7N A;  2FR3 A;  2O62 A;  1AQB A;  4AZR A;  1SXX A;  4RUU A;  5IO7 A;  5EDC A;  1DZP A;  1MUP A;  1CBI A;  1HBQ A;  3KFG A;  1P6P A;  1TOW A;  5KHP A;  4ZR2 A;  4A1Y A;  2RQ0 A;  3NPO A;  2FLJ A;  3APU A;  4XMC A;  1ZNE A;  4OS3 A;  2L67 A;  4Y0R A;  3O22 A;  2ASN X;  1HBP A;  1SY3 A;  3UEU A;  2HMB A;  3FA8 A;  2LKK A;  4AZP A;  4EEJ A;  4EXZ A;  5IO5 A;  1YP6 A;  3STM X;  3TGC A;  3BS2 A;  3P6G A;  5LKE A;  1SY2 A;  1G74 A;  1BJ7 A;  1OPA A;  4ZGU A;  1KT3 A;  5K06 A;  3B2H A;  1QQS A;  1E5P A;  2XST A;  4OMX A;  2JOZ A;  3APW A;  4WFV A;  1CJ5 A;  4HPB A;  4LZU A;  2Q39 A;  5HCC C;  1T8V A;  1ZNH A;  3BX7 A;  3CBC A;  1KQW A;  1CRB A;  4ZH9 A;  3WJB A;  1BRP A;  1EAL A;  4IMN A;  1GXA A;  3NP1 A;  5F1E A;  2L9C A;  1MDC A;  4HPA A;  4AZQ A;  4I3B A;  4GE1 A;  1YWB A;  3TZS A; 
#chains in the Genus database with same CATH topology
 4GD9 A;  2QM9 A;  3FA6 A;  1VWO B;  5EEE A;  1A57 A;  4GJS A;  2RTN B;  1LIE A;  1BEB A;  3C77 X;  4IB9 A;  5HWZ A;  4NP1 A;  5HZ5 A;  3ZUO A;  3KFH A;  3VG6 A;  2HLV A;  2WSJ A;  4U8U M;  1XKI A;  2NNQ A;  1X8N A;  1B0O A;  3P6H A;  2IZC B;  3F6Z B;  4XMG A;  5D4A A;  3FW4 A;  1EUO A;  3T2W A;  1Y52 X;  1G5W A;  1NP1 A;  2GTL M;  1SY1 A;  1KL3 A;  5BVS A;  1VWP B;  3P6C A;  1STP A;  3EW2 A;  1ADL A;  4QYP A;  3C76 X;  3MVF A;  1SLE B;  4YGG A;  4FGI B;  3JS1 A;  2FRS A;  2Q2P A;  4U9C A;  2G78 A;  3O19 A;  1KOI A;  5K68 A;  3X00 A;  4YFR A;  4Z2O A;  1LPJ A;  3SLT A;  1FEN A;  1SWF A;  1E02 A;  3CMP A;  2BLG A;  2RTQ B;  4HFO A;  1KFF A;  4UU2 A;  2CBS A;  3SLO A;  5LJC A;  1CBQ A;  3B2L A;  2L5P A;  1IIU A;  3AUM O;  1SMP I;  1MVG A;  1N9Y A;  1IKJ A;  3WZP A;  1QY1 A;  1W5R A;  3U03 A;  2N93 A;  2RCT A;  2QO4 A;  4EDE A;  2DJG A;  4ZH6 A;  2OFR X;  4A8Z A;  3VU1 A;  1HN2 A;  4NNT A;  2MO5 A;  2NND A;  4TNN A;  3WJC A;  2IZH B;  1STR B;  3B2I A;  4NLI A;  4OEM A;  2I5Z O;  1KT6 A;  4KII A;  5HTD A;  4QQ1 A;  1QG5 A;  4QGW A;  5LJD A;  3RE6 A;  5H9N A;  1ZNG A;  1LIF A;  5DPQ A;  4CPH A;  1SLG B;  1SRF A;  4L1N A;  4CPE A;  2RTB B;  1A2D A;  5JD2 A;  2OY1 O;  2QOS C;  2X45 A;  1ML7 A;  1H91 A;  4TKH A;  1X71 A;  1DC9 A;  1DFV A;  3LV4 A;  5FQ6 E;  5FQ7 E;  1SWS A;  1K24 A;  1SA8 A;  2PY1 A;  4MVK A;  3PH6 A;  4NYQ A;  3O2Y A;  5HTE A;  2IZI A;  1VWE B;  1PBY A;  2CM4 A;  1ERX A;  1NBX A;  2K23 A;  1DV9 A;  3HOL A;  2OY8 A;  4JGL A;  1ZNL A;  2RTO B;  5B29 A;  3JQO A;  1BRQ A;  1EW3 A;  1VWR B;  1VPR A;  1VWG B;  2BS5 A;  1I4U A;  1JQP A;  2LBA A;  4DQ3 A;  2IZG B;  5B2A O;  1FEL A;  1U18 A;  1N0S A;  1VWM B;  1K3B A;  1HQP A;  1EII A;  1SWE A;  4Y0Q A;  3KZA A;  3WZO A;  1T68 X;  5LJB A;  1VYO A;  1LDQ A;  2A0A A;  3VPJ E;  1T0V A;  3B2J A;  2G79 A;  1UZ2 X;  2ALL X;  1VWA B;  1AB0 A;  4CDD A;  2IZB A;  1EQD A;  2BHV A;  2RTF B;  2IZL B;  4O4U A;  1B56 A;  1I9H A;  3RBY A;  3VE2 A;  4BX5 A;  1GT5 A;  4ON1 A;  3L4R A;  3FW5 A;  1LUQ A;  2DM5 A;  4BX5 B;  2RTD B;  4JO6 A;  3S60 A;  4BX6 B;  2X46 A;  1G85 A;  3RDX A;  3WOV A;  2OF8 A;  1OPB A;  3F8A A;  2X55 A;  1Y9L A;  2MM3 A;  1Y0G A;  2KTS A;  1N9M A;  3CQN A;  3FEK A;  2WUT A;  4TQ2 A;  4YBP A;  2ZSC A;  1SWR A;  2QO6 A;  2HZR A;  2X8F A;  4ZJ0 A;  1JJU A;  1IFB A;  4I95 A;  1LNM A;  3UEX A;  1SXW A;  4D6B A;  3FIQ A;  3HOE A;  4GU8 A;  3D9W A;  4KC7 A;  5FQ8 E;  5HBS A;  3BLG A;  3RDO A;  3KFF A;  1X8U A;  2IZJ A;  1B8E A;  3S5X A;  4I9R A;  4O3W A;  4U8U O;  5H9A A;  4M7M A;  4ZHG A;  4YDB A;  5B5G A;  2Q9S A;  2OVS A;  2GTL O;  2RTR B;  1VWH B;  2QCB A;  3MM0 A;  1SRI A;  3KFI A;  4HWM A;  1Y9T A;  5HA0 A;  3FYF A;  3HWF A;  1ACD A;  1HY2 A;  3U0D A;  1X8P A;  4UU3 A;  1GX3 A;  5HA1 A;  1IFC A;  2W2F A;  5IO6 A;  5LKF A;  1HMR A;  3NQK A;  2LFO A;  5HCE C;  1UYN X;  4L3R A;  5HAE A;  3CBS A;  2OF9 A;  4BQU A;  1NP4 A;  4AZO A;  4YDA A;  5B3M O;  2ACP X;  3HTY A;  1AVD A;  1VWC B;  2YG2 A;  4YBU A;  4HPD A;  1OEK A;  1BSY A;  1XCA A;  4I60 A;  3PEC A;  3PQS A;  2R74 A;  1LCW A;  4YCH A;  1PMP A;  2P8G A;  1ERB A;  3WZN A;  3BDR A;  5B27 A;  3OD9 A;  2F73 A;  3TGB A;  1S7D A;  1JBH A;  3MG5 A;  4ML7 B;  5D47 A;  2GH7 A;  2FS7 A;  1GKA A;  2Y3E A;  3G7X A;  3BU9 A;  4INN A;  3BX8 A;  5L8N A;  1EIO A;  1ALB A;  1VWJ B;  4CV7 A;  1JJJ A;  2AH7 X;  4YMY A;  1GKA B;  2ZAI A;  2AT3 X;  3NQ9 A;  1N43 A;  1YP7 A;  2UYW A;  1O8V A;  1SWB A;  2WQ9 A;  4JHQ A;  4Y0P A;  1YWC A;  1W4T A;  4ES7 A;  3HWG A;  2F01 A;  1GX8 A;  4QZT A;  2QOM A;  5CYB A;  5EDB A;  5EPQ A;  3SZI A;  1VWI B;  1A3Y A;  3WBG A;  4BCS A;  4BGF A;  2CZU A;  2Q2M A;  3ELX A;  5IRU A;  1SRJ A;  3ZQ3 A;  2BSZ A;  1VWQ B;  2CAM A;  2RTL A;  1LIB A;  3GE2 A;  3OE3 A;  3AKM A;  4GET A;  1KL5 A;  4GGZ A;  4YH0 A;  3WJF A;  4ZHD A;  1N4J A;  1PBO A;  2BS6 A;  4BVM A;  4CPI A;  2X32 A;  1SRE A;  1KL4 A;  4I3C A;  4HPC A;  2FT9 A;  1HMT A;  1FTP A;  1YUP A;  2A5C A;  3HWE A;  4LQZ A;  4KT5 A;  4ZHF A;  5DG4 A;  3VHM A;  5LJE A;  4XMF A;  4MEE A;  4GH7 A;  1RXJ A;  3AKN A;  2FKG A;  3B2K A;  3H3I A;  1EXS A;  1LFO A;  2A2G A;  4GNY A;  4YCE A;  5F58 A;  4KCA A;  3WYP A;  4COT A;  1OEE A;  4EKV A;  1BWY A;  1QY0 A;  2R73 A;  1LF7 A;  1D2U A;  3UEW A;  2A13 A;  3RY1 A;  1OBQ A;  4LKP A;  1JMX A;  1QFT A;  2Y32 A;  3QKG A;  5BYP A;  1FE3 A;  2WPU A;  1RLB E;  3SAO A;  1SWJ A;  1GT1 A;  3P6D A;  4U3Q A;  1SRH A;  4IAW A;  2HKD A;  2A2U A;  2RTM A;  5HCD C;  2AT6 X;  2MJI A;  4MIS A;  4LZV A;  4CSB A;  3RDQ A;  1MEP A;  1EPA A;  1JYD A;  1S2P A;  1LIC A;  1SWU A;  2FTB A;  5JR8 A;  2FWV A;  4GDA A;  2LA7 A;  4MVL A;  4TJZ A;  3SOT A;  2KTD A;  2RA6 A;  3EM0 A;  1LDO A;  4Y5D A;  2GJ5 A;  5AJC A;  4A1H A;  5HZ8 A;  1KGL A;  3WJG A;  4WHI A;  1RSU B;  1YWA A;  1HQQ A;  1LCV A;  3EYC A;  4ORS A;  1DZK A;  1O1U A;  5HZQ A;  3VGW A;  3RKG A;  1A18 A;  5LJG A;  2AT8 X;  3PP6 A;  3NX2 A;  2FHN X;  1CBS A;  3IFB A;  5IRW A;  1JMZ A;  2AF5 A;  2CM9 A;  4QGX A;  4ALO A;  4BOE A;  2LB6 A;  3FEL A;  1BM5 A;  5EED A;  4AW8 A;  1FJ1 E;  4Z2V A;  5FEN A;  1KZW A;  3IA8 A;  3TGA A;  4C5P A;  4CDC A;  3FEP A;  2GTL N;  1Z24 A;  5L8O A;  2X8T A;  1TVQ A;  3TF6 A;  5F7G A;  2X56 A;  1GT4 A;  1JV4 A;  3QQ2 A;  3HWD A;  2JU8 A;  4IB8 A;  4NNS A;  2FS6 A;  1S44 A;  2X4M A;  2A5B A;  3MX7 A;  4O4S A;  4FQB B;  3DSZ A;  1SWL A;  3RWX A;  4ZHH A;  3SZJ A;  3BSZ E;  4MIR A;  2Z4I A;  3ZZV A;  5L3Y A;  2RTG B;  2OZQ A;  1GM6 A;  4IB7 A;  4OEL A;  1U17 A;  4ZFX A;  2W2A A;  3U9P C;  5H9L A;  4I9S A;  2QO5 A;  4BX6 A;  4EFG A;  1LCZ A;  1BBP A;  3T2X A;  5CE4 A;  5BVT A;  3AEH A;  2RD7 C;  1SY0 A;  2EU7 X;  3PED A;  4N7D A;  1NQN A;  2L68 A;  1JJX A;  4QAE A;  4XMD A;  3S5V A;  5CSE A;  1FEM A;  1SWD A;  1HMS A;  2OVE A;  2G8C O;  2OVD A;  4YKO A;  4ODD A;  5D48 A;  4ORY A;  1KXO A;  1N7Y A;  1NGL A;  3PK2 A;  3VG5 A;  4WBK A;  1SXU A;  1R0U A;  1IKE A;  1Y53 X;  3P6F A;  4NYR A;  1BLR A;  3FLL A;  2NP1 A;  4PSQ A;  2RCQ A;  4GGT A;  1E06 A;  3EC5 A;  1VWL B;  1ZRY A;  5B5F A;  1AEL A;  3APX A;  3WYQ A;  4TLJ A;  3FR2 A;  5CHK A;  1QFV A;  4I3D A;  3VHH A;  1VWD B;  1OSP O;  3EBK A;  4IAX A;  3VE1 A;  1IJ8 A;  1I06 A;  1KT7 A;  3ZW2 A;  3F9D A;  3UEV A;  4IRW A;  4YKM A;  2I5V O;  4D6A A;  1LID A;  1QAB E;  2AVI A;  4XME A;  2A8G A;  2ANS A;  2G7B A;  1QWD A;  1DF8 A;  4TKJ A;  3PQU A;  3OJY C;  4I6S A;  1MK5 A;  2CZT A;  4YGH A;  4YFP A;  2AT5 X;  2AL0 X;  3RE5 A;  3RZY A;  3WXQ A;  4Z2P A;  2Y3F A;  2JGS A;  5D8J A;  3FDC A;  2AT0 X;  2HNX A;  2OFM X;  3HPE A;  4NW4 A;  4ORX A;  5B11 O;  3K3L A;  2LBV A;  1KT4 A;  5K67 A;  2XKL A;  2R56 A;  4Y59 A;  1BSQ A;  1SWG A;  3KVN A;  1QY2 A;  4IB6 A;  3FR5 A;  3CKF A;  3DTQ A;  1Y55 X;  3EMM A;  4XMH A;  4ZGF A;  4O3Y A;  1CBR A;  4NLJ A;  1URE A;  4O3Z A;  2BC3 A;  4IBA A;  2RTA A;  2ZAG A;  2BT9 A;  4M6S A;  3NR3 A;  4MVE A;  4OMW A;  4YVB A;  3FA9 A;  2NNE A;  3P02 A;  5H9K A;  3N91 A;  3OBL A;  4OS0 A;  2HYS A;  1DZM A;  2RTH B;  2F09 A;  2OFA A;  2JW1 A;  2OVA A;  1VWF B;  5FAZ A;  3VHI A;  4GK9 A;  2C1S A;  1VWB B;  1E2T A;  1PEE A;  3WJE A;  1DF3 A;  4QGV A;  3C78 X;  1ICN A;  2IZE B;  3I0A A;  1KZX A;  1BSO A;  4KH8 A;  3S26 A;  2ACO A;  1EI5 A;  1AVG I;  3P24 A;  4O9S A;  3FR4 A;  4ZCB A;  4Z6J A;  1KQX A;  2FGS A;  3LTW A;  4CDE A;  4IAB A;  5LJH A;  2JMB A;  3NAD A;  4CDF A;  4Z27 A;  5KIC A;  1ZND A;  2KT4 B;  2X34 A;  2WEW A;  2C1Q A;  2AMM X;  2G5L A;  2JU3 A;  3JSQ A;  4AZN A;  1JIW I;  1O1V A;  1PM1 X;  2CBR A;  3VG2 A;  5B10 O;  1SWA A;  4FBO A;  3D4R A;  1JZU A;  5F6Z A;  2HZQ A;  3VG4 A;  3FID A;  3VG3 A;  2FHL A;  4AYH A;  1SWO A;  1PTS A;  2RTJ A;  3D95 A;  4O4O A;  3WZQ A;  1MX8 A;  3MBT A;  5HZ9 A;  1SLF B;  3BU1 A;  4O4X A;  3CQR A;  1HXZ A;  3UAQ A;  2FR2 A;  2W2B A;  1W6F A;  3SZH A;  1GGL A;  3WVM A;  1SXY A;  3EBW A;  3BY0 A;  4GZV A;  1WUB A;  4ORW A;  3RSW A;  1B4M A;  2C4I A;  2Z4H A;  4MVI A;  3D97 A;  2MWH A;  1SWC A;  1NQM A;  1OEJ A;  3WJD A;  4OS8 A;  1YWD A;  4K19 A;  3VG7 A;  2OL8 O;  3ZI8 A;  3BRN A;  3CR6 A;  1TOU A;  5H8T A;  4LKT A;  4GJV A;  1VWK B;  1UYO X;  1RXK A;  4IMO A;  3GAQ A;  1SWK A;  3PPT A;  4ORR A;  1X89 A;  1OBU A;  1FDQ A;  1NC9 A;  2JU7 A;  2OFB A;  2UZ2 A;  5HZ6 A;  2VDF A;  3LHN A;  3NQ3 A;  3ZWE A;  1L6M A;  1SWN A;  2WEX A;  3D96 A;  1I78 A;  2GC9 A;  3FEN A;  3FMZ A;  4U8U N;  3P6E A;  1I05 A;  2M4L A;  2RTK A;  4Y0S A;  3PH5 A;  3I17 A;  1I04 A;  1RXH A;  2WWP A;  3CWK A;  1SWT A;  2KD2 A;  1WBI A;  2YMS A;  5D45 A;  2IFB A;  3SLJ A;  3ZUI A;  4TKB A;  1D3S A;  3T6L A;  2AKQ A;  1RBP A;  4A60 A;  4RUN A;  2OL6 O;  1YIV A;  2JN3 A;  1LKE A;  1VWN B;  1VYG A;  5F6B A;  1X8Q A;  1OBP A;  2RTI B;  4GKC A;  2RTP B;  4CPH B;  4DQ4 A;  1U0X A;  1MM9 A;  3T6F A;  3NX1 A;  3HK1 A;  1E00 A;  2KW1 A;  3NBX X;  1TXL A;  2K62 A;  4N7C A;  4FBR A;  2Q4N A;  5LJK A;  4ALB A;  2WQA E;  4BJ8 A;  1AVE A;  4WFU A;  4BX7 A;  2WR6 A;  1DZJ A;  3STK A;  1VYF A;  2POA A;  2MF6 A;  2A3F X;  4QYN A;  1KT5 A;  2OL7 A;  2RTE B;  4NV7 A;  1EPB A;  2X8S A;  1STS B;  4OKA A;  4YGZ A;  5L8I A;  5BVQ A;  2VFB A;  3RDU A;  3V8U A;  2E4J A;  4BX7 B;  5C0N A;  3ZW1 A;  2MHD A;  3FA7 A;  1SLD B;  3T1D A;  5AQ6 A;  5F2B A;  1GT3 A;  2RN4 A;  3Q6L A;  4ZHC A;  2OY5 O;  3ZW1 B;  4YFQ A;  3APV A;  2OYB O;  4GGR A;  5EZ2 A;  3STN A;  4AZM A;  3EW1 A;  4GRJ A;  5FFH A;  1RST B;  1RAV A;  1ICM A;  4PJ2 A;  1LEL A;  3E3C A;  1MX7 A;  1SWP A;  4GUZ A;  1JYJ A;  3ELZ A;  4NV8 A;  2IZD B;  1IW2 A;  4O3X B;  5AEO A;  1TW4 A;  2QMI A;  4QZU A;  4EQA C;  4ID2 A;  4R0B A;  4GNW A;  4CK4 A;  1GX9 A;  2GTF X;  2IZK A;  3KQ0 A;  1X8O A;  2RTC B;  4ARH A;  5KID A;  4ORU A;  1ZNK A;  3RDM A;  1G7N A;  2FR3 A;  2O62 A;  1AQB A;  4B55 A;  4AZR A;  4DNE A;  1SXX A;  4RUU A;  1MOY A;  5IO7 A;  4CPF A;  5EDC A;  1DZP A;  1MUP A;  3CKG A;  4BBO A;  3ZW0 A;  1CBI A;  1HBQ A;  3KFG A;  1P6P A;  1TOW A;  3Q34 A;  5KHP A;  4QNI A;  2OY7 A;  2PI3 O;  2DJF A;  4ZR2 A;  4Z28 A;  3ZW0 B;  4A1Y A;  2RQ0 A;  3NPO A;  2FLJ A;  3APU A;  4XMC A;  1ZNE A;  4OS3 A;  2L67 A;  4U46 A;  3O22 A;  3PDF A;  2ASN X;  1HBP A;  4Y0R A;  1SY3 A;  3UEU A;  2HMB A;  3FA8 A;  2LKK A;  4AZP A;  4EEJ A;  2VFC A;  4EXZ A;  1SWH A;  1YP6 A;  2IZF B;  3STM X;  5IO5 A;  3TGC A;  2FKJ A;  3BS2 A;  3P6G A;  5LKE A;  1SY2 A;  1NDJ A;  1G74 A;  1BJ7 A;  4FBV A;  1OPA A;  4KC8 A;  1KT3 A;  5IRA A;  4ZGU A;  5K06 A;  3B2H A;  1QQS A;  3RDS A;  1E5P A;  1SWQ A;  2XST A;  2IZA A;  4OMX A;  2JOZ A;  3APW A;  4WFV A;  1CJ5 A;  1SRG A;  4HPB A;  4O49 A;  4LZU A;  2Q39 A;  1HXL A;  3RY2 A;  4JNJ A;  1T8V A;  5HCC C;  4QRL A;  1ZNH A;  3BX7 A;  3CBC A;  1KQW A;  1CRB A;  4ZH9 A;  3WJB A;  1BRP A;  1EAL A;  5AJB A;  4IMN A;  4GDZ A;  4DCB A;  1GXA A;  5IXG A;  3NP1 A;  5F1E A;  2L9C A;  1MDC A;  4HPA A;  4AZQ A;  4I3B A;  4GE1 A;  1YWB A;  3TZS A; 
#chains in the Genus database with same CATH homology
 2QM9 A;  3FA6 A;  5EEE A;  1A57 A;  1LIE A;  1BEB A;  3C77 X;  4IB9 A;  5HWZ A;  4NP1 A;  5HZ5 A;  3ZUO A;  3KFH A;  3VG6 A;  2HLV A;  2WSJ A;  4U8U M;  1XKI A;  2NNQ A;  1X8N A;  1B0O A;  3P6H A;  3F6Z B;  4XMG A;  5D4A A;  3FW4 A;  1EUO A;  1G5W A;  1NP1 A;  2GTL M;  1SY1 A;  5BVS A;  3P6C A;  1ADL A;  4QYP A;  3C76 X;  3MVF A;  4YGG A;  4FGI B;  3JS1 A;  2FRS A;  2Q2P A;  4U9C A;  2G78 A;  3O19 A;  1KOI A;  4YFR A;  1LPJ A;  1FEN A;  1E02 A;  3CMP A;  2BLG A;  4HFO A;  4UU2 A;  2CBS A;  5LJC A;  1CBQ A;  3B2L A;  2L5P A;  1IIU A;  1SMP I;  1MVG A;  1IKJ A;  1QY1 A;  3U03 A;  2N93 A;  2RCT A;  2QO4 A;  4EDE A;  4ZH6 A;  2OFR X;  4A8Z A;  3VU1 A;  1HN2 A;  4NNT A;  2MO5 A;  2NND A;  4TNN A;  3WJC A;  3B2I A;  4NLI A;  1KT6 A;  4KII A;  5HTD A;  4QQ1 A;  1QG5 A;  4QGW A;  5LJD A;  5H9N A;  1ZNG A;  1LIF A;  5DPQ A;  4L1N A;  1A2D A;  2QOS C;  2X45 A;  1ML7 A;  1H91 A;  4TKH A;  1X71 A;  1DC9 A;  1DFV A;  3LV4 A;  5FQ6 E;  5FQ7 E;  1SA8 A;  2PY1 A;  4MVK A;  3PH6 A;  4NYQ A;  3O2Y A;  5HTE A;  2K23 A;  1ERX A;  2CM4 A;  1DV9 A;  3HOL A;  4JGL A;  1ZNL A;  5B29 A;  3JQO A;  1BRQ A;  1EW3 A;  1VPR A;  2BS5 A;  1I4U A;  2LBA A;  4DQ3 A;  1FEL A;  1U18 A;  1N0S A;  1HQP A;  1EII A;  4Y0Q A;  3KZA A;  1T68 X;  5LJB A;  2A0A A;  3VPJ E;  1T0V A;  3B2J A;  2G79 A;  1UZ2 X;  2ALL X;  1AB0 A;  1EQD A;  2BHV A;  4O4U A;  3RBY A;  3VE2 A;  1B56 A;  1GT5 A;  4ON1 A;  3L4R A;  3FW5 A;  2DM5 A;  3S60 A;  2X46 A;  1G85 A;  3WOV A;  1OPB A;  3F8A A;  1Y9L A;  2MM3 A;  2KTS A;  3CQN A;  3FEK A;  2WUT A;  4TQ2 A;  4YBP A;  2QO6 A;  2X8F A;  2HZR A;  4ZJ0 A;  4I95 A;  1IFB A;  1LNM A;  3UEX A;  1SXW A;  4D6B A;  3FIQ A;  3HOE A;  4GU8 A;  4KC7 A;  5FQ8 E;  5HBS A;  3BLG A;  3KFF A;  1X8U A;  1B8E A;  3S5X A;  4I9R A;  4O3W A;  4U8U O;  5H9A A;  4M7M A;  4ZHG A;  4YDB A;  2Q9S A;  2OVS A;  2GTL O;  3KFI A;  4HWM A;  1Y9T A;  5HA0 A;  3FYF A;  3HWF A;  1ACD A;  3U0D A;  1X8P A;  4UU3 A;  5IO6 A;  5HA1 A;  1IFC A;  2W2F A;  5LKF A;  1HMR A;  3NQK A;  2LFO A;  5HCE C;  4L3R A;  5HAE A;  3CBS A;  4BQU A;  1NP4 A;  4AZO A;  4YDA A;  2ACP X;  3HTY A;  2YG2 A;  4YBU A;  4HPD A;  1OEK A;  1BSY A;  1XCA A;  3PEC A;  3PQS A;  2R74 A;  4YCH A;  1PMP A;  2P8G A;  1ERB A;  3BDR A;  5B27 A;  3OD9 A;  2F73 A;  3TGB A;  1S7D A;  1JBH A;  4ML7 B;  5D47 A;  2FS7 A;  1GKA A;  3G7X A;  5L8N A;  3BU9 A;  4INN A;  3BX8 A;  1EIO A;  1ALB A;  4CV7 A;  1JJJ A;  2AH7 X;  4YMY A;  1GKA B;  2ZAI A;  2AT3 X;  3NQ9 A;  1YP7 A;  2WQ9 A;  1O8V A;  4Y0P A;  4ES7 A;  1YWC A;  3HWG A;  1GX8 A;  4QZT A;  5CYB A;  5EDB A;  5EPQ A;  1A3Y A;  3WBG A;  2CZU A;  2Q2M A;  3ELX A;  3ZQ3 A;  3OE3 A;  1LIB A;  3GE2 A;  4GET A;  3AKM A;  4YH0 A;  4ZHD A;  3WJF A;  1PBO A;  2BS6 A;  4BVM A;  4I3C A;  4HPC A;  2FT9 A;  1HMT A;  1FTP A;  1YUP A;  3HWE A;  4LQZ A;  4ZHF A;  4KT5 A;  5DG4 A;  5LJE A;  4XMF A;  4GH7 A;  3AKN A;  3B2K A;  3H3I A;  1EXS A;  1LFO A;  2A2G A;  4GNY A;  4YCE A;  5F58 A;  4KCA A;  4COT A;  1OEE A;  1BWY A;  1QY0 A;  2R73 A;  1LF7 A;  1D2U A;  3UEW A;  2A13 A;  1OBQ A;  4LKP A;  1QFT A;  3QKG A;  5BYP A;  1FE3 A;  1RLB E;  3SAO A;  1GT1 A;  3P6D A;  4U3Q A;  4IAW A;  2A2U A;  5HCD C;  2AT6 X;  2MJI A;  4MIS A;  4LZV A;  4CSB A;  1EPA A;  1JYD A;  1S2P A;  1LIC A;  2FTB A;  5JR8 A;  2FWV A;  4TJZ A;  2LA7 A;  4MVL A;  3SOT A;  2KTD A;  2RA6 A;  3EM0 A;  2GJ5 A;  5AJC A;  4A1H A;  5HZ8 A;  1KGL A;  3WJG A;  4WHI A;  1YWA A;  3EYC A;  4ORS A;  5HZQ A;  1DZK A;  1O1U A;  3RKG A;  1A18 A;  5LJG A;  2AT8 X;  3PP6 A;  3NX2 A;  1CBS A;  3IFB A;  2CM9 A;  4QGX A;  4ALO A;  4BOE A;  2LB6 A;  3FEL A;  1BM5 A;  5EED A;  4AW8 A;  5FEN A;  1KZW A;  3IA8 A;  3TGA A;  3FEP A;  2GTL N;  1Z24 A;  5L8O A;  2X8T A;  1TVQ A;  3TF6 A;  5F7G A;  1GT4 A;  1JV4 A;  3HWD A;  2JU8 A;  4IB8 A;  4NNS A;  2FS6 A;  1S44 A;  3MX7 A;  4O4S A;  4FQB B;  3DSZ A;  3RWX A;  4ZHH A;  3BSZ E;  4MIR A;  2Z4I A;  3ZZV A;  2OZQ A;  1GM6 A;  4IB7 A;  1U17 A;  4ZFX A;  2W2A A;  3U9P C;  5H9L A;  4I9S A;  2QO5 A;  4EFG A;  5CE4 A;  1BBP A;  5BVT A;  2RD7 C;  1SY0 A;  2EU7 X;  3PED A;  4N7D A;  1JJX A;  2L68 A;  4QAE A;  4XMD A;  3S5V A;  1FEM A;  2OVD A;  1HMS A;  2OVE A;  4YKO A;  4ODD A;  5D48 A;  1KXO A;  1NGL A;  3VG5 A;  4WBK A;  1SXU A;  1R0U A;  1IKE A;  3P6F A;  4NYR A;  1BLR A;  3FLL A;  2NP1 A;  4PSQ A;  2RCQ A;  1E06 A;  1ZRY A;  1AEL A;  3APX A;  4TLJ A;  3FR2 A;  1QFV A;  4I3D A;  3EBK A;  4IAX A;  3VE1 A;  1I06 A;  1KT7 A;  3ZW2 A;  3F9D A;  3UEV A;  4YKM A;  4D6A A;  1LID A;  1QAB E;  4XME A;  2ANS A;  2G7B A;  1QWD A;  4TKJ A;  3PQU A;  3OJY C;  4I6S A;  2CZT A;  4YGH A;  4YFP A;  2AT5 X;  2AL0 X;  3RZY A;  3WXQ A;  5D8J A;  2AT0 X;  2HNX A;  2OFM X;  4NW4 A;  4ORX A;  3K3L A;  2LBV A;  1KT4 A;  2XKL A;  2R56 A;  1BSQ A;  1QY2 A;  4IB6 A;  3FR5 A;  3DTQ A;  3EMM A;  4XMH A;  4ZGF A;  4O3Y A;  1CBR A;  4NLJ A;  1URE A;  4O3Z A;  4IBA A;  4M6S A;  4OMW A;  2ZAG A;  2BT9 A;  4ORY A;  3NR3 A;  4MVE A;  3FA9 A;  2NNE A;  3P02 A;  5H9K A;  3N91 A;  3OBL A;  4OS0 A;  2HYS A;  1DZM A;  2F09 A;  5FAZ A;  2JW1 A;  2OVA A;  4GK9 A;  1PEE A;  3WJE A;  1DF3 A;  4QGV A;  3C78 X;  1ICN A;  3I0A A;  1KZX A;  1BSO A;  4KH8 A;  3S26 A;  2ACO A;  1EI5 A;  1AVG I;  3P24 A;  4O9S A;  3FR4 A;  4ZCB A;  1KQX A;  4IAB A;  5LJH A;  2JMB A;  3NAD A;  5KIC A;  1ZND A;  2KT4 B;  3JSQ A;  2WEW A;  2AMM X;  2JU3 A;  4AZN A;  1JIW I;  1O1V A;  1PM1 X;  2CBR A;  3VG2 A;  4FBO A;  3D4R A;  1JZU A;  5F6Z A;  2HZQ A;  3VG4 A;  3VG3 A;  4AYH A;  3D95 A;  4O4O A;  1MX8 A;  3MBT A;  5HZ9 A;  3BU1 A;  4O4X A;  3CQR A;  3UAQ A;  2FR2 A;  2W2B A;  1GGL A;  3WVM A;  1SXY A;  3EBW A;  3BY0 A;  4GZV A;  4ORW A;  3RSW A;  1B4M A;  2Z4H A;  4MVI A;  3D97 A;  2MWH A;  1OEJ A;  3WJD A;  4OS8 A;  1YWD A;  4K19 A;  3VG7 A;  3ZI8 A;  3BRN A;  3CR6 A;  1TOU A;  5H8T A;  4LKT A;  4IMO A;  3GAQ A;  3PPT A;  4ORR A;  1X89 A;  1OBU A;  1FDQ A;  2JU7 A;  5HZ6 A;  3LHN A;  3NQ3 A;  3ZWE A;  1L6M A;  3D96 A;  2WEX A;  3FEN A;  3FMZ A;  2GC9 A;  4U8U N;  3P6E A;  1I05 A;  2M4L A;  4Y0S A;  3PH5 A;  3I17 A;  1I04 A;  2WWP A;  3CWK A;  2KD2 A;  5D45 A;  2YMS A;  3ZUI A;  2IFB A;  4TKB A;  1D3S A;  2AKQ A;  1RBP A;  4A60 A;  4RUN A;  1YIV A;  2JN3 A;  1LKE A;  1VYG A;  5F6B A;  1X8Q A;  1OBP A;  4GKC A;  4DQ4 A;  1U0X A;  3NX1 A;  3HK1 A;  1E00 A;  2KW1 A;  3NBX X;  1TXL A;  2K62 A;  4N7C A;  4FBR A;  2Q4N A;  5LJK A;  4ALB A;  2WQA E;  4WFU A;  2WR6 A;  1DZJ A;  3STK A;  1VYF A;  2POA A;  2A3F X;  4QYN A;  1KT5 A;  5L8I A;  1EPB A;  2X8S A;  3V8U A;  4YGZ A;  5C0N A;  5BVQ A;  2E4J A;  3ZW1 A;  2MHD A;  3FA7 A;  3T1D A;  5AQ6 A;  1GT3 A;  2RN4 A;  3Q6L A;  4ZHC A;  3ZW1 B;  4YFQ A;  3APV A;  5EZ2 A;  4AZM A;  3STN A;  4GRJ A;  5FFH A;  1ICM A;  4PJ2 A;  3E3C A;  1MX7 A;  1JYJ A;  3ELZ A;  1IW2 A;  4O3X B;  5AEO A;  1TW4 A;  2QMI A;  4QZU A;  4EQA C;  4ID2 A;  4R0B A;  4GNW A;  4CK4 A;  1GX9 A;  2GTF X;  3KQ0 A;  1X8O A;  4ARH A;  5KID A;  4ORU A;  1ZNK A;  1G7N A;  2FR3 A;  2O62 A;  1AQB A;  4AZR A;  1SXX A;  4RUU A;  5IO7 A;  5EDC A;  1DZP A;  1MUP A;  3ZW0 A;  1CBI A;  1HBQ A;  3KFG A;  1P6P A;  1TOW A;  5KHP A;  4QNI A;  4ZR2 A;  3ZW0 B;  4A1Y A;  2RQ0 A;  3NPO A;  2FLJ A;  3APU A;  4XMC A;  1ZNE A;  4OS3 A;  2L67 A;  4Y0R A;  3O22 A;  2ASN X;  1HBP A;  1SY3 A;  3UEU A;  2HMB A;  3FA8 A;  2LKK A;  4AZP A;  4EEJ A;  4EXZ A;  5IO5 A;  1YP6 A;  3STM X;  3TGC A;  3BS2 A;  3P6G A;  5LKE A;  1SY2 A;  1G74 A;  1BJ7 A;  4FBV A;  1OPA A;  4KC8 A;  1KT3 A;  4ZGU A;  5K06 A;  3B2H A;  1QQS A;  1E5P A;  2XST A;  4OMX A;  2JOZ A;  3APW A;  4WFV A;  1CJ5 A;  4HPB A;  4O49 A;  4LZU A;  2Q39 A;  5HCC C;  1T8V A;  4QRL A;  1ZNH A;  3BX7 A;  3CBC A;  1KQW A;  1CRB A;  4ZH9 A;  3WJB A;  1BRP A;  1EAL A;  5AJB A;  4IMN A;  4GDZ A;  1GXA A;  3NP1 A;  5F1E A;  2L9C A;  1MDC A;  4HPA A;  4AZQ A;  4I3B A;  4GE1 A;  1YWB A;  3TZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...