1BWYA

Nmr study of bovine heart fatty acid binding protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
132
structure length
132
Chain Sequence
b'VDAFVGTWKLVDSKNFDDYMKSLGVGFATRQVGNMTKPTTIIEVNGDTVIIKTQSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHVQKWNGQETSLVREMVDGKLILTLTHGTAVCTRTYEKQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HEART FATTY ACID BINDING PROTEIN)
publication title Three-dimensional structure of bovine heart fatty-acid-binding protein with bound palmitic acid, determined by multidimensional NMR spectroscopy.
pubmed doi rcsb
source organism Bos taurus
molecule tags Lipid binding protein
total genus 33
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 1998-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1bwyA00
4ZHFA 1HBPA 1XKIA 4GNWA 3STKA 2JU7A 3MBTA 4NNSA 3CBSA 2A13A 2QO6A 3BS2A 5FENA 1BM5A 3BRNA 2FT9A 1GX8A 1TVQA 2WEWA 2QO4A 3KQ0A 1ZNKA 1OEJA 4ZHDA 3CBCA 1SXWA 5BVSA 1KQXA 4WFVA 3TGAA 3KFHA 3B2HA 2FS6A 1KQWA 5H9KA 2MM3A 3APVA 1KT5A 2AH7X 3BU1A 1MVGA 3ELZA 1DZMA 5HCCC 3WJBA 5LJEA 4I3DA 2IFBA 1JJXA 4DQ4A 1T0VA 1OEEA 3C78X 1D3SA 2AT6X 4XMDA 1HN2A 1DZJA 2BLGA 1U0XA 1DF3A 1BSQA 3TF6A 4WFUA 4AW8A 2EU7X 1CBIA 3DTQA 2JOZA 3U0DA 1SY0A 4AZRA 1RBPA 4ORYA 1AVGI 5D4AA 1IIUA 1H91A 1X8QA 3PH5A 4LKPA 2FTBA 5LJBA 1QFVA 5BVTA 5HTEA 1IFCA 5AQ6A 1EIIA 1OEKA 1SXXA 2K62A 2OVEA 4GETA 1KT4A 3EBWA 1QY2A 1X8PA 4IB6A 4ODDA 4OMXA 4YGZA 4D6AA 3L4RA 3PH6A 5H9LA 1JBHA 2OVDA 3B2KA 1L6MA 3FMZA 4AYHA 1GT5A 1B56A 3STMX 4WBKA 1EW3A 5H8TA 3GAQA 1A3YA 3ZUIA 4ORXA 4N7CA 3WJGA 4ORWA 2Q4NA 4XMHA 3P6CA 3ELXA 5B27A 1HBQA 3U9PC 3FW4A 1ZNLA 4UU3A 4EDEA 3FR4A 4QGWA 4YKOA 4BQUA 3I17A 4HPBA 3WJDA 4M7MA 1KGLA 4KIIA 2FLJA 2MO5A 1EPBA 1OBPA 5EDBA 3I0AA 3APXA 4LZUA 1EPAA 1AQBA 1LKEA 4A1HA 3F8AA 1AB0A 4EEJA 4ZH6A 5HZ9A 1DFVA 3Q6LA 3BX8A 2RQ0A 3FELA 3HWGA 2OFMX 4ZFXA 1O8VA 3NADA 1S7DA 2CBSA 1RLBE 5H9AA 4TKBA 5EEEA 2ALLX 1OBQA 5HZQA 1SA8A 1SY1A 3CR6A 1X89A 3C77X 1E00A 2W2AA 1HMRA 1A2DA 3CQRA 1LNMA 2NP1A 5LJDA 1BRQA 5HZ5A 2Q2MA 3TGCA 1B0OA 4ES7A 2G78A 1X8OA 1ERXA 1DZPA 2NNEA 4ORUA 1GM6A 2G79A 3JS1A 2XKLA 3WVMA 5JR8A 2X46A 2LFOA 3VG2A 5DPQA 4ZGUA 4GKCA 4ORSA 5FAZA 3BSZE 4LKTA 4HPDA 4NYQA 5LJCA 3F9DA 3HK1A 1CBSA 5HA0A 1BJ7A 3P6EA 1FDQA 4QZTA 1ADLA 4ZJ0A 1S44A 4YBPA 1YP6A 4HPAA 1A57A 1MX8A 4ZR2A 4AZOA 1FELA 1HMTA 3EBKA 3P6DA 1OPAA 3PP6A 5K06A 3C76X 4I3BA 1I4UA 1I05A 1ACDA 1LIDA 4MVLA 1ZNDA 2A3FX 2QM9A 4IBAA 1GGLA 4YDBA 3FA6A 5C0NA 1BSYA 2WEXA 1TXLA 2L9CA 1BSOA 3RZYA 2LKKA 3UEXA 4R0BA 4M6SA 4XMGA 3VG3A 1JZUA 4OS8A 5F1EA 3BLGA 3FEPA 2QOSC 4YH0A 5L8NA 2ACPX 1KZWA 4QYPA 3VG5A 5KIDA 2PY1A 4PSQA 5LJKA 1YUPA 5L8OA 4IAWA 4YCEA 1S2PA 3D96A 5F7GA 2L67A 4D6BA 4YMYA 4YFPA 1PM1X 4YFRA 2W2BA 3CQNA 4AZPA 4YDAA 1T68X 2NNDA 1FTPA 1YWBA 5HBSA 1KZXA 4TNNA 2MJIA 2YG2A 1O1VA 2CZUA 3NX1A 4A60A 1DV9A 3KZAA 5D47A 4ZH9A 1E02A 3WXQA 3T1DA 2AT5X 1QY0A 3MVFA 1BRPA 1YP7A 2AT8X 1R0UA 2AT0X 4IMOA 1GX9A 5L8IA 4Y0RA 2HMBA 1KXOA 2NNQA 3CMPA 2W2FA 1LPJA 1OBUA 3OJYC 2O62A 1DZKA 1ZRYA 2FWVA 4MVIA 1FE3A 1PMPA 3NQ9A 2OFRX 4HFOA 3BY0A 2A0AA 1LIEA 4DQ3A 3P6HA 1VYFA 4QAEA 3KFGA 1X71A 1UREA 4NLIA 2RCQA 1OPBA 1VYGA 2ASNX 4ZHCA 3FR2A 1QG5A 1CRBA 1QWDA 4YFQA 2Q2PA 2KT4B 5HA1A 2Q9SA 1NP1A 1SY3A 5LKEA 2FRSA 2CBRA 3B2IA 4EXZA 3AKNA 5LJHA 2R73A 4BVMA 4I3CA 1QFTA 1ZNEA 1E5PA 2FS7A 1DC9A 2ACOA 2L68A 3UEVA 5HZ6A 3B2LA 1G5WA 1GT4A 2RA6A 1ML7A 4IB8A 5DG4A 4GNYA 2CM9A 1Z24A 3B2JA 2R56A 3APWA 4YCHA 2WSJA 1EQDA 2OZQA 3KFFA 1HMSA 2HNXA 2AMMX 4Y0QA 2HYSA 1G74A 1A18A 3BU9A 3NQ3A 4AZMA 1GKAB 3VG4A 1U18A 3IFBA 1CBQA 2GC9A 5HWZA 4ARHA 1LIBA 1IFBA 3WJEA 5D48A 1T8VA 1ALBA 1KT6A 1KT3A 1PBOA 3O19A 4YGGA 4BOEA 4NP1A 4TKHA 1EIOA 3O2YA 3PECA 4Y0PA 4K19A 2QO5A 2WR6A 4LZVA 1BBPA 3K3LA 4QYNA 4QZUA 2FR2A 1X8UA 1YWDA 3QKGA 3P6GA 1JV4A 3ZUOA 4A1YA 3KFIA 1QABE 3HWFA 3NR3A 4ZHHA 1KT7A 3NP1A 5HAEA 2ANSA 3PPTA 5EPQA 1CBRA 2CZTA 3AKMA 2N93A 4OMWA 2JU8A 3BX7A 3G7XA 5KICA 3IA8A 1LICA 1GXAA 2R74A 3CWKA 1SXYA 1XCAA 5IO7A 5D8JA 1N0SA 2RD7C 4TLJA 2FR3A 4I9SA 2G7BA 1LFOA 4NLJA 3FW5A 4GE1A 4MVKA 5HTDA 3D95A 5B29A 1B8EA 1LIFA 4TKJA 1G85A 2WQ9A 3FR5A 4AZQA 1EUOA 1IW2A 4GRJA 3U03A 1MX7A 2JU3A 1FEMA 5HZ8A 2L5PA 3FA8A 1TW4A 5EEDA 1P6PA 1D2UA 1MDCA 5BVQA 5IO5A 1KOIA 2E4JA 1NP4A 4TJZA 3UEWA 3EYCA 1QQSA 2F73A 2HLVA 3STNA 3VG7A 2AKQA 1TOWA 3FA9A 1JYJA 4OS3A 3HWDA 3JSQA 1ICMA 5LJGA 4YGHA 1UZ2X 4NYRA 3P6FA 4TQ2A 4YKMA 4UU2A 4GH7A 3FEKA 4NNTA 4ZCBA 4IB9A 1SXUA 3VG6A 2XSTA 1ZNHA 3RSWA 4RUUA 4IB7A 3ZQ3A 5EZ2A 1TOUA 1QY1A 3NPOA 1E06A 1I06A 2GTFX 1X8NA 1EXSA 3NX2A 1VPRA 3EM0A 5EDCA 2CM4A 3WBGA 4EFGA 1PEEA 3FENA 5KHPA 1SY2A 4QGVA 3FA7A 3FIQA 1BEBA 2POAA 2WWPA 2P8GA 4A8ZA 5H9NA 1ZNGA 4CK4A 4RUNA 4YBUA 2GJ5A 2DM5A 5HCDC 3PEDA 1EALA 5F6ZA 3S26A 1GT1A 4I9RA 3DSZA 4ALOA 2KTDA 4N7DA 1MUPA 4O9SA 4Y0SA 2A2GA 3D97A 4HPCA 5D45A 2LBVA 5F6BA 1IKEA 2A2UA 4XMFA 3O22A 2AL0X 3SAOA 4QGXA 1NGLA 3UEUA 2WQAE 4XMEA 4ORRA 1GT3A 4ALBA 2WUTA 1U17A 1GKAA 2JN3A 1YIVA 2RCTA 2OVAA 2AT3X 5LKFA 2HZQA 1LF7A 1YWCA 1AELA 5CE4A 3WJCA 4IAXA 1IKJA 2X45A 4XMCA 5IO6A 2HZRA 1JJJA 1JYDA 2LBAA 1O1UA 3EMMA 1YWAA 2Q39A 3TZSA 5FFHA 1FENA 3HWEA 1CJ5A 3BDRA 3WJFA 1ERBA 3TGBA 4AZNA 3APUA 2K23A 2LB6A 4IMNA 1I04A 1BWYA 1B4MA 1G7NA 4OS0A 1BLRA 4ZHGA 1HQPA 5HCEC 1ICNA 5F58A 3FLLA
chains in the Genus database with same CATH superfamily
4NW4A 1SWFA 4ZHFA 1HBPA 1XKIA 2C1QA 3T6LA 4GNWA 3STKA 2JU7A 3MBTA 4NNSA 3CBSA 4HWMA 1JMZA 1SWHA 2A13A 2QO6A 2Y3EA 3BS2A 4GGTA 5FENA 2Z4IA 1SWUA 1BM5A 3BRNA 1PTSA 1GX8A 1TVQA 2FT9A 2OFBA 1MM9A 2QO4A 2WEWA 3KQ0A 4WHIA 1ZNKA 3WYQA 1OEJA 4ZHDA 3CBCA 1SXWA 4JNJA 1KQXA 2G5LA 5BVSA 5IRAA 4Z27A 4WFVA 1LCWA 3TGAA 4IRWA 1STSB 4JGLA 3KFHA 3H3IA 3B2HA 1VWJB 2FS6A 1KQWA 1SWKA 4OKAA 2MM3A 1Y9LA 1KT5A 2RTRB 2RTPB 3APVA 4I6SA 4ON1A 5H9KA 2AH7X 3RDXA 3WZOA 3BU1A 4LQZA 1MVGA 3ELZA 1DZMA 1OSPO 3VPJE 1K24A 3VHMA 5HCCC 3SLTA 3WJBA 1SWTA 5LJEA 4I3DA 2IFBA 2IZHB 1JJXA 4DQ4A 1T0VA 1OEEA 3C78X 1AVDA 1D3SA 2AT6X 4XMDA 1HN2A 1LDOA 1DZJA 2BLGA 1U0XA 2A5BA 3ZW1A 1BSQA 3TF6A 4WFUA 4AW8A 1DF3A 2EU7X 1CBIA 3DTQA 2JOZA 1UYOX 2F09A 3NBXX 1SY0A 4AZRA 3U0DA 1RBPA 4ORYA 1AVGI 5D4AA 1Y52X 1IIUA 1H91A 4ID2A 1SWOA 1X8QA 3PH5A 4LKPA 2FTBA 4KC7A 1QFVA 4U8UN 2GTLO 5HTEA 1IFCA 1VWGB 2X4MA 5AQ6A 3ZW1B 5BVTA 3V8UA 4U46A 1EIIA 1OEKA 1SXXA 2K62A 2LA7A 2OVEA 2MF6A 4GETA 5B11O 1KT4A 3EBWA 1QY2A 1X8PA 4IB6A 4ODDA 4OMXA 4YGZA 4D6AA 5LJBA 1WBIA 1VWAB 3L4RA 1WUBA 3PH6A 2VDFA 3PDFA 5H9LA 3SZJA 3WZNA 1JBHA 2OVDA 3B2KA 2RTNB 1L6MA 3AUMO 3FMZA 1GT5A 4AYHA 1B56A 1MK5A 3WOVA 3STMX 4WBKA 5L3YA 1EW3A 1RXHA 1VWFB 2IZGB 5H8TA 3GAQA 1A3YA 3ZUIA 4ORXA 3VE2A 4O3YA 4N7CA 3WJGA 4ORWA 2GTLM 2Q4NA 4XMHA 2HKDA 3P6CA 3ELXA 3FLLA 5B27A 1HBQA 1VWDB 3U9PC 3FW4A 3EC5A 1ZNLA 2RTAA 4UU3A 4EDEA 3FR4A 4QGWA 4YKOA 1LCZA 4BQUA 3I17A 5AEOA 4NV7A 4HPBA 3WJDA 3HTYA 4M7MA 3ZW0B 3FDCA 1KGLA 1PBYA 4KIIA 5IRUA 1KL4A 2FLJA 1VWCB 5IXGA 2MO5A 1EPBA 1LUQA 1OBPA 5EDBA 3I0AA 3APXA 3LTWA 4LZUA 1NBXA 3OE3A 4BGFA 1EPAA 1AQBA 1LKEA 4A1HA 5JD2A 1SLGB 3F8AA 2KTSA 1AB0A 4EEJA 4ZH6A 5HZ9A 2RTKA 1VWHB 1DFVA 2BC3A 3Q6LA 3BX8A 2RQ0A 4YVBA 1MOYA 1N9MA 4ZGFA 3FELA 3HWGA 4BX6B 2C4IA 2OFMX 1SWQA 4ZFXA 1O8VA 3NADA 1S7DA 2CBSA 1RLBE 5H9AA 4CDDA 4TKBA 5EEEA 2OL8O 4Z28A 4DNEA 2ALLX 4ML7B 5BYPA 1OBQA 2BT9A 3RDSA 5HZQA 1DF8A 1SA8A 1SY1A 3CR6A 1X89A 2JGSA 3C77X 1E00A 3EW2A 3F6ZB 2FHNX 2Y3FA 4U8UO 3UAQA 1STPA 2W2AA 4CPIA 2AVIA 1A2DA 1HMRA 3CQRA 1LNMA 2NP1A 5LJDA 2RTHB 4GUZA 1BRQA 5HZ5A 4BCSA 2Q2MA 5CSEA 3VGWA 3X00A 3TGCA 1SWBA 2X34A 1UYNX 1B0OA 4ES7A 2G78A 2ZAIA 1X8OA 1ERXA 1DZPA 2NNEA 4ORUA 1GM6A 2G79A 3JS1A 2XKLA 3WVMA 3SLOA 2IZIA 5JR8A 2X46A 2LFOA 3VG2A 1N4JA 5DPQA 2CAMA 4ZGUA 3WYPA 2X8SA 4GKCA 4GDZA 4ORSA 4U8UM 4BX5B 4CPHB 5FAZA 3BSZE 4LKTA 4HPDA 1SREA 3Q34A 4NYQA 5LJCA 4O3XB 3F9DA 3HK1A 1CBSA 5HA0A 4Z2VA 1BJ7A 3P6EA 4GGRA 1FDQA 4QZTA 1ADLA 1JIWI 2RTQB 4ZJ0A 2JW1A 1S44A 2G8CO 4KC8A 4PJ2A 4YBPA 1YP6A 1SLDB 4HPAA 1SWLA 2OYBO 1A57A 1MX8A 2QMIA 4ZR2A 4AZOA 1JJUA 5B5FA 1FELA 1HMTA 3EBKA 3RDQA 2VFBA 1OPAA 3P6DA 3PP6A 5K06A 1LCVA 3VHHA 3C76X 4INNA 4I3BA 3VE1A 1I4UA 1I05A 1ACDA 1LIDA 2AF5A 4MVLA 2IZKA 2DJFA 3SZIA 1ZNDA 2A3FX 2QM9A 2ZSCA 4IBAA 1GGLA 4YDBA 3FA6A 2FHLA 5C0NA 1BSYA 1STRB 2WEXA 1HXLA 1TXLA 2L9CA 1BSOA 3VHIA 4GK9A 3RZYA 2LKKA 3UEXA 4R0BA 4M6SA 4XMGA 3VG3A 1JZUA 4JO6A 3ZWEA 5FQ6E 4OS8A 1KL3A 4KH8A 3BLGA 3FEPA 5F1EA 2QOSC 1W5RA 4YH0A 3S5XA 3RE5A 5L8NA 1VWPB 2ACPX 1KZWA 1NC9A 1Y55X 3RDMA 4QYPA 1SLFB 2RTLA 3VG5A 4C5PA 3RWXA 2PY1A 4PSQA 5KIDA 5LJKA 1YUPA 2X8TA 5L8OA 4IAWA 4YCEA 1S2PA 3D96A 4U3QA 5F7GA 5IRWA 4O4XA 5B3MO 2L67A 5K68A 4D6BA 4BX7B 4YMYA 3PK2A 4FGIB 1VWQB 4YFPA 1PM1X 3ZW2A 4YFRA 2W2BA 2UYWA 3CQNA 1FJ1E 4AZPA 4YDAA 1T68X 1HXZA 2NNDA 1FTPA 1YWBA 5HBSA 3RY2A 1VWBB 1KZXA 4TNNA 2MJIA 2YG2A 1O1VA 5FQ7E 2CZUA 3NX1A 4FQBB 4O4SA 4A60A 1DV9A 4FBOA 3KZAA 5D47A 4ZH9A 1SRJA 3ZW0A 1E02A 3WXQA 3T1DA 1Y0GA 2AT5X 1QY0A 2IZJA 3MVFA 1BRPA 1YP7A 4BJ8A 1N9YA 2AT8X 1R0UA 2AT0X 2QCBA 2RTIB 3WZPA 2C1SA 1GX9A 4IMOA 1SWDA 2RTEB 4I95A 5L8IA 4DCBA 2RTCB 1E2TA 2OF9A 4MIRA 2HMBA 4Y0RA 1KXOA 2NNQA 1VWRB 1VYOA 3CMPA 2W2FA 1LPJA 1Y53X 1OBUA 2X32A 1GX3A 3OJYC 4QQ1A 2O62A 1RXJA 3GE2A 1DZKA 1ZRYA 2FWVA 4GZVA 1SWRA 3S5VA 4BX6A 3T2WA 4MVIA 4CDCA 3T2XA 3CKFA 4I60A 1MEPA 1FE3A 1PMPA 1VWEB 2OFRX 2Y32A 3NQ9A 4KT5A 3ZZVA 1I78A 4HFOA 3N91A 2RTJA 3BY0A 2A0AA 3SZHA 2OL7A 1LIEA 4DQ3A 3P6HA 1VYFA 4QAEA 3KFGA 1LELA 1X71A 1UREA 1SWEA 2MWHA 4NLIA 1I9HA 2RCQA 1KFFA 1OPBA 1VYGA 2ASNX 4ZHCA 5K67A 3FR2A 4CDEA 1QG5A 1CRBA 1QWDA 1SWPA 2I5ZO 2IZDB 3D4RA 3PQSA 4YFQA 5B2AO 2DJGA 1SRFA 2KT4B 2Q2PA 1NP1A 1SY3A 2Q9SA 5HA1A 5LKEA 2FRSA 2CBRA 3B2IA 4EXZA 3AKNA 5LJHA 2R73A 4BVMA 2IZFB 4I3CA 1QFTA 1ZNEA 1E5PA 4O3ZA 4EQAC 2FS7A 1DC9A 2ACOA 2L68A 3UEVA 1RAVA 5HZ6A 3B2LA 1SWAA 1G5WA 1GT4A 2RA6A 1ML7A 4IB8A 5DG4A 4GNYA 3AEHA 4BX5A 2CM9A 2VFCA 4CPHA 4U9CA 1Z24A 1KL5A 2R56A 3B2JA 3APWA 3HPEA 3P24A 4O3WA 4YCHA 2WSJA 1EQDA 2OF8A 2OZQA 3KFFA 2PI3O 1AVEA 1HMSA 2HNXA 2AMMX 4Y0QA 2HYSA 1G74A 1A18A 2QOMA 3BU9A 3FIDA 3NQ3A 1GKAB 2Z4HA 1NQMA 3LV4A 2OY7A 4AZMA 2YMSA 3VG4A 3RBYA 1U18A 3IFBA 1CBQA 2GC9A 4B55A 2ZAGA 3SLJA 5HWZA 2FKGA 4ARHA 1JMXA 3QQ2A 1LIBA 1IFBA 3WJEA 5D48A 1T8VA 1ALBA 1KT6A 1KT3A 1PBOA 2BS6A 2GH7A 3EW1A 3O19A 4YGGA 3RY1A 4BOEA 4NP1A 4TKHA 1EIOA 2I5VO 2BS5A 3O2YA 3PECA 4Y0PA 4K19A 2QO5A 2WR6A 3KVNA 3NQKA 1BBPA 3K3LA 3MM0A 4LZVA 4QYNA 2FR2A 1X8UA 4QZUA 1YWDA 3QKGA 3P6GA 1JV4A 3ZUOA 3HOLA 2OY8A 4A1YA 4BBOA 3KFIA 1QABE 1RXKA 4Y5DA 3HWFA 3NR3A 1SMPI 2RTOB 1KT7A 3NP1A 4ZHHA 3VU1A 5HAEA 2ANSA 3PPTA 4O4OA 3FYFA 5EPQA 1CBRA 2CZTA 3AKMA 4CPFA 4EKVA 1JQPA 2N93A 4COTA 4L1NA 2FKJA 4OMWA 2JU8A 3BX7A 2X56A 2OFAA 2F01A 3G7XA 3IA8A 5KICA 1LICA 1GXAA 3RE6A 2R74A 3CWKA 1SXYA 1SRGA 1XCAA 5D8JA 1N0SA 5IO7A 2X55A 2RD7C 4TLJA 3HOEA 2FR3A 3D9WA 4I9SA 1SWGA 4MEEA 2G7BA 4BX7A 1LFOA 1W6FA 1N43A 1W4TA 2BSZA 3FW5A 4GE1A 4GJSA 1VWKB 4MVKA 4NLJA 2RN4A 3D95A 5B29A 4CV7A 1B8EA 1LIFA 4TKJA 5HTDA 1G85A 3RKGA 2WQ9A 2RTGB 1RSUB 3FR5A 4AZQA 2BHVA 1EUOA 1IW2A 4GRJA 3U03A 2WPUA 1MX7A 2FGSA 2JU3A 3LHNA 4OELA 3SOTA 2M4LA 1FEMA 4MVEA 3RDOA 5HZ8A 1SRHA 2L5PA 3FA8A 1TW4A 5EEDA 3E3CA 1P6PA 4MISA 1D2UA 1MDCA 2JMBA 5BVQA 5IO5A 1KOIA 2E4JA 4L3RA 1NP4A 4TJZA 3UEWA 3EYCA 5FQ8E 1QQSA 1SWJA 2F73A 2HLVA 3STNA 3VG7A 1LDQA 2AKQA 1TOWA 3FA9A 1JYJA 4OS3A 5CHKA 2IZBA 3HWDA 2IZAA 3JSQA 2RTDB 1ICMA 5LJGA 4CPEA 4YGHA 1EI5A 1HQQA 1UZ2X 3P6FA 4NYRA 2RTBB 4NV8A 2OY1O 4UU2A 1SWCA 2IZLB 4GH7A 4YKMA 4TQ2A 4QNIA 3FEKA 4NNTA 2OVSA 4ZCBA 4IB9A 1SXUA 3VG6A 2XSTA 1ZNHA 1NDJA 3RSWA 4RUUA 4FBRA 4IB7A 3ZQ3A 5EZ2A 1TOUA 1QY1A 2MHDA 1E06A 1I06A 2GTFX 1X8NA 3NPOA 1EXSA 3NX2A 4CDFA 1VPRA 3EM0A 3MX7A 5EDCA 2CM4A 3PQUA 3WBGA 3ZI8A 4EFGA 1PEEA 3CKGA 1VWIB 3FENA 5KHPA 1NQNA 1SY2A 3MG5A 4QGVA 3FA7A 3FIQA 1BEBA 3OD9A 5B5GA 1N7YA 2POAA 2WWPA 3OBLA 2P8GA 1VWNB 4A8ZA 5H9NA 4GJVA 1ZNGA 4O4UA 4CK4A 4RUNA 2X8FA 2A5CA 4YBUA 2GJ5A 2DM5A 5HCDC 3PEDA 1EALA 5F6ZA 3P02A 3S26A 1GT1A 4I9RA 3DSZA 5AJCA 4ALOA 1VWOB 2KTDA 4N7DA 1MUPA 4O9SA 4Y0SA 2A2GA 3D97A 4HPCA 5D45A 2LBVA 5CYBA 5F6BA 2IZCB 1IKEA 2A2UA 2RTFB 3O22A 2AL0X 4GD9A 1VWMB 4XMFA 3SAOA 4QGXA 1NGLA 3UEUA 4O49A 2WQAE 2KD2A 1SRIA 4FBVA 4XMEA 4ORRA 1GT3A 3T6FA 4ALBA 1SLEB 2WUTA 1U17A 1GKAA 4OEMA 3S60A 2JN3A 1YIVA 2RCTA 4QRLA 2OVAA 2AT3X 4GDAA 5LKFA 2HZQA 1LF7A 1YWCA 5AJBA 2OY5O 5CE4A 1AELA 2RTMA 1SWSA 5F2BA 3WJCA 4IAXA 1IKJA 2X45A 3JQOA 4KCAA 4XMCA 1SWNA 4Z6JA 3WZQA 4Z2OA 5IO6A 2HZRA 1JJJA 1JYDA 2LBAA 1O1UA 3EMMA 1YWAA 5B10O 2Q39A 3TZSA 1HY2A 5FFHA 1K3BA 1FENA 4IABA 3HWEA 1CJ5A 2GTLN 3BDRA 3WJFA 1ERBA 1RSTB 4GU8A 1Y9TA 4AZNA 3TGBA 3APUA 2K23A 2LB6A 4IMNA 1I04A 4GGZA 1BWYA 1B4MA 3RDUA 1G7NA 4OS0A 1IJ8A 4Y59A 4CSBA 4JHQA 2KW1A 4Z2PA 4ZHGA 1BLRA 2IZEB 1HQPA 5HCEC 1ICNA 5F58A 2A8GA 2OL6O 1VWLB 2UZ2A
chains in the Genus database with same CATH topology
4NW4A 4ZHFA 1HBPA 1XKIA 4GNWA 3STKA 2JU7A 3MBTA 4NNSA 3CBSA 4HWMA 2A13A 2QO6A 3BS2A 5FENA 1BM5A 2Z4IA 3BRNA 2FT9A 1GX8A 1TVQA 2WEWA 4WHIA 2QO4A 3KQ0A 1ZNKA 1OEJA 4ZHDA 3CBCA 1SXWA 5BVSA 1KQXA 4WFVA 3TGAA 4JGLA 3KFHA 3H3IA 3B2HA 2FS6A 1KQWA 5H9KA 2MM3A 1Y9LA 1KT5A 3APVA 4I6SA 4ON1A 2AH7X 3BU1A 4LQZA 1MVGA 3ELZA 1DZMA 3VPJE 5HCCC 3WJBA 5LJEA 4I3DA 2IFBA 1JJXA 4DQ4A 1T0VA 1OEEA 3C78X 1D3SA 2AT6X 4XMDA 1HN2A 1DZJA 2BLGA 1U0XA 3ZW1A 1DF3A 1BSQA 3TF6A 4WFUA 4AW8A 2EU7X 1CBIA 3DTQA 2JOZA 3NBXX 2F09A 3U0DA 1SY0A 4AZRA 1RBPA 4ORYA 1AVGI 5D4AA 1IIUA 1H91A 4ID2A 1X8QA 3PH5A 4LKPA 2FTBA 4KC7A 1QFVA 4U8UN 2GTLO 5HTEA 1IFCA 3ZW1B 5AQ6A 5BVTA 3V8UA 1EIIA 1OEKA 1SXXA 2K62A 2LA7A 2OVEA 4GETA 1KT4A 3EBWA 1QY2A 1X8PA 4IB6A 4ODDA 4OMXA 4YGZA 4D6AA 5LJBA 3L4RA 3PH6A 5H9LA 1JBHA 2OVDA 3B2KA 1L6MA 3FMZA 4AYHA 1GT5A 1B56A 3WOVA 3STMX 4WBKA 1EW3A 5H8TA 3GAQA 1A3YA 3ZUIA 4ORXA 3VE2A 4O3YA 4N7CA 3WJGA 4ORWA 2GTLM 2Q4NA 4XMHA 3P6CA 3ELXA 5B27A 1HBQA 3U9PC 3FW4A 1ZNLA 4UU3A 4EDEA 3FR4A 4QGWA 4YKOA 4BQUA 3I17A 5AEOA 4HPBA 3WJDA 3HTYA 4M7MA 3ZW0B 1KGLA 4KIIA 2FLJA 2MO5A 1EPBA 1OBPA 5EDBA 3I0AA 3APXA 4LZUA 3OE3A 1EPAA 1AQBA 1LKEA 4A1HA 3F8AA 2KTSA 1AB0A 4EEJA 4ZH6A 5HZ9A 1DFVA 3Q6LA 3BX8A 2RQ0A 4ZGFA 3FELA 3HWGA 2OFMX 4ZFXA 1O8VA 3NADA 1S7DA 2CBSA 1RLBE 5H9AA 4TKBA 5EEEA 5BYPA 2ALLX 4ML7B 1OBQA 2BT9A 5HZQA 1SA8A 1SY1A 3CR6A 1X89A 3C77X 1E00A 3F6ZB 4U8UO 3UAQA 2W2AA 1HMRA 1A2DA 3CQRA 1LNMA 2NP1A 5LJDA 1BRQA 5HZ5A 2Q2MA 3TGCA 1B0OA 4ES7A 2G78A 2ZAIA 1X8OA 1ERXA 1DZPA 2NNEA 4ORUA 1GM6A 2G79A 3JS1A 2XKLA 3WVMA 5JR8A 2X46A 2LFOA 3VG2A 5DPQA 4ZGUA 2X8SA 4GKCA 4GDZA 4ORSA 4U8UM 5FAZA 3BSZE 4LKTA 4HPDA 4NYQA 5LJCA 4O3XB 3F9DA 3HK1A 1CBSA 5HA0A 1BJ7A 3P6EA 1FDQA 4QZTA 1ADLA 1JIWI 4ZJ0A 2JW1A 1S44A 4KC8A 4PJ2A 4YBPA 1YP6A 4HPAA 1A57A 1MX8A 2QMIA 4ZR2A 4AZOA 1FELA 1HMTA 3EBKA 3P6DA 1OPAA 3PP6A 5K06A 3C76X 4INNA 4I3BA 3VE1A 1I4UA 1I05A 1ACDA 1LIDA 4MVLA 1ZNDA 2A3FX 2QM9A 4IBAA 1GGLA 4YDBA 3FA6A 5C0NA 1BSYA 2WEXA 1TXLA 2L9CA 1BSOA 4GK9A 3RZYA 2LKKA 3UEXA 4R0BA 4M6SA 4XMGA 3VG3A 1JZUA 3ZWEA 5FQ6E 4OS8A 4KH8A 3BLGA 3FEPA 5F1EA 2QOSC 4YH0A 3S5XA 5L8NA 2ACPX 1KZWA 4QYPA 3VG5A 3RWXA 2PY1A 4PSQA 5KIDA 5LJKA 1YUPA 2X8TA 5L8OA 4IAWA 4YCEA 1S2PA 3D96A 4U3QA 5F7GA 4O4XA 2L67A 4D6BA 4YMYA 4FGIB 4YFPA 1PM1X 3ZW2A 4YFRA 2W2BA 3CQNA 4AZPA 4YDAA 1T68X 2NNDA 1FTPA 1YWBA 5HBSA 1KZXA 4TNNA 2MJIA 2YG2A 1O1VA 5FQ7E 2CZUA 3NX1A 4FQBB 4O4SA 4A60A 1DV9A 4FBOA 3KZAA 5D47A 4ZH9A 3ZW0A 1E02A 3WXQA 3T1DA 2AT5X 1QY0A 3MVFA 1BRPA 1YP7A 2AT8X 1R0UA 2AT0X 4IMOA 1GX9A 5L8IA 4I95A 4Y0RA 4MIRA 2HMBA 1KXOA 2NNQA 3CMPA 2W2FA 1LPJA 1OBUA 3OJYC 4QQ1A 2O62A 3GE2A 1DZKA 1ZRYA 2FWVA 4GZVA 3S5VA 4MVIA 1FE3A 1PMPA 3NQ9A 2OFRX 4KT5A 3ZZVA 4HFOA 3N91A 3BY0A 2A0AA 1LIEA 4DQ3A 3P6HA 1VYFA 4QAEA 3KFGA 1X71A 1UREA 2MWHA 4NLIA 2RCQA 1OPBA 1VYGA 2ASNX 4ZHCA 3FR2A 1QG5A 1CRBA 1QWDA 3PQSA 4YFQA 3D4RA 2Q2PA 2KT4B 5HA1A 2Q9SA 1NP1A 1SY3A 5LKEA 2FRSA 2CBRA 3B2IA 4EXZA 3AKNA 5LJHA 2R73A 4BVMA 4I3CA 1QFTA 1ZNEA 1E5PA 4O3ZA 4EQAC 2FS7A 1DC9A 2ACOA 2L68A 3UEVA 5HZ6A 3B2LA 1G5WA 1GT4A 2RA6A 1ML7A 4IB8A 5DG4A 4GNYA 2CM9A 4U9CA 1Z24A 3B2JA 2R56A 4O3WA 3APWA 3P24A 4YCHA 2WSJA 1EQDA 2OZQA 3KFFA 1HMSA 2HNXA 2AMMX 4Y0QA 2HYSA 1G74A 1A18A 3BU9A 3NQ3A 4AZMA 1GKAB 2Z4HA 3LV4A 2YMSA 3VG4A 3RBYA 1U18A 3IFBA 1CBQA 2GC9A 2ZAGA 5HWZA 4ARHA 1LIBA 1IFBA 3WJEA 5D48A 1T8VA 1ALBA 1KT6A 1KT3A 1PBOA 2BS6A 3O19A 4YGGA 4BOEA 4NP1A 4TKHA 1EIOA 2BS5A 3O2YA 3PECA 4Y0PA 4K19A 2QO5A 2WR6A 4LZVA 3NQKA 1BBPA 3K3LA 4QYNA 4QZUA 2FR2A 1X8UA 1YWDA 3QKGA 3P6GA 1JV4A 3ZUOA 3HOLA 4A1YA 3KFIA 1QABE 3HWFA 3NR3A 1SMPI 4ZHHA 1KT7A 3NP1A 3VU1A 5HAEA 2ANSA 3PPTA 4O4OA 3FYFA 5EPQA 1CBRA 2CZTA 3AKMA 2N93A 4COTA 4L1NA 4OMWA 2JU8A 3BX7A 3G7XA 5KICA 3IA8A 1LICA 1GXAA 2R74A 3CWKA 1SXYA 1XCAA 5IO7A 5D8JA 1N0SA 2RD7C 4TLJA 3HOEA 2FR3A 4I9SA 2G7BA 1LFOA 4NLJA 3FW5A 4GE1A 4MVKA 4CV7A 5HTDA 2RN4A 3D95A 5B29A 1B8EA 1LIFA 4TKJA 1G85A 3RKGA 2WQ9A 3FR5A 4AZQA 2BHVA 1EUOA 1IW2A 4GRJA 3U03A 1MX7A 3LHNA 2JU3A 3SOTA 2M4LA 1FEMA 4MVEA 5HZ8A 2L5PA 3FA8A 1TW4A 5EEDA 3E3CA 1P6PA 4MISA 1D2UA 1MDCA 2JMBA 5BVQA 5IO5A 1KOIA 2E4JA 4L3RA 1NP4A 4TJZA 3UEWA 3EYCA 5FQ8E 1QQSA 2F73A 2HLVA 3STNA 3VG7A 2AKQA 1TOWA 3FA9A 1JYJA 4OS3A 3HWDA 3JSQA 1ICMA 5LJGA 4YGHA 1EI5A 1UZ2X 3P6FA 4NYRA 4CSBA 4TQ2A 4YKMA 4UU2A 4GH7A 4QNIA 3FEKA 4NNTA 2OVSA 4ZCBA 4IB9A 1SXUA 3VG6A 2XSTA 1ZNHA 3RSWA 4RUUA 4FBRA 4IB7A 3ZQ3A 5EZ2A 1TOUA 1QY1A 2MHDA 1E06A 1I06A 2GTFX 1X8NA 3NPOA 1EXSA 3NX2A 1VPRA 3EM0A 3MX7A 5EDCA 2CM4A 3PQUA 3WBGA 3ZI8A 4EFGA 1PEEA 3FENA 5KHPA 1SY2A 4QGVA 3FA7A 3FIQA 1BEBA 3OD9A 2POAA 2WWPA 3OBLA 2P8GA 4A8ZA 5H9NA 1ZNGA 4O4UA 4CK4A 4RUNA 2X8FA 4YBUA 2GJ5A 2DM5A 5HCDC 3PEDA 1EALA 5F6ZA 3P02A 3S26A 1GT1A 4I9RA 3DSZA 5AJCA 4ALOA 2KTDA 4N7DA 1MUPA 4O9SA 4Y0SA 2A2GA 3D97A 4HPCA 5D45A 2LBVA 5CYBA 5F6BA 1IKEA 2A2UA 4XMFA 3O22A 2AL0X 3SAOA 4QGXA 1NGLA 3UEUA 4O49A 2WQAE 2KD2A 4FBVA 4XMEA 4ORRA 1GT3A 4ALBA 2WUTA 1U17A 1GKAA 3S60A 2JN3A 1YIVA 2RCTA 4QRLA 2OVAA 2AT3X 5LKFA 2HZQA 1LF7A 1YWCA 5AJBA 5CE4A 1AELA 3WJCA 4IAXA 1IKJA 2X45A 3JQOA 4KCAA 4XMCA 5IO6A 2HZRA 1JJJA 1JYDA 2LBAA 1O1UA 3EMMA 1YWAA 2Q39A 3TZSA 5FFHA 1FENA 4IABA 3HWEA 1CJ5A 2GTLN 3BDRA 3WJFA 1ERBA 4GU8A 1Y9TA 4AZNA 3TGBA 3APUA 2K23A 2LB6A 4IMNA 1I04A 1BWYA 1B4MA 1G7NA 4OS0A 1BLRA 2KW1A 4ZHGA 1HQPA 5HCEC 1ICNA 5F58A 3FLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHF A;  1HBP A;  1XKI A;  4GNW A;  3STK A;  2JU7 A;  3MBT A;  4NNS A;  3CBS A;  2A13 A;  2QO6 A;  3BS2 A;  5FEN A;  1BM5 A;  3BRN A;  2FT9 A;  1GX8 A;  1TVQ A;  2WEW A;  2QO4 A;  3KQ0 A;  1ZNK A;  1OEJ A;  4ZHD A;  3CBC A;  1SXW A;  5BVS A;  1KQX A;  4WFV A;  3TGA A;  3KFH A;  3B2H A;  2FS6 A;  1KQW A;  5H9K A;  2MM3 A;  3APV A;  1KT5 A;  2AH7 X;  3BU1 A;  1MVG A;  3ELZ A;  1DZM A;  5HCC C;  3WJB A;  5LJE A;  4I3D A;  2IFB A;  1JJX A;  4DQ4 A;  1T0V A;  1OEE A;  3C78 X;  1D3S A;  2AT6 X;  4XMD A;  1HN2 A;  1DZJ A;  2BLG A;  1U0X A;  1DF3 A;  1BSQ A;  3TF6 A;  4WFU A;  4AW8 A;  2EU7 X;  1CBI A;  3DTQ A;  2JOZ A;  3U0D A;  1SY0 A;  4AZR A;  1RBP A;  4ORY A;  1AVG I;  5D4A A;  1IIU A;  1H91 A;  1X8Q A;  3PH5 A;  4LKP A;  2FTB A;  5LJB A;  1QFV A;  5BVT A;  5HTE A;  1IFC A;  5AQ6 A;  1EII A;  1OEK A;  1SXX A;  2K62 A;  2OVE A;  4GET A;  1KT4 A;  3EBW A;  1QY2 A;  1X8P A;  4IB6 A;  4ODD A;  4OMX A;  4YGZ A;  4D6A A;  3L4R A;  3PH6 A;  5H9L A;  1JBH A;  2OVD A;  3B2K A;  1L6M A;  3FMZ A;  4AYH A;  1GT5 A;  1B56 A;  3STM X;  4WBK A;  1EW3 A;  5H8T A;  3GAQ A;  1A3Y A;  3ZUI A;  4ORX A;  4N7C A;  3WJG A;  4ORW A;  2Q4N A;  4XMH A;  3P6C A;  3ELX A;  5B27 A;  1HBQ A;  3U9P C;  3FW4 A;  1ZNL A;  4UU3 A;  4EDE A;  3FR4 A;  4QGW A;  4YKO A;  4BQU A;  3I17 A;  4HPB A;  3WJD A;  4M7M A;  1KGL A;  4KII A;  2FLJ A;  2MO5 A;  1EPB A;  1OBP A;  5EDB A;  3I0A A;  3APX A;  4LZU A;  1EPA A;  1AQB A;  1LKE A;  4A1H A;  3F8A A;  1AB0 A;  4EEJ A;  4ZH6 A;  5HZ9 A;  1DFV A;  3Q6L A;  3BX8 A;  2RQ0 A;  3FEL A;  3HWG A;  2OFM X;  4ZFX A;  1O8V A;  3NAD A;  1S7D A;  2CBS A;  1RLB E;  5H9A A;  4TKB A;  5EEE A;  2ALL X;  1OBQ A;  5HZQ A;  1SA8 A;  1SY1 A;  3CR6 A;  1X89 A;  3C77 X;  1E00 A;  2W2A A;  1HMR A;  1A2D A;  3CQR A;  1LNM A;  2NP1 A;  5LJD A;  1BRQ A;  5HZ5 A;  2Q2M A;  3TGC A;  1B0O A;  4ES7 A;  2G78 A;  1X8O A;  1ERX A;  1DZP A;  2NNE A;  4ORU A;  1GM6 A;  2G79 A;  3JS1 A;  2XKL A;  3WVM A;  5JR8 A;  2X46 A;  2LFO A;  3VG2 A;  5DPQ A;  4ZGU A;  4GKC A;  4ORS A;  5FAZ A;  3BSZ E;  4LKT A;  4HPD A;  4NYQ A;  5LJC A;  3F9D A;  3HK1 A;  1CBS A;  5HA0 A;  1BJ7 A;  3P6E A;  1FDQ A;  4QZT A;  1ADL A;  4ZJ0 A;  1S44 A;  4YBP A;  1YP6 A;  4HPA A;  1A57 A;  1MX8 A;  4ZR2 A;  4AZO A;  1FEL A;  1HMT A;  3EBK A;  3P6D A;  1OPA A;  3PP6 A;  5K06 A;  3C76 X;  4I3B A;  1I4U A;  1I05 A;  1ACD A;  1LID A;  4MVL A;  1ZND A;  2A3F X;  2QM9 A;  4IBA A;  1GGL A;  4YDB A;  3FA6 A;  5C0N A;  1BSY A;  2WEX A;  1TXL A;  2L9C A;  1BSO A;  3RZY A;  2LKK A;  3UEX A;  4R0B A;  4M6S A;  4XMG A;  3VG3 A;  1JZU A;  4OS8 A;  5F1E A;  3BLG A;  3FEP A;  2QOS C;  4YH0 A;  5L8N A;  2ACP X;  1KZW A;  4QYP A;  3VG5 A;  5KID A;  2PY1 A;  4PSQ A;  5LJK A;  1YUP A;  5L8O A;  4IAW A;  4YCE A;  1S2P A;  3D96 A;  5F7G A;  2L67 A;  4D6B A;  4YMY A;  4YFP A;  1PM1 X;  4YFR A;  2W2B A;  3CQN A;  4AZP A;  4YDA A;  1T68 X;  2NND A;  1FTP A;  1YWB A;  5HBS A;  1KZX A;  4TNN A;  2MJI A;  2YG2 A;  1O1V A;  2CZU A;  3NX1 A;  4A60 A;  1DV9 A;  3KZA A;  5D47 A;  4ZH9 A;  1E02 A;  3WXQ A;  3T1D A;  2AT5 X;  1QY0 A;  3MVF A;  1BRP A;  1YP7 A;  2AT8 X;  1R0U A;  2AT0 X;  4IMO A;  1GX9 A;  5L8I A;  4Y0R A;  2HMB A;  1KXO A;  2NNQ A;  3CMP A;  2W2F A;  1LPJ A;  1OBU A;  3OJY C;  2O62 A;  1DZK A;  1ZRY A;  2FWV A;  4MVI A;  1FE3 A;  1PMP A;  3NQ9 A;  2OFR X;  4HFO A;  3BY0 A;  2A0A A;  1LIE A;  4DQ3 A;  3P6H A;  1VYF A;  4QAE A;  3KFG A;  1X71 A;  1URE A;  4NLI A;  2RCQ A;  1OPB A;  1VYG A;  2ASN X;  4ZHC A;  3FR2 A;  1QG5 A;  1CRB A;  1QWD A;  4YFQ A;  2Q2P A;  2KT4 B;  5HA1 A;  2Q9S A;  1NP1 A;  1SY3 A;  5LKE A;  2FRS A;  2CBR A;  3B2I A;  4EXZ A;  3AKN A;  5LJH A;  2R73 A;  4BVM A;  4I3C A;  1QFT A;  1ZNE A;  1E5P A;  2FS7 A;  1DC9 A;  2ACO A;  2L68 A;  3UEV A;  5HZ6 A;  3B2L A;  1G5W A;  1GT4 A;  2RA6 A;  1ML7 A;  4IB8 A;  5DG4 A;  4GNY A;  2CM9 A;  1Z24 A;  3B2J A;  2R56 A;  3APW A;  4YCH A;  2WSJ A;  1EQD A;  2OZQ A;  3KFF A;  1HMS A;  2HNX A;  2AMM X;  4Y0Q A;  2HYS A;  1G74 A;  1A18 A;  3BU9 A;  3NQ3 A;  4AZM A;  1GKA B;  3VG4 A;  1U18 A;  3IFB A;  1CBQ A;  2GC9 A;  5HWZ A;  4ARH A;  1LIB A;  1IFB A;  3WJE A;  5D48 A;  1T8V A;  1ALB A;  1KT6 A;  1KT3 A;  1PBO A;  3O19 A;  4YGG A;  4BOE A;  4NP1 A;  4TKH A;  1EIO A;  3O2Y A;  3PEC A;  4Y0P A;  4K19 A;  2QO5 A;  2WR6 A;  4LZV A;  1BBP A;  3K3L A;  4QYN A;  4QZU A;  2FR2 A;  1X8U A;  1YWD A;  3QKG A;  3P6G A;  1JV4 A;  3ZUO A;  4A1Y A;  3KFI A;  1QAB E;  3HWF A;  3NR3 A;  4ZHH A;  1KT7 A;  3NP1 A;  5HAE A;  2ANS A;  3PPT A;  5EPQ A;  1CBR A;  2CZT A;  3AKM A;  2N93 A;  4OMW A;  2JU8 A;  3BX7 A;  3G7X A;  5KIC A;  3IA8 A;  1LIC A;  1GXA A;  2R74 A;  3CWK A;  1SXY A;  1XCA A;  5IO7 A;  5D8J A;  1N0S A;  2RD7 C;  4TLJ A;  2FR3 A;  4I9S A;  2G7B A;  1LFO A;  4NLJ A;  3FW5 A;  4GE1 A;  4MVK A;  5HTD A;  3D95 A;  5B29 A;  1B8E A;  1LIF A;  4TKJ A;  1G85 A;  2WQ9 A;  3FR5 A;  4AZQ A;  1EUO A;  1IW2 A;  4GRJ A;  3U03 A;  1MX7 A;  2JU3 A;  1FEM A;  5HZ8 A;  2L5P A;  3FA8 A;  1TW4 A;  5EED A;  1P6P A;  1D2U A;  1MDC A;  5BVQ A;  5IO5 A;  1KOI A;  2E4J A;  1NP4 A;  4TJZ A;  3UEW A;  3EYC A;  1QQS A;  2F73 A;  2HLV A;  3STN A;  3VG7 A;  2AKQ A;  1TOW A;  3FA9 A;  1JYJ A;  4OS3 A;  3HWD A;  3JSQ A;  1ICM A;  5LJG A;  4YGH A;  1UZ2 X;  4NYR A;  3P6F A;  4TQ2 A;  4YKM A;  4UU2 A;  4GH7 A;  3FEK A;  4NNT A;  4ZCB A;  4IB9 A;  1SXU A;  3VG6 A;  2XST A;  1ZNH A;  3RSW A;  4RUU A;  4IB7 A;  3ZQ3 A;  5EZ2 A;  1TOU A;  1QY1 A;  3NPO A;  1E06 A;  1I06 A;  2GTF X;  1X8N A;  1EXS A;  3NX2 A;  1VPR A;  3EM0 A;  5EDC A;  2CM4 A;  3WBG A;  4EFG A;  1PEE A;  3FEN A;  5KHP A;  1SY2 A;  4QGV A;  3FA7 A;  3FIQ A;  1BEB A;  2POA A;  2WWP A;  2P8G A;  4A8Z A;  5H9N A;  1ZNG A;  4CK4 A;  4RUN A;  4YBU A;  2GJ5 A;  2DM5 A;  5HCD C;  3PED A;  1EAL A;  5F6Z A;  3S26 A;  1GT1 A;  4I9R A;  3DSZ A;  4ALO A;  2KTD A;  4N7D A;  1MUP A;  4O9S A;  4Y0S A;  2A2G A;  3D97 A;  4HPC A;  5D45 A;  2LBV A;  5F6B A;  1IKE A;  2A2U A;  4XMF A;  3O22 A;  2AL0 X;  3SAO A;  4QGX A;  1NGL A;  3UEU A;  2WQA E;  4XME A;  4ORR A;  1GT3 A;  4ALB A;  2WUT A;  1U17 A;  1GKA A;  2JN3 A;  1YIV A;  2RCT A;  2OVA A;  2AT3 X;  5LKF A;  2HZQ A;  1LF7 A;  1YWC A;  1AEL A;  5CE4 A;  3WJC A;  4IAX A;  1IKJ A;  2X45 A;  4XMC A;  5IO6 A;  2HZR A;  1JJJ A;  1JYD A;  2LBA A;  1O1U A;  3EMM A;  1YWA A;  2Q39 A;  3TZS A;  5FFH A;  1FEN A;  3HWE A;  1CJ5 A;  3BDR A;  3WJF A;  1ERB A;  3TGB A;  4AZN A;  3APU A;  2K23 A;  2LB6 A;  4IMN A;  1I04 A;  1BWY A;  1B4M A;  1G7N A;  4OS0 A;  1BLR A;  4ZHG A;  1HQP A;  5HCE C;  1ICN A;  5F58 A;  3FLL A; 
#chains in the Genus database with same CATH topology
 4NW4 A;  1SWF A;  4ZHF A;  1HBP A;  1XKI A;  2C1Q A;  3T6L A;  4GNW A;  3STK A;  2JU7 A;  3MBT A;  4NNS A;  3CBS A;  4HWM A;  1JMZ A;  1SWH A;  2A13 A;  2QO6 A;  2Y3E A;  3BS2 A;  4GGT A;  5FEN A;  2Z4I A;  1SWU A;  1BM5 A;  3BRN A;  1PTS A;  1GX8 A;  1TVQ A;  2FT9 A;  2OFB A;  1MM9 A;  2QO4 A;  2WEW A;  3KQ0 A;  4WHI A;  1ZNK A;  3WYQ A;  1OEJ A;  4ZHD A;  3CBC A;  1SXW A;  4JNJ A;  1KQX A;  2G5L A;  5BVS A;  5IRA A;  4Z27 A;  4WFV A;  1LCW A;  3TGA A;  4IRW A;  1STS B;  4JGL A;  3KFH A;  3H3I A;  3B2H A;  1VWJ B;  2FS6 A;  1KQW A;  1SWK A;  4OKA A;  2MM3 A;  1Y9L A;  1KT5 A;  2RTR B;  2RTP B;  3APV A;  4I6S A;  4ON1 A;  5H9K A;  2AH7 X;  3RDX A;  3WZO A;  3BU1 A;  4LQZ A;  1MVG A;  3ELZ A;  1DZM A;  1OSP O;  3VPJ E;  1K24 A;  3VHM A;  5HCC C;  3SLT A;  3WJB A;  1SWT A;  5LJE A;  4I3D A;  2IFB A;  2IZH B;  1JJX A;  4DQ4 A;  1T0V A;  1OEE A;  3C78 X;  1AVD A;  1D3S A;  2AT6 X;  4XMD A;  1HN2 A;  1LDO A;  1DZJ A;  2BLG A;  1U0X A;  2A5B A;  3ZW1 A;  1BSQ A;  3TF6 A;  4WFU A;  4AW8 A;  1DF3 A;  2EU7 X;  1CBI A;  3DTQ A;  2JOZ A;  1UYO X;  2F09 A;  3NBX X;  1SY0 A;  4AZR A;  3U0D A;  1RBP A;  4ORY A;  1AVG I;  5D4A A;  1Y52 X;  1IIU A;  1H91 A;  4ID2 A;  1SWO A;  1X8Q A;  3PH5 A;  4LKP A;  2FTB A;  4KC7 A;  1QFV A;  4U8U N;  2GTL O;  5HTE A;  1IFC A;  1VWG B;  2X4M A;  5AQ6 A;  3ZW1 B;  5BVT A;  3V8U A;  4U46 A;  1EII A;  1OEK A;  1SXX A;  2K62 A;  2LA7 A;  2OVE A;  2MF6 A;  4GET A;  5B11 O;  1KT4 A;  3EBW A;  1QY2 A;  1X8P A;  4IB6 A;  4ODD A;  4OMX A;  4YGZ A;  4D6A A;  5LJB A;  1WBI A;  1VWA B;  3L4R A;  1WUB A;  3PH6 A;  2VDF A;  3PDF A;  5H9L A;  3SZJ A;  3WZN A;  1JBH A;  2OVD A;  3B2K A;  2RTN B;  1L6M A;  3AUM O;  3FMZ A;  1GT5 A;  4AYH A;  1B56 A;  1MK5 A;  3WOV A;  3STM X;  4WBK A;  5L3Y A;  1EW3 A;  1RXH A;  1VWF B;  2IZG B;  5H8T A;  3GAQ A;  1A3Y A;  3ZUI A;  4ORX A;  3VE2 A;  4O3Y A;  4N7C A;  3WJG A;  4ORW A;  2GTL M;  2Q4N A;  4XMH A;  2HKD A;  3P6C A;  3ELX A;  3FLL A;  5B27 A;  1HBQ A;  1VWD B;  3U9P C;  3FW4 A;  3EC5 A;  1ZNL A;  2RTA A;  4UU3 A;  4EDE A;  3FR4 A;  4QGW A;  4YKO A;  1LCZ A;  4BQU A;  3I17 A;  5AEO A;  4NV7 A;  4HPB A;  3WJD A;  3HTY A;  4M7M A;  3ZW0 B;  3FDC A;  1KGL A;  1PBY A;  4KII A;  5IRU A;  1KL4 A;  2FLJ A;  1VWC B;  5IXG A;  2MO5 A;  1EPB A;  1LUQ A;  1OBP A;  5EDB A;  3I0A A;  3APX A;  3LTW A;  4LZU A;  1NBX A;  3OE3 A;  4BGF A;  1EPA A;  1AQB A;  1LKE A;  4A1H A;  5JD2 A;  1SLG B;  3F8A A;  2KTS A;  1AB0 A;  4EEJ A;  4ZH6 A;  5HZ9 A;  2RTK A;  1VWH B;  1DFV A;  2BC3 A;  3Q6L A;  3BX8 A;  2RQ0 A;  4YVB A;  1MOY A;  1N9M A;  4ZGF A;  3FEL A;  3HWG A;  4BX6 B;  2C4I A;  2OFM X;  1SWQ A;  4ZFX A;  1O8V A;  3NAD A;  1S7D A;  2CBS A;  1RLB E;  5H9A A;  4CDD A;  4TKB A;  5EEE A;  2OL8 O;  4Z28 A;  4DNE A;  2ALL X;  4ML7 B;  5BYP A;  1OBQ A;  2BT9 A;  3RDS A;  5HZQ A;  1DF8 A;  1SA8 A;  1SY1 A;  3CR6 A;  1X89 A;  2JGS A;  3C77 X;  1E00 A;  3EW2 A;  3F6Z B;  2FHN X;  2Y3F A;  4U8U O;  3UAQ A;  1STP A;  2W2A A;  4CPI A;  2AVI A;  1A2D A;  1HMR A;  3CQR A;  1LNM A;  2NP1 A;  5LJD A;  2RTH B;  4GUZ A;  1BRQ A;  5HZ5 A;  4BCS A;  2Q2M A;  5CSE A;  3VGW A;  3X00 A;  3TGC A;  1SWB A;  2X34 A;  1UYN X;  1B0O A;  4ES7 A;  2G78 A;  2ZAI A;  1X8O A;  1ERX A;  1DZP A;  2NNE A;  4ORU A;  1GM6 A;  2G79 A;  3JS1 A;  2XKL A;  3WVM A;  3SLO A;  2IZI A;  5JR8 A;  2X46 A;  2LFO A;  3VG2 A;  1N4J A;  5DPQ A;  2CAM A;  4ZGU A;  3WYP A;  2X8S A;  4GKC A;  4GDZ A;  4ORS A;  4U8U M;  4BX5 B;  4CPH B;  5FAZ A;  3BSZ E;  4LKT A;  4HPD A;  1SRE A;  3Q34 A;  4NYQ A;  5LJC A;  4O3X B;  3F9D A;  3HK1 A;  1CBS A;  5HA0 A;  4Z2V A;  1BJ7 A;  3P6E A;  4GGR A;  1FDQ A;  4QZT A;  1ADL A;  1JIW I;  2RTQ B;  4ZJ0 A;  2JW1 A;  1S44 A;  2G8C O;  4KC8 A;  4PJ2 A;  4YBP A;  1YP6 A;  1SLD B;  4HPA A;  1SWL A;  2OYB O;  1A57 A;  1MX8 A;  2QMI A;  4ZR2 A;  4AZO A;  1JJU A;  5B5F A;  1FEL A;  1HMT A;  3EBK A;  3RDQ A;  2VFB A;  1OPA A;  3P6D A;  3PP6 A;  5K06 A;  1LCV A;  3VHH A;  3C76 X;  4INN A;  4I3B A;  3VE1 A;  1I4U A;  1I05 A;  1ACD A;  1LID A;  2AF5 A;  4MVL A;  2IZK A;  2DJF A;  3SZI A;  1ZND A;  2A3F X;  2QM9 A;  2ZSC A;  4IBA A;  1GGL A;  4YDB A;  3FA6 A;  2FHL A;  5C0N A;  1BSY A;  1STR B;  2WEX A;  1HXL A;  1TXL A;  2L9C A;  1BSO A;  3VHI A;  4GK9 A;  3RZY A;  2LKK A;  3UEX A;  4R0B A;  4M6S A;  4XMG A;  3VG3 A;  1JZU A;  4JO6 A;  3ZWE A;  5FQ6 E;  4OS8 A;  1KL3 A;  4KH8 A;  3BLG A;  3FEP A;  5F1E A;  2QOS C;  1W5R A;  4YH0 A;  3S5X A;  3RE5 A;  5L8N A;  1VWP B;  2ACP X;  1KZW A;  1NC9 A;  1Y55 X;  3RDM A;  4QYP A;  1SLF B;  2RTL A;  3VG5 A;  4C5P A;  3RWX A;  2PY1 A;  4PSQ A;  5KID A;  5LJK A;  1YUP A;  2X8T A;  5L8O A;  4IAW A;  4YCE A;  1S2P A;  3D96 A;  4U3Q A;  5F7G A;  5IRW A;  4O4X A;  5B3M O;  2L67 A;  5K68 A;  4D6B A;  4BX7 B;  4YMY A;  3PK2 A;  4FGI B;  1VWQ B;  4YFP A;  1PM1 X;  3ZW2 A;  4YFR A;  2W2B A;  2UYW A;  3CQN A;  1FJ1 E;  4AZP A;  4YDA A;  1T68 X;  1HXZ A;  2NND A;  1FTP A;  1YWB A;  5HBS A;  3RY2 A;  1VWB B;  1KZX A;  4TNN A;  2MJI A;  2YG2 A;  1O1V A;  5FQ7 E;  2CZU A;  3NX1 A;  4FQB B;  4O4S A;  4A60 A;  1DV9 A;  4FBO A;  3KZA A;  5D47 A;  4ZH9 A;  1SRJ A;  3ZW0 A;  1E02 A;  3WXQ A;  3T1D A;  1Y0G A;  2AT5 X;  1QY0 A;  2IZJ A;  3MVF A;  1BRP A;  1YP7 A;  4BJ8 A;  1N9Y A;  2AT8 X;  1R0U A;  2AT0 X;  2QCB A;  2RTI B;  3WZP A;  2C1S A;  1GX9 A;  4IMO A;  1SWD A;  2RTE B;  4I95 A;  5L8I A;  4DCB A;  2RTC B;  1E2T A;  2OF9 A;  4MIR A;  2HMB A;  4Y0R A;  1KXO A;  2NNQ A;  1VWR B;  1VYO A;  3CMP A;  2W2F A;  1LPJ A;  1Y53 X;  1OBU A;  2X32 A;  1GX3 A;  3OJY C;  4QQ1 A;  2O62 A;  1RXJ A;  3GE2 A;  1DZK A;  1ZRY A;  2FWV A;  4GZV A;  1SWR A;  3S5V A;  4BX6 A;  3T2W A;  4MVI A;  4CDC A;  3T2X A;  3CKF A;  4I60 A;  1MEP A;  1FE3 A;  1PMP A;  1VWE B;  2OFR X;  2Y32 A;  3NQ9 A;  4KT5 A;  3ZZV A;  1I78 A;  4HFO A;  3N91 A;  2RTJ A;  3BY0 A;  2A0A A;  3SZH A;  2OL7 A;  1LIE A;  4DQ3 A;  3P6H A;  1VYF A;  4QAE A;  3KFG A;  1LEL A;  1X71 A;  1URE A;  1SWE A;  2MWH A;  4NLI A;  1I9H A;  2RCQ A;  1KFF A;  1OPB A;  1VYG A;  2ASN X;  4ZHC A;  5K67 A;  3FR2 A;  4CDE A;  1QG5 A;  1CRB A;  1QWD A;  1SWP A;  2I5Z O;  2IZD B;  3D4R A;  3PQS A;  4YFQ A;  5B2A O;  2DJG A;  1SRF A;  2KT4 B;  2Q2P A;  1NP1 A;  1SY3 A;  2Q9S A;  5HA1 A;  5LKE A;  2FRS A;  2CBR A;  3B2I A;  4EXZ A;  3AKN A;  5LJH A;  2R73 A;  4BVM A;  2IZF B;  4I3C A;  1QFT A;  1ZNE A;  1E5P A;  4O3Z A;  4EQA C;  2FS7 A;  1DC9 A;  2ACO A;  2L68 A;  3UEV A;  1RAV A;  5HZ6 A;  3B2L A;  1SWA A;  1G5W A;  1GT4 A;  2RA6 A;  1ML7 A;  4IB8 A;  5DG4 A;  4GNY A;  3AEH A;  4BX5 A;  2CM9 A;  2VFC A;  4CPH A;  4U9C A;  1Z24 A;  1KL5 A;  2R56 A;  3B2J A;  3APW A;  3HPE A;  3P24 A;  4O3W A;  4YCH A;  2WSJ A;  1EQD A;  2OF8 A;  2OZQ A;  3KFF A;  2PI3 O;  1AVE A;  1HMS A;  2HNX A;  2AMM X;  4Y0Q A;  2HYS A;  1G74 A;  1A18 A;  2QOM A;  3BU9 A;  3FID A;  3NQ3 A;  1GKA B;  2Z4H A;  1NQM A;  3LV4 A;  2OY7 A;  4AZM A;  2YMS A;  3VG4 A;  3RBY A;  1U18 A;  3IFB A;  1CBQ A;  2GC9 A;  4B55 A;  2ZAG A;  3SLJ A;  5HWZ A;  2FKG A;  4ARH A;  1JMX A;  3QQ2 A;  1LIB A;  1IFB A;  3WJE A;  5D48 A;  1T8V A;  1ALB A;  1KT6 A;  1KT3 A;  1PBO A;  2BS6 A;  2GH7 A;  3EW1 A;  3O19 A;  4YGG A;  3RY1 A;  4BOE A;  4NP1 A;  4TKH A;  1EIO A;  2I5V O;  2BS5 A;  3O2Y A;  3PEC A;  4Y0P A;  4K19 A;  2QO5 A;  2WR6 A;  3KVN A;  3NQK A;  1BBP A;  3K3L A;  3MM0 A;  4LZV A;  4QYN A;  2FR2 A;  1X8U A;  4QZU A;  1YWD A;  3QKG A;  3P6G A;  1JV4 A;  3ZUO A;  3HOL A;  2OY8 A;  4A1Y A;  4BBO A;  3KFI A;  1QAB E;  1RXK A;  4Y5D A;  3HWF A;  3NR3 A;  1SMP I;  2RTO B;  1KT7 A;  3NP1 A;  4ZHH A;  3VU1 A;  5HAE A;  2ANS A;  3PPT A;  4O4O A;  3FYF A;  5EPQ A;  1CBR A;  2CZT A;  3AKM A;  4CPF A;  4EKV A;  1JQP A;  2N93 A;  4COT A;  4L1N A;  2FKJ A;  4OMW A;  2JU8 A;  3BX7 A;  2X56 A;  2OFA A;  2F01 A;  3G7X A;  3IA8 A;  5KIC A;  1LIC A;  1GXA A;  3RE6 A;  2R74 A;  3CWK A;  1SXY A;  1SRG A;  1XCA A;  5D8J A;  1N0S A;  5IO7 A;  2X55 A;  2RD7 C;  4TLJ A;  3HOE A;  2FR3 A;  3D9W A;  4I9S A;  1SWG A;  4MEE A;  2G7B A;  4BX7 A;  1LFO A;  1W6F A;  1N43 A;  1W4T A;  2BSZ A;  3FW5 A;  4GE1 A;  4GJS A;  1VWK B;  4MVK A;  4NLJ A;  2RN4 A;  3D95 A;  5B29 A;  4CV7 A;  1B8E A;  1LIF A;  4TKJ A;  5HTD A;  1G85 A;  3RKG A;  2WQ9 A;  2RTG B;  1RSU B;  3FR5 A;  4AZQ A;  2BHV A;  1EUO A;  1IW2 A;  4GRJ A;  3U03 A;  2WPU A;  1MX7 A;  2FGS A;  2JU3 A;  3LHN A;  4OEL A;  3SOT A;  2M4L A;  1FEM A;  4MVE A;  3RDO A;  5HZ8 A;  1SRH A;  2L5P A;  3FA8 A;  1TW4 A;  5EED A;  3E3C A;  1P6P A;  4MIS A;  1D2U A;  1MDC A;  2JMB A;  5BVQ A;  5IO5 A;  1KOI A;  2E4J A;  4L3R A;  1NP4 A;  4TJZ A;  3UEW A;  3EYC A;  5FQ8 E;  1QQS A;  1SWJ A;  2F73 A;  2HLV A;  3STN A;  3VG7 A;  1LDQ A;  2AKQ A;  1TOW A;  3FA9 A;  1JYJ A;  4OS3 A;  5CHK A;  2IZB A;  3HWD A;  2IZA A;  3JSQ A;  2RTD B;  1ICM A;  5LJG A;  4CPE A;  4YGH A;  1EI5 A;  1HQQ A;  1UZ2 X;  3P6F A;  4NYR A;  2RTB B;  4NV8 A;  2OY1 O;  4UU2 A;  1SWC A;  2IZL B;  4GH7 A;  4YKM A;  4TQ2 A;  4QNI A;  3FEK A;  4NNT A;  2OVS A;  4ZCB A;  4IB9 A;  1SXU A;  3VG6 A;  2XST A;  1ZNH A;  1NDJ A;  3RSW A;  4RUU A;  4FBR A;  4IB7 A;  3ZQ3 A;  5EZ2 A;  1TOU A;  1QY1 A;  2MHD A;  1E06 A;  1I06 A;  2GTF X;  1X8N A;  3NPO A;  1EXS A;  3NX2 A;  4CDF A;  1VPR A;  3EM0 A;  3MX7 A;  5EDC A;  2CM4 A;  3PQU A;  3WBG A;  3ZI8 A;  4EFG A;  1PEE A;  3CKG A;  1VWI B;  3FEN A;  5KHP A;  1NQN A;  1SY2 A;  3MG5 A;  4QGV A;  3FA7 A;  3FIQ A;  1BEB A;  3OD9 A;  5B5G A;  1N7Y A;  2POA A;  2WWP A;  3OBL A;  2P8G A;  1VWN B;  4A8Z A;  5H9N A;  4GJV A;  1ZNG A;  4O4U A;  4CK4 A;  4RUN A;  2X8F A;  2A5C A;  4YBU A;  2GJ5 A;  2DM5 A;  5HCD C;  3PED A;  1EAL A;  5F6Z A;  3P02 A;  3S26 A;  1GT1 A;  4I9R A;  3DSZ A;  5AJC A;  4ALO A;  1VWO B;  2KTD A;  4N7D A;  1MUP A;  4O9S A;  4Y0S A;  2A2G A;  3D97 A;  4HPC A;  5D45 A;  2LBV A;  5CYB A;  5F6B A;  2IZC B;  1IKE A;  2A2U A;  2RTF B;  3O22 A;  2AL0 X;  4GD9 A;  1VWM B;  4XMF A;  3SAO A;  4QGX A;  1NGL A;  3UEU A;  4O49 A;  2WQA E;  2KD2 A;  1SRI A;  4FBV A;  4XME A;  4ORR A;  1GT3 A;  3T6F A;  4ALB A;  1SLE B;  2WUT A;  1U17 A;  1GKA A;  4OEM A;  3S60 A;  2JN3 A;  1YIV A;  2RCT A;  4QRL A;  2OVA A;  2AT3 X;  4GDA A;  5LKF A;  2HZQ A;  1LF7 A;  1YWC A;  5AJB A;  2OY5 O;  5CE4 A;  1AEL A;  2RTM A;  1SWS A;  5F2B A;  3WJC A;  4IAX A;  1IKJ A;  2X45 A;  3JQO A;  4KCA A;  4XMC A;  1SWN A;  4Z6J A;  3WZQ A;  4Z2O A;  5IO6 A;  2HZR A;  1JJJ A;  1JYD A;  2LBA A;  1O1U A;  3EMM A;  1YWA A;  5B10 O;  2Q39 A;  3TZS A;  1HY2 A;  5FFH A;  1K3B A;  1FEN A;  4IAB A;  3HWE A;  1CJ5 A;  2GTL N;  3BDR A;  3WJF A;  1ERB A;  1RST B;  4GU8 A;  1Y9T A;  4AZN A;  3TGB A;  3APU A;  2K23 A;  2LB6 A;  4IMN A;  1I04 A;  4GGZ A;  1BWY A;  1B4M A;  3RDU A;  1G7N A;  4OS0 A;  1IJ8 A;  4Y59 A;  4CSB A;  4JHQ A;  2KW1 A;  4Z2P A;  4ZHG A;  1BLR A;  2IZE B;  1HQP A;  5HCE C;  1ICN A;  5F58 A;  2A8G A;  2OL6 O;  1VWL B;  2UZ2 A; 
#chains in the Genus database with same CATH homology
 4NW4 A;  4ZHF A;  1HBP A;  1XKI A;  4GNW A;  3STK A;  2JU7 A;  3MBT A;  4NNS A;  3CBS A;  4HWM A;  2A13 A;  2QO6 A;  3BS2 A;  5FEN A;  1BM5 A;  2Z4I A;  3BRN A;  2FT9 A;  1GX8 A;  1TVQ A;  2WEW A;  4WHI A;  2QO4 A;  3KQ0 A;  1ZNK A;  1OEJ A;  4ZHD A;  3CBC A;  1SXW A;  5BVS A;  1KQX A;  4WFV A;  3TGA A;  4JGL A;  3KFH A;  3H3I A;  3B2H A;  2FS6 A;  1KQW A;  5H9K A;  2MM3 A;  1Y9L A;  1KT5 A;  3APV A;  4I6S A;  4ON1 A;  2AH7 X;  3BU1 A;  4LQZ A;  1MVG A;  3ELZ A;  1DZM A;  3VPJ E;  5HCC C;  3WJB A;  5LJE A;  4I3D A;  2IFB A;  1JJX A;  4DQ4 A;  1T0V A;  1OEE A;  3C78 X;  1D3S A;  2AT6 X;  4XMD A;  1HN2 A;  1DZJ A;  2BLG A;  1U0X A;  3ZW1 A;  1DF3 A;  1BSQ A;  3TF6 A;  4WFU A;  4AW8 A;  2EU7 X;  1CBI A;  3DTQ A;  2JOZ A;  3NBX X;  2F09 A;  3U0D A;  1SY0 A;  4AZR A;  1RBP A;  4ORY A;  1AVG I;  5D4A A;  1IIU A;  1H91 A;  4ID2 A;  1X8Q A;  3PH5 A;  4LKP A;  2FTB A;  4KC7 A;  1QFV A;  4U8U N;  2GTL O;  5HTE A;  1IFC A;  3ZW1 B;  5AQ6 A;  5BVT A;  3V8U A;  1EII A;  1OEK A;  1SXX A;  2K62 A;  2LA7 A;  2OVE A;  4GET A;  1KT4 A;  3EBW A;  1QY2 A;  1X8P A;  4IB6 A;  4ODD A;  4OMX A;  4YGZ A;  4D6A A;  5LJB A;  3L4R A;  3PH6 A;  5H9L A;  1JBH A;  2OVD A;  3B2K A;  1L6M A;  3FMZ A;  4AYH A;  1GT5 A;  1B56 A;  3WOV A;  3STM X;  4WBK A;  1EW3 A;  5H8T A;  3GAQ A;  1A3Y A;  3ZUI A;  4ORX A;  3VE2 A;  4O3Y A;  4N7C A;  3WJG A;  4ORW A;  2GTL M;  2Q4N A;  4XMH A;  3P6C A;  3ELX A;  5B27 A;  1HBQ A;  3U9P C;  3FW4 A;  1ZNL A;  4UU3 A;  4EDE A;  3FR4 A;  4QGW A;  4YKO A;  4BQU A;  3I17 A;  5AEO A;  4HPB A;  3WJD A;  3HTY A;  4M7M A;  3ZW0 B;  1KGL A;  4KII A;  2FLJ A;  2MO5 A;  1EPB A;  1OBP A;  5EDB A;  3I0A A;  3APX A;  4LZU A;  3OE3 A;  1EPA A;  1AQB A;  1LKE A;  4A1H A;  3F8A A;  2KTS A;  1AB0 A;  4EEJ A;  4ZH6 A;  5HZ9 A;  1DFV A;  3Q6L A;  3BX8 A;  2RQ0 A;  4ZGF A;  3FEL A;  3HWG A;  2OFM X;  4ZFX A;  1O8V A;  3NAD A;  1S7D A;  2CBS A;  1RLB E;  5H9A A;  4TKB A;  5EEE A;  5BYP A;  2ALL X;  4ML7 B;  1OBQ A;  2BT9 A;  5HZQ A;  1SA8 A;  1SY1 A;  3CR6 A;  1X89 A;  3C77 X;  1E00 A;  3F6Z B;  4U8U O;  3UAQ A;  2W2A A;  1HMR A;  1A2D A;  3CQR A;  1LNM A;  2NP1 A;  5LJD A;  1BRQ A;  5HZ5 A;  2Q2M A;  3TGC A;  1B0O A;  4ES7 A;  2G78 A;  2ZAI A;  1X8O A;  1ERX A;  1DZP A;  2NNE A;  4ORU A;  1GM6 A;  2G79 A;  3JS1 A;  2XKL A;  3WVM A;  5JR8 A;  2X46 A;  2LFO A;  3VG2 A;  5DPQ A;  4ZGU A;  2X8S A;  4GKC A;  4GDZ A;  4ORS A;  4U8U M;  5FAZ A;  3BSZ E;  4LKT A;  4HPD A;  4NYQ A;  5LJC A;  4O3X B;  3F9D A;  3HK1 A;  1CBS A;  5HA0 A;  1BJ7 A;  3P6E A;  1FDQ A;  4QZT A;  1ADL A;  1JIW I;  4ZJ0 A;  2JW1 A;  1S44 A;  4KC8 A;  4PJ2 A;  4YBP A;  1YP6 A;  4HPA A;  1A57 A;  1MX8 A;  2QMI A;  4ZR2 A;  4AZO A;  1FEL A;  1HMT A;  3EBK A;  3P6D A;  1OPA A;  3PP6 A;  5K06 A;  3C76 X;  4INN A;  4I3B A;  3VE1 A;  1I4U A;  1I05 A;  1ACD A;  1LID A;  4MVL A;  1ZND A;  2A3F X;  2QM9 A;  4IBA A;  1GGL A;  4YDB A;  3FA6 A;  5C0N A;  1BSY A;  2WEX A;  1TXL A;  2L9C A;  1BSO A;  4GK9 A;  3RZY A;  2LKK A;  3UEX A;  4R0B A;  4M6S A;  4XMG A;  3VG3 A;  1JZU A;  3ZWE A;  5FQ6 E;  4OS8 A;  4KH8 A;  3BLG A;  3FEP A;  5F1E A;  2QOS C;  4YH0 A;  3S5X A;  5L8N A;  2ACP X;  1KZW A;  4QYP A;  3VG5 A;  3RWX A;  2PY1 A;  4PSQ A;  5KID A;  5LJK A;  1YUP A;  2X8T A;  5L8O A;  4IAW A;  4YCE A;  1S2P A;  3D96 A;  4U3Q A;  5F7G A;  4O4X A;  2L67 A;  4D6B A;  4YMY A;  4FGI B;  4YFP A;  1PM1 X;  3ZW2 A;  4YFR A;  2W2B A;  3CQN A;  4AZP A;  4YDA A;  1T68 X;  2NND A;  1FTP A;  1YWB A;  5HBS A;  1KZX A;  4TNN A;  2MJI A;  2YG2 A;  1O1V A;  5FQ7 E;  2CZU A;  3NX1 A;  4FQB B;  4O4S A;  4A60 A;  1DV9 A;  4FBO A;  3KZA A;  5D47 A;  4ZH9 A;  3ZW0 A;  1E02 A;  3WXQ A;  3T1D A;  2AT5 X;  1QY0 A;  3MVF A;  1BRP A;  1YP7 A;  2AT8 X;  1R0U A;  2AT0 X;  4IMO A;  1GX9 A;  5L8I A;  4I95 A;  4Y0R A;  4MIR A;  2HMB A;  1KXO A;  2NNQ A;  3CMP A;  2W2F A;  1LPJ A;  1OBU A;  3OJY C;  4QQ1 A;  2O62 A;  3GE2 A;  1DZK A;  1ZRY A;  2FWV A;  4GZV A;  3S5V A;  4MVI A;  1FE3 A;  1PMP A;  3NQ9 A;  2OFR X;  4KT5 A;  3ZZV A;  4HFO A;  3N91 A;  3BY0 A;  2A0A A;  1LIE A;  4DQ3 A;  3P6H A;  1VYF A;  4QAE A;  3KFG A;  1X71 A;  1URE A;  2MWH A;  4NLI A;  2RCQ A;  1OPB A;  1VYG A;  2ASN X;  4ZHC A;  3FR2 A;  1QG5 A;  1CRB A;  1QWD A;  3PQS A;  4YFQ A;  3D4R A;  2Q2P A;  2KT4 B;  5HA1 A;  2Q9S A;  1NP1 A;  1SY3 A;  5LKE A;  2FRS A;  2CBR A;  3B2I A;  4EXZ A;  3AKN A;  5LJH A;  2R73 A;  4BVM A;  4I3C A;  1QFT A;  1ZNE A;  1E5P A;  4O3Z A;  4EQA C;  2FS7 A;  1DC9 A;  2ACO A;  2L68 A;  3UEV A;  5HZ6 A;  3B2L A;  1G5W A;  1GT4 A;  2RA6 A;  1ML7 A;  4IB8 A;  5DG4 A;  4GNY A;  2CM9 A;  4U9C A;  1Z24 A;  3B2J A;  2R56 A;  4O3W A;  3APW A;  3P24 A;  4YCH A;  2WSJ A;  1EQD A;  2OZQ A;  3KFF A;  1HMS A;  2HNX A;  2AMM X;  4Y0Q A;  2HYS A;  1G74 A;  1A18 A;  3BU9 A;  3NQ3 A;  4AZM A;  1GKA B;  2Z4H A;  3LV4 A;  2YMS A;  3VG4 A;  3RBY A;  1U18 A;  3IFB A;  1CBQ A;  2GC9 A;  2ZAG A;  5HWZ A;  4ARH A;  1LIB A;  1IFB A;  3WJE A;  5D48 A;  1T8V A;  1ALB A;  1KT6 A;  1KT3 A;  1PBO A;  2BS6 A;  3O19 A;  4YGG A;  4BOE A;  4NP1 A;  4TKH A;  1EIO A;  2BS5 A;  3O2Y A;  3PEC A;  4Y0P A;  4K19 A;  2QO5 A;  2WR6 A;  4LZV A;  3NQK A;  1BBP A;  3K3L A;  4QYN A;  4QZU A;  2FR2 A;  1X8U A;  1YWD A;  3QKG A;  3P6G A;  1JV4 A;  3ZUO A;  3HOL A;  4A1Y A;  3KFI A;  1QAB E;  3HWF A;  3NR3 A;  1SMP I;  4ZHH A;  1KT7 A;  3NP1 A;  3VU1 A;  5HAE A;  2ANS A;  3PPT A;  4O4O A;  3FYF A;  5EPQ A;  1CBR A;  2CZT A;  3AKM A;  2N93 A;  4COT A;  4L1N A;  4OMW A;  2JU8 A;  3BX7 A;  3G7X A;  5KIC A;  3IA8 A;  1LIC A;  1GXA A;  2R74 A;  3CWK A;  1SXY A;  1XCA A;  5IO7 A;  5D8J A;  1N0S A;  2RD7 C;  4TLJ A;  3HOE A;  2FR3 A;  4I9S A;  2G7B A;  1LFO A;  4NLJ A;  3FW5 A;  4GE1 A;  4MVK A;  4CV7 A;  5HTD A;  2RN4 A;  3D95 A;  5B29 A;  1B8E A;  1LIF A;  4TKJ A;  1G85 A;  3RKG A;  2WQ9 A;  3FR5 A;  4AZQ A;  2BHV A;  1EUO A;  1IW2 A;  4GRJ A;  3U03 A;  1MX7 A;  3LHN A;  2JU3 A;  3SOT A;  2M4L A;  1FEM A;  4MVE A;  5HZ8 A;  2L5P A;  3FA8 A;  1TW4 A;  5EED A;  3E3C A;  1P6P A;  4MIS A;  1D2U A;  1MDC A;  2JMB A;  5BVQ A;  5IO5 A;  1KOI A;  2E4J A;  4L3R A;  1NP4 A;  4TJZ A;  3UEW A;  3EYC A;  5FQ8 E;  1QQS A;  2F73 A;  2HLV A;  3STN A;  3VG7 A;  2AKQ A;  1TOW A;  3FA9 A;  1JYJ A;  4OS3 A;  3HWD A;  3JSQ A;  1ICM A;  5LJG A;  4YGH A;  1EI5 A;  1UZ2 X;  3P6F A;  4NYR A;  4CSB A;  4TQ2 A;  4YKM A;  4UU2 A;  4GH7 A;  4QNI A;  3FEK A;  4NNT A;  2OVS A;  4ZCB A;  4IB9 A;  1SXU A;  3VG6 A;  2XST A;  1ZNH A;  3RSW A;  4RUU A;  4FBR A;  4IB7 A;  3ZQ3 A;  5EZ2 A;  1TOU A;  1QY1 A;  2MHD A;  1E06 A;  1I06 A;  2GTF X;  1X8N A;  3NPO A;  1EXS A;  3NX2 A;  1VPR A;  3EM0 A;  3MX7 A;  5EDC A;  2CM4 A;  3PQU A;  3WBG A;  3ZI8 A;  4EFG A;  1PEE A;  3FEN A;  5KHP A;  1SY2 A;  4QGV A;  3FA7 A;  3FIQ A;  1BEB A;  3OD9 A;  2POA A;  2WWP A;  3OBL A;  2P8G A;  4A8Z A;  5H9N A;  1ZNG A;  4O4U A;  4CK4 A;  4RUN A;  2X8F A;  4YBU A;  2GJ5 A;  2DM5 A;  5HCD C;  3PED A;  1EAL A;  5F6Z A;  3P02 A;  3S26 A;  1GT1 A;  4I9R A;  3DSZ A;  5AJC A;  4ALO A;  2KTD A;  4N7D A;  1MUP A;  4O9S A;  4Y0S A;  2A2G A;  3D97 A;  4HPC A;  5D45 A;  2LBV A;  5CYB A;  5F6B A;  1IKE A;  2A2U A;  4XMF A;  3O22 A;  2AL0 X;  3SAO A;  4QGX A;  1NGL A;  3UEU A;  4O49 A;  2WQA E;  2KD2 A;  4FBV A;  4XME A;  4ORR A;  1GT3 A;  4ALB A;  2WUT A;  1U17 A;  1GKA A;  3S60 A;  2JN3 A;  1YIV A;  2RCT A;  4QRL A;  2OVA A;  2AT3 X;  5LKF A;  2HZQ A;  1LF7 A;  1YWC A;  5AJB A;  5CE4 A;  1AEL A;  3WJC A;  4IAX A;  1IKJ A;  2X45 A;  3JQO A;  4KCA A;  4XMC A;  5IO6 A;  2HZR A;  1JJJ A;  1JYD A;  2LBA A;  1O1U A;  3EMM A;  1YWA A;  2Q39 A;  3TZS A;  5FFH A;  1FEN A;  4IAB A;  3HWE A;  1CJ5 A;  2GTL N;  3BDR A;  3WJF A;  1ERB A;  4GU8 A;  1Y9T A;  4AZN A;  3TGB A;  3APU A;  2K23 A;  2LB6 A;  4IMN A;  1I04 A;  1BWY A;  1B4M A;  1G7N A;  4OS0 A;  1BLR A;  2KW1 A;  4ZHG A;  1HQP A;  5HCE C;  1ICN A;  5F58 A;  3FLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...