1DF3A

Solution structure of a recombinant mouse major urinary protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
162
structure length
162
Chain Sequence
EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a recombinant mouse major urinary protein.
pubmed doi rcsb
molecule keywords MAJOR URINARY PROTEIN
molecule tags Transport protein
source organism Mus musculus
total genus 30
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 1999-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1df3A00
2P8GA 3ELXA 1HBQA 1A2DA 1EQDA 5HZ9A 4Y0SA 1AELA 1T8VA 1HMRA 1XCAA 4ES7A 3FMZA 4GE1A 5LJGA 1UZ2X 4TJZA 1ZNHA 1CJ5A 1B56A 1QY1A 1JV4A 2JN3A 4A60A 1ERXA 5H9NA 1B0OA 1SXYA 1ERBA 1XKIA 3FW5A 4AZMA 4UU3A 3WJBA 5BVSA 1NP4A 5F7GA 2L5PA 4GKCA 4YKOA 4ORUA 2AT8X 3NPOA 1H91A 2Q9SA 3DSZA 2QM9A 1OBUA 5F6ZA 1LIBA 3D96A 4IB9A 1IIUA 5H9KA 2ACPX 1KT7A 4MVLA 1DV9A 3WJDA 4XMGA 1O1VA 1GM6A 3ZUIA 3Q6LA 4M7MA 3APVA 4ZHGA 3KFHA 1E02A 3UEVA 5KHPA 3FENA 2OVAA 3APXA 4YH0A 1ZNLA 5DPQA 3NR3A 3NX1A 3L4RA 5KICA 5HZQA 4NYRA 4WBKA 5HTEA 1GXAA 1LPJA 1AVGI 1LFOA 4YKMA 2OZQA 1FENA 1KQXA 4GETA 5HAEA 1EIOA 3C77X 2HZQA 2L68A 2R74A 3NADA 3PP6A 5BVTA 4LZUA 1G7NA 4XMCA 4ALOA 1D2UA 5EZ2A 3STNA 3ZQ3A 4ARHA 5LJEA 2A13A 1S2PA 2FR2A 2QO6A 4RUNA 2QO4A 1AB0A 5IO5A 3MBTA 1GX9A 4IMNA 1P6PA 4YFQA 4D6AA 1BSQA 1GX8A 2L9CA 3STMX 3EYCA 3TF6A 3TGBA 2OFMX 1G85A 1X8OA 2ALLX 1I06A 4D6BA 2ASNX 4EEJA 4AZOA 5HZ8A 5HCCC 3PH6A 1DF3A 4ORRA 1EW3A 5F1EA 1BLRA 3C78X 1I05A 4OMXA 1ML7A 3FA6A 1S7DA 2R73A 4KIIA 4IBAA 2CZTA 1VPRA 4NLJA 4I3CA 1KXOA 5CE4A 2CM9A 3FR4A 1KQWA 1I4UA 4R0BA 4ORSA 1KT5A 1X71A 1SA8A 3FELA 4IAXA 4EFGA 4OMWA 5EEDA 3I0AA 5HCEC 2IFBA 3EM0A 5HZ5A 3FR5A 4XMHA 1IW2A 1ZNDA 1GKAB 2AL0X 2K62A 2WQ9A 3C76X 5F58A 5HCDC 1DZPA 4YGZA 1DC9A 2OVEA 4AZNA 1NP1A 2A0AA 3DTQA 5HZ6A 4TNNA 5HBSA 1EIIA 1YP6A 1ADLA 5AQ6A 1KOIA 3EBKA 4GH7A 2FT9A 2HNXA 3FR2A 3RZYA 3ZUOA 4ZHHA 1IFCA 3HK1A 3KZAA 3P6CA 1FE3A 3RSWA 1ZRYA 4WFVA 4YDBA 4I9RA 3WJCA 4QGVA 4TQ2A 1GT4A 5L8OA 3EBWA 4QYPA 1QY0A 2L67A 1VYFA 3EMMA 1LF7A 5C0NA 1EXSA 1HN2A 3B2KA 4AZQA 1PBOA 3F9DA 3VG7A 3FA8A 3BDRA 2X45A 2E4JA 3IFBA 3BX7A 3OJYC 4IAWA 2JOZA 4NYQA 4ZH6A 5HA0A 4ZH9A 1PEEA 1KGLA 3F8AA 4MVKA 4QGXA 2KT4B 3VG3A 5KIDA 4IMOA 1X8QA 4WFUA 5B29A 3QKGA 3TGAA 1MX8A 2NP1A 1BRPA 3B2LA 5EEEA 4AW8A 4DQ4A 3U0DA 3TGCA 1BSOA 2RD7C 1GGLA 4M6SA 5H9LA 5L8IA 1N0SA 1UREA 1OEJA 5L8NA 5IO7A 1ICMA 2WUTA 4HPDA 2FR3A 4YCHA 5F6BA 3K3LA 2A3FX 2WEWA 3PECA 1S44A 3KFIA 4TLJA 1GT5A 2K23A 4QAEA 1EPBA 2HYSA 1A57A 4YMYA 1E5PA 1BJ7A 1QY2A 3KFFA 4OS3A 3HWDA 3P6HA 3CBCA 5D47A 3CMPA 2NNDA 5EDCA 1IKEA 5LJKA 4XMDA 5LKFA 1X8NA 3FLLA 3KFGA 2N93A 4ZGUA 4CK4A 1QFTA 4Y0PA 1ACDA 4ZFXA 1YWAA 1BEBA 1RLBE 4I3DA 1AQBA 3TZSA 2XKLA 3O19A 1ZNKA 3BS2A 3O22A 2OVDA 3WJEA 4PSQA 4A8ZA 1SY2A 1G5WA 5D48A 2O62A 1GT3A 4MVIA 4BVMA 1BM5A 2DM5A 2MM3A 3PEDA 1YWCA 1HMSA 3T1DA 2OFRX 4N7CA 2AT5X 3D97A 3APUA 1TVQA 2BLGA 2POAA 1QQSA 4AZRA 3NP1A 4EDEA 1T0VA 5H9AA 5EDBA 1FELA 1BSYA 3CBSA 5FFHA 4BOEA 3APWA 3VG2A 4GNWA 1ZNGA 1CBIA 4OS8A 3VG6A 3CR6A 2CZUA 4ZJ0A 2Q2MA 4AZPA 1OEEA 1PM1X 4YBPA 3BLGA 2HZRA 4QGWA 4EXZA 1X8PA 4Y0QA 3BY0A 2ANSA 1G74A 1NGLA 2GTFX 4ORXA 1LIFA 1DFVA 1QABE 2MO5A 1YIVA 1FTPA 2LFOA 4HPBA 2YG2A 1X8UA 2AH7X 3B2JA 2FS7A 2NNEA 1JYJA 1SXXA 1GT1A 3WXQA 4RUUA 1QG5A 4YGGA 3D95A 2RCQA 5FENA 4A1HA 1MUPA 2WQAE 3S26A 2ACOA 2RA6A 4IB7A 1U18A 1TOWA 4XMEA 5HTDA 1QFVA 2QO5A 3NQ3A 4QZUA 1HMTA 1KZXA 4IB6A 2W2FA 1HBPA 2JU8A 3SAOA 4ORYA 2QOSC 5EPQA 5HA1A 1D3SA 3BSZE 4LKTA 4QZTA 3NQ9A 5LJHA 2WEXA 4YBUA 1JJXA 1BBPA 1O8VA 2FRSA 1B4MA 4HPAA 4NNTA 1TOUA 5D8JA 2G7BA 1A18A 1T68X 5LJDA 4BQUA 3GAQA 2AT6X 1MX7A 1CBRA 1PMPA 4TKJA 1OBQA 5LJCA 3FA9A 4LZVA 1KT4A 5H8TA 4ZHDA 2CBRA 2EU7X 2A2GA 2X46A 4ZCBA 2CBSA 3NX2A 2Q39A 3CQNA 2FS6A 2WSJA 5FAZA 3CQRA 3KQ0A 2A2UA 1E06A 1E00A 1RBPA 3FW4A 4O9SA 3UEXA 2AMMX 4YCEA 1GKAA 1MVGA 3STKA 1EPAA 1LIEA 3JS1A 3UEUA 1CBSA 1TXLA 1CBQA 1KT3A 1SY1A 2LKKA 2MJIA 4ORWA 1CRBA 5IO6A 4I9SA 4UU2A 4IB8A 1YWBA 2RCTA 4ZHFA 2GC9A 5DG4A 3P6FA 1BWYA 1HQPA 1JZUA 2FWVA 1O1UA 1Z24A 1JJJA 1JBHA 1OPAA 2Q4NA 1FDQA 1A3YA 1X89A 2W2BA 3G7XA 4GRJA 3AKMA 4HPCA 4ZHCA 1L6MA 3VG4A 3P6EA 3BU1A 1OBPA 1QWDA 2G79A 4GNYA 2CM4A 1FEMA 2G78A 4NP1A 4AYHA 3JSQA 1OEKA 2RQ0A 3P6GA 1ALBA 2LBAA 1IKJA 3VG5A 1SY0A 3PPTA 4TKBA 1ZNEA 3WBGA 5LKEA 3B2IA 4DQ3A 3FEKA 1OPBA 5K06A 1B8EA 2JU3A 1LICA 5D4AA 1SY3A 3U9PC 2JU7A 5LJBA 1R0UA 2WWPA 4YDAA 4YFPA 1LKEA 2GJ5A 1JYDA 3U03A 2F73A 3B2HA 4ODDA 1DZJA 5BVQA 5B27A 4YFRA 4NNSA 1U0XA 3AKNA 2AT0X 3O2YA 3PH5A 1IFBA 2FLJA 2HLVA 3I17A 3WVMA 4HFOA 3P6DA 4TKHA 2PY1A 1EUOA 2LB6A 3HWFA 5D45A 1SXUA 1LIDA 1YP7A 5HWZA 4ALBA 2AKQA 1LNMA 1YUPA 1KT6A 2KTDA 3MVFA 2FTBA 1I04A 1U17A 3BX8A 3ELZA 4OS0A 4YGHA 1DZKA 4QYNA 3WJGA 3UEWA 5JR8A 1KZWA 1SXWA 4N7DA 2HMBA 1DZMA 2WR6A 4XMFA 1ICNA 3HWEA 2LBVA 4NLIA 2NNQA 3IA8A 3BU9A 1TW4A 2R56A 2W2AA 3WJFA 4Y0RA 1VYGA 1EALA 1MDCA 2XSTA 1BRQA 4K19A 3FIQA 3HWGA 2Q2PA 4I3BA 2AT3X 3BRNA 4LKPA 3FEPA 3CWKA 4A1YA 3FA7A 4ZR2A 1YWDA
chains in the Genus database with same CATH superfamily
2P8GA 3ELXA 1HBQA 1A2DA 1EQDA 5HZ9A 4Y0SA 5CYBA 1AELA 1JMZA 1T8VA 1HMRA 4GDAA 4CSBA 1VWLB 1XCAA 1SLFB 4FBVA 4ES7A 3FMZA 2RTAA 3QQ2A 4GE1A 1UZ2X 5LJGA 2GTLM 4TJZA 1ZNHA 1CJ5A 1B56A 1QY1A 3VHMA 1JV4A 2JN3A 4A60A 1ERXA 3F6ZB 5AEOA 5H9NA 1B0OA 1SXYA 1ERBA 4BGFA 1XKIA 3FW5A 4AZMA 4UU3A 3WJBA 1SWDA 5BVSA 1NP4A 5F7GA 2L5PA 4GKCA 3ZW1A 4YKOA 4ORUA 2AT8X 3NPOA 4BCSA 3ZW2A 1H91A 1Y53X 2Q9SA 2QM9A 3DSZA 4IRWA 1OBUA 1AVDA 5CSEA 1LIBA 5F6ZA 3D96A 1KL3A 4IB9A 1IIUA 1JIWI 3HOLA 4QGVA 5H9KA 2ACPX 1KT7A 4MVLA 1DV9A 3WJDA 4XMGA 1O1VA 1SMPI 2FKGA 3D9WA 1VWCB 3T6LA 3MG5A 1GM6A 3ZUIA 2RTIB 4QQ1A 3Q6LA 3RY2A 2Z4HA 4M7MA 3APVA 2BS5A 4FBRA 4ZHGA 4U8UM 4WHIA 1K24A 3KFHA 1E02A 3UEVA 4CDCA 5KHPA 3FENA 2FHLA 2OVAA 3APXA 4OEMA 2IZEB 1ZNLA 4YH0A 5F2BA 5DPQA 5JD2A 4CPHA 1SWNA 2KW1A 3NR3A 3VPJE 3NX1A 1SWJA 4ZGFA 4YVBA 3L4RA 4O4OA 5KICA 4O49A 4GK9A 5HZQA 4NYRA 1VWRB 2X8SA 4WBKA 5HTEA 1GXAA 1LPJA 1AVGI 1SLDB 1LFOA 4YKMA 2OZQA 2OY5O 1LCZA 1FENA 4LQZA 1SWKA 3V8UA 5IXGA 2OL6O 1KQXA 4GETA 5HAEA 1EIOA 3C77X 1Y55X 2ZSCA 2HZQA 2L68A 2R74A 3NADA 3PP6A 2MHDA 2RTRB 3UAQA 3EW1A 2RTGB 4L3RA 4O4SA 5BVTA 4LZUA 1G7NA 4XMCA 4ALOA 1D2UA 5EZ2A 3STNA 3VU1A 3ZQ3A 1JMXA 1SLEB 1VWPB 2A13A 1S2PA 2FR2A 2QO6A 2RTQB 4GJVA 5FQ7E 3WZQA 2OL7A 4RUNA 4COTA 5IRWA 2QO4A 1AB0A 5IO5A 3MBTA 1GX9A 2GH7A 3OBLA 4IMNA 1P6PA 4KH8A 4YFQA 1BSQA 1GX8A 2L9CA 4D6AA 4CPEA 3STMX 3EYCA 4ID2A 3TF6A 2BHVA 3TGBA 2OFMX 1G85A 1X8OA 2ALLX 4EKVA 4BX7B 1I06A 4D6BA 4DNEA 2ASNX 4EEJA 4AZOA 5HZ8A 5HCCC 3PH6A 1DF3A 2OVSA 4ORRA 1EW3A 3VE1A 5F1EA 1BLRA 3C78X 1I05A 3RE5A 4O4XA 4OMXA 1ML7A 2Y3FA 3FA6A 3T2WA 4ARHA 4FBOA 1S7DA 1I78A 4OELA 1VWDB 2R73A 2X8FA 3PQSA 2GTLO 4KIIA 4Z2VA 4IBAA 1VWJB 3AUMO 2CZTA 1KL4A 1VPRA 2OY8A 3EW2A 4NLJA 4I3CA 5B11O 3RDMA 1UYNX 1KXOA 5CE4A 2CM9A 5AJCA 3FR4A 1KQWA 1I4UA 2IZHB 1RXJA 4R0BA 1SREA 3RKGA 1W6FA 4ORSA 1KT5A 2VFCA 4CPFA 1X71A 1SA8A 3FELA 4JO6A 1SWUA 1HY2A 4ML7B 1Y9TA 1NBXA 3E3CA 2Y3EA 3RWXA 3RY1A 4IAXA 3OD9A 4NV8A 4EFGA 4OMWA 5EEDA 3I0AA 5HCEC 3WOVA 3VE2A 2IFBA 3EM0A 4IABA 4MEEA 2QMIA 5HZ5A 4L1NA 4DCBA 1STPA 3FR5A 4XMHA 1IW2A 1ZNDA 1GKAB 2AL0X 2DJGA 2K62A 2WQ9A 3C76X 3MX7A 2RTPB 5F58A 1VYOA 5HCDC 1DZPA 4KC7A 1DC9A 4YGZA 2OVEA 1VWEB 3ZZVA 1NP1A 2A0AA 3DTQA 4AZNA 5HZ6A 4TNNA 5HBSA 1EIIA 4NV7A 1YP6A 1ADLA 5AQ6A 1Y9LA 2AVIA 2QOMA 1KOIA 4EQAC 1HQQA 3EBKA 1VWAB 4GH7A 2FT9A 2HNXA 3FR2A 3RZYA 3ZUOA 1N4JA 1IFCA 3HK1A 1GX3A 3KZAA 1DF8A 3P6CA 4QNIA 4JNJA 4CDEA 1FE3A 3RSWA 1ZRYA 4WFVA 4YDBA 4I9RA 5B2AO 3NQKA 3WJCA 1N9YA 1GT4A 2BC3A 4BX7A 4I60A 5L8OA 3EBWA 4QYPA 2A5BA 1SWTA 3MM0A 1QY0A 2L67A 1N9MA 1VYFA 3EC5A 5IRAA 3PDFA 3EMMA 2C1QA 1JQPA 1LF7A 4CPIA 5C0NA 3RDSA 4JHQA 1EXSA 1HN2A 5LJEA 3B2KA 4AZQA 4CDDA 1PBOA 1JJUA 2ZAIA 3F9DA 3VG7A 3FA8A 4GU8A 3BDRA 2X45A 2E4JA 1W5RA 4FQBB 3IFBA 3BX7A 3OJYC 1LCWA 2BS6A 4IAWA 2JOZA 4NYQA 1VWGB 2Z4IA 4KCAA 4ZH6A 5HA0A 4ZH9A 1PEEA 1KGLA 2VDFA 3F8AA 1VWHB 3ZWEA 1E2TA 1SRIA 4MVKA 4QGXA 2KT4B 5FQ6E 3VG3A 5KIDA 1EI5A 4IMOA 3VHHA 1X8QA 4WFUA 5B29A 3QKGA 3TGAA 1MX8A 2YMSA 2NP1A 3AEHA 1BRPA 3B2LA 5EEEA 3SZIA 4AW8A 2IZGB 4DQ4A 3U0DA 3TGCA 1BSOA 2RD7C 4O3WA 1GGLA 4M6SA 5H9LA 5L8IA 1N0SA 1SWQA 1UREA 4ON1A 1OEJA 5L8NA 5IO7A 1ICMA 2WUTA 4HPDA 2FR3A 4YCHA 3WYPA 4BX5B 2IZAA 5F6BA 3K3LA 2A3FX 2WEWA 2QCBA 3PECA 1S44A 3KFIA 3RDOA 4GZVA 4TLJA 3ZW0A 1GT5A 2K23A 4I6SA 5B10O 4QAEA 1EPBA 2OFBA 2HYSA 2MWHA 1A57A 2IZFB 1VWKB 1E5PA 1BJ7A 1QY2A 4YMYA 2G5LA 1VWOB 3KFFA 1OSPO 4OS3A 3HWDA 3P6HA 3CBCA 5D47A 4JGLA 3CMPA 2NNDA 5EDCA 2F09A 1IKEA 5LJKA 4XMDA 1W4TA 5LKFA 1VWQB 1X8NA 3FLLA 3KFGA 2N93A 4ZGUA 1SWEA 4CK4A 3RBYA 1RAVA 5B5GA 1QFTA 4Y0PA 1ACDA 4ZFXA 1YWAA 1KFFA 4GGTA 1BEBA 1STSB 1RLBE 1RSUB 3RE6A 2LA7A 1AQBA 4I3DA 4HWMA 3TZSA 2XKLA 3FYFA 3O19A 1ZNKA 3BS2A 1SRHA 1RSTB 2OVDA 3O22A 3WJEA 4PSQA 4A8ZA 1SY2A 1G5WA 2RTDB 5D48A 2O62A 1GT3A 3HOEA 4MVIA 4NW4A 4BVMA 1BM5A 2DM5A 1I9HA 2MM3A 3PEDA 1YWCA 4BX6B 2IZBA 1HMSA 3T1DA 2OFRX 4N7CA 2AT5X 3D97A 1LDQA 3APUA 4O3YA 2FKJA 3VGWA 1TVQA 2BLGA 2POAA 3LV4A 1QQSA 3OE3A 1PBYA 3NP1A 4AZRA 2IZDB 4EDEA 4I95A 1T0VA 5H9AA 3WYQA 5EDBA 1FELA 2RTEB 3SLTA 1BSYA 1RXKA 3CBSA 5FFHA 4BOEA 3APWA 3VG2A 2RTCB 2BSZA 1FJ1E 4GNWA 1ZNGA 4BX5A 1CBIA 4MISA 2VFBA 4OS8A 2PI3O 3VG6A 1Y52X 3CR6A 4Z2OA 4PJ2A 2OYBO 1MM9A 2CZUA 4ZJ0A 2Q2MA 4AZPA 2C1SA 1OEEA 1PM1X 2RN4A 4YBPA 3BLGA 2HZRA 4GD9A 4QGWA 3SOTA 4EXZA 1X8PA 2BT9A 4Y0QA 1VWMB 3S5XA 2M4LA 3BY0A 2ANSA 1G74A 1SRFA 2X32A 1NGLA 2GTFX 2IZIA 4ORXA 1LIFA 1DFVA 1QABE 2A5CA 2MO5A 1YIVA 4FGIB 1FTPA 2LFOA 4HPBA 4O3XB 3SLJA 4INNA 3X00A 2YG2A 1X8UA 2AH7X 3B2JA 1SRJA 2FS7A 2NNEA 1JYJA 1SXXA 1GT1A 2OF8A 3WXQA 4RUUA 1QG5A 4YGGA 3D95A 1SWFA 2RCQA 5FENA 4A1HA 1MUPA 2WQAE 3S26A 4BBOA 2ACOA 2RA6A 4IB7A 4Z28A 1SWRA 1TOWA 1U18A 4XMEA 5HTDA 4QRLA 1QFVA 3PK2A 2QO5A 1MOYA 1IJ8A 3NQ3A 4GUZA 4QZUA 1HMTA 5CHKA 2KTSA 4IB6A 3SZJA 3Q34A 2W2FA 4B55A 1KZXA 1HBPA 2JU8A 3SAOA 2X8TA 4ORYA 2RTHB 1SLGB 2QOSC 2A8GA 5AJBA 5EPQA 1SWBA 4U3QA 5HA1A 1Y0GA 1D3SA 3BSZE 3D4RA 4LKTA 4QZTA 3NQ9A 5LJHA 2WEXA 3WZOA 1RXHA 2F01A 2JW1A 4YBUA 1JJXA 1BBPA 3CKFA 1O8VA 2FRSA 4CPHB 2JMBA 4GDZA 1LELA 2IZJA 2RTMA 2AF5A 1B4MA 4HPAA 4NNTA 1TOUA 1LUQA 2X4MA 2G7BA 5D8JA 1A18A 1T68X 5LJDA 4BQUA 3GAQA 3CKGA 1NQMA 2AT6X 4Z27A 1MX7A 1CBRA 1AVEA 1PMPA 2RTOB 1OBQA 4TKJA 3T2XA 5LJCA 3FA9A 1MK5A 1KT4A 4LZVA 5H8TA 3VHIA 4ZHDA 2DJFA 2CBRA 2EU7X 2A2GA 4Y59A 2X46A 4ZCBA 3LHNA 2CBSA 2IZKA 3NX2A 1SRGA 2Q39A 3CQNA 2FS6A 2WSJA 4GJSA 3CQRA 3KQ0A 5FAZA 2A2UA 3WZNA 1NQNA 1E06A 3RDXA 1E00A 1K3BA 1PTSA 1RBPA 3FW4A 2RTKA 4O9SA 3UEXA 2AMMX 4YCEA 1GKAA 1MVGA 3STKA 1EPAA 1LIEA 3JS1A 3UEUA 5K67A 1CBSA 1TXLA 2GTLN 4U46A 1CBQA 1KT3A 1SWAA 1SY1A 2MF6A 2LKKA 2MJIA 2RTFB 4ORWA 1CRBA 1SWSA 5IO6A 4I9SA 4UU2A 1WBIA 1VWIB 3P02A 1KL5A 4IB8A 1YWBA 2RCTA 4ZHFA 2GC9A 5DG4A 3P6FA 3HPEA 1BWYA 1HQPA 2HKDA 2I5ZO 3P24A 4O4UA 3SZHA 4TQ2A 2FWVA 2FHNX 4OKAA 1JZUA 1O1UA 1Z24A 2FGSA 3PQUA 1JJJA 1JBHA 1OPAA 2Q4NA 1VWBB 1FDQA 1A3YA 1X89A 2OY7A 2W2BA 1HXLA 2OY1O 2UYWA 3G7XA 4GRJA 4ZHHA 3AKMA 3LTWA 4HPCA 4ZHCA 1L6MA 1SWLA 3VG4A 3P6EA 3BU1A 1OBPA 1QWDA 2G79A 4GNYA 2CM4A 1FEMA 2G78A 2WPUA 4NP1A 4U8UN 5IRUA 3NBXX 4AYHA 3JSQA 1OEKA 2RQ0A 3P6GA 1ALBA 2LBAA 2G8CO 1IKJA 1SWPA 3VG5A 1LCVA 3KVNA 1SY0A 1LDOA 3PPTA 4MVEA 1ZNEA 3H3IA 3WBGA 4TKBA 5LKEA 3B2IA 5B3MO 1UYOX 4DQ3A 1STRB 3FEKA 1OPBA 5K06A 2Y32A 1B8EA 2JU3A 1LICA 5D4AA 1SY3A 2OFAA 3U9PC 2JU7A 5LJBA 5K68A 2KD2A 4KT5A 4CDFA 1R0UA 2WWPA 4MIRA 4YDAA 1VWNB 4YFPA 1LKEA 2GJ5A 1WUBA 1JYDA 3JQOA 3U03A 2F73A 4GGZA 3B2HA 2RTLA 4ODDA 1DZJA 4O3ZA 5BVQA 3S5VA 5B27A 5L3YA 1SWHA 3S60A 3ZI8A 4YFRA 2JGSA 4NNSA 1U0XA 3AKNA 3T6FA 2AT0X 3O2YA 4GGRA 3PH5A 2IZLB 2OL8O 1IFBA 2FLJA 2HLVA 3HTYA 2UZ2A 3RDUA 2I5VO 4Z6JA 5BYPA 1NC9A 3I17A 3WVMA 4HFOA 3P6DA 4TKHA 4Y5DA 2PY1A 1EUOA 2LB6A 3FIDA 3HWFA 5D45A 1SXUA 1LIDA 1YP7A 5HWZA 4ALBA 2AKQA 2X34A 5B5FA 1LNMA 1YUPA 2RTNB 1KT6A 3ZW0B 5FQ8E 2KTDA 4Z2PA 3MVFA 1N7YA 4KC8A 3WZPA 2C4IA 2FTBA 1I04A 1U17A 2ZAGA 3BX8A 3ELZA 3ZW1B 4OS0A 4YGHA 1DZKA 4BJ8A 1MEPA 4QYNA 3WJGA 3SLOA 1SWGA 2X55A 3UEWA 5JR8A 1KZWA 1SXWA 1SWCA 4N7DA 2HMBA 1DZMA 2WR6A 4XMFA 1ICNA 4BX6A 3HWEA 2LBVA 4NLIA 2NNQA 3FDCA 3IA8A 3BU9A 1TW4A 2R56A 1VWFB 2RTJA 2W2AA 1N43A 3RDQA 3WJFA 1SWOA 2X56A 4Y0RA 1VYGA 1HXZA 2CAMA 1EALA 1MDCA 2XSTA 1BRQA 4K19A 4U9CA 4U8UO 2IZCB 3FIQA 4C5PA 3HWGA 1NDJA 2OF9A 2Q2PA 4I3BA 4CV7A 2AT3X 3GE2A 3BRNA 4LKPA 3FEPA 3CWKA 4A1YA 3FA7A 4ZR2A 2RTBB 1YWDA 3N91A
chains in the Genus database with same CATH topology
2P8GA 3ELXA 1HBQA 1A2DA 1EQDA 5HZ9A 4Y0SA 5CYBA 1AELA 1T8VA 1HMRA 4CSBA 1XCAA 4FBVA 4ES7A 3FMZA 4GE1A 5LJGA 1UZ2X 2GTLM 4TJZA 1ZNHA 1CJ5A 1B56A 1QY1A 1JV4A 2JN3A 4A60A 1ERXA 3F6ZB 5AEOA 5H9NA 1B0OA 1SXYA 1ERBA 1XKIA 3FW5A 4AZMA 4UU3A 3WJBA 5BVSA 1NP4A 5F7GA 2L5PA 4GKCA 3ZW1A 4YKOA 4ORUA 2AT8X 3NPOA 3ZW2A 1H91A 2Q9SA 3DSZA 2QM9A 1OBUA 5F6ZA 1LIBA 3D96A 4IB9A 1IIUA 1JIWI 3HOLA 5H9KA 2ACPX 1KT7A 4MVLA 1DV9A 3WJDA 4XMGA 1O1VA 1SMPI 1GM6A 3ZUIA 4QQ1A 3Q6LA 2Z4HA 4M7MA 3APVA 2BS5A 4ZHGA 4U8UM 4WHIA 3KFHA 1E02A 3UEVA 5KHPA 3FENA 2OVAA 3APXA 4YH0A 1ZNLA 5DPQA 2KW1A 3NR3A 3VPJE 3NX1A 4ZGFA 3L4RA 4O4OA 5KICA 4O49A 4GK9A 5HZQA 4NYRA 2X8SA 4WBKA 5HTEA 1GXAA 1LPJA 1AVGI 1LFOA 4YKMA 2OZQA 1FENA 4LQZA 3V8UA 1KQXA 4GETA 5HAEA 1EIOA 3C77X 2HZQA 2L68A 2R74A 3NADA 3PP6A 2MHDA 5BVTA 3UAQA 4O4SA 4L3RA 4LZUA 1G7NA 4XMCA 4ALOA 1D2UA 5EZ2A 3STNA 3VU1A 3ZQ3A 5FQ7E 4ARHA 5LJEA 2A13A 1S2PA 2FR2A 2QO6A 4COTA 4RUNA 2QO4A 1AB0A 5IO5A 3MBTA 1GX9A 3OBLA 4IMNA 1P6PA 4KH8A 4YFQA 1BSQA 1GX8A 2L9CA 4D6AA 3STMX 3EYCA 4ID2A 3TF6A 2BHVA 3TGBA 2OFMX 1G85A 1X8OA 2ALLX 1I06A 4D6BA 2ASNX 4EEJA 4AZOA 5HZ8A 5HCCC 3PH6A 1DF3A 2OVSA 4ORRA 1EW3A 3VE1A 5F1EA 1BLRA 3C78X 1I05A 4O4XA 4OMXA 1ML7A 3FA6A 4FBOA 1S7DA 2R73A 2X8FA 3PQSA 2GTLO 4KIIA 4IBAA 2CZTA 1VPRA 4NLJA 4I3CA 1KXOA 5CE4A 2CM9A 5AJCA 3FR4A 1KQWA 1I4UA 4R0BA 3RKGA 4ORSA 1KT5A 1X71A 1SA8A 3FELA 4ML7B 1Y9TA 3E3CA 3RWXA 4IAXA 3OD9A 4EFGA 4OMWA 5EEDA 3I0AA 5HCEC 3WOVA 3VE2A 2IFBA 3EM0A 4IABA 5HZ5A 2QMIA 4L1NA 3FR5A 4XMHA 1IW2A 1ZNDA 1GKAB 2AL0X 2K62A 2WQ9A 3C76X 3MX7A 5F58A 5HCDC 1DZPA 4KC7A 1DC9A 4YGZA 2OVEA 3ZZVA 4AZNA 1NP1A 2A0AA 3DTQA 5HZ6A 4TNNA 5HBSA 1EIIA 1YP6A 1ADLA 5AQ6A 1Y9LA 1KOIA 4EQAC 3EBKA 4GH7A 2FT9A 2HNXA 3FR2A 3RZYA 3ZUOA 4QNIA 1IFCA 3HK1A 3KZAA 3P6CA 3ZW0B 4ZHHA 1FE3A 3RSWA 1ZRYA 4WFVA 4YDBA 4I9RA 3WJCA 3NQKA 4QGVA 4TQ2A 1GT4A 5L8OA 3EBWA 4QYPA 1QY0A 2L67A 1VYFA 3EMMA 1LF7A 5C0NA 1EXSA 1HN2A 3B2KA 4AZQA 1PBOA 2ZAIA 3F9DA 3VG7A 3FA8A 4GU8A 3BDRA 2X45A 2E4JA 4FQBB 3IFBA 3BX7A 3OJYC 4IAWA 2BS6A 2JOZA 4NYQA 2Z4IA 4KCAA 4ZH6A 5HA0A 4ZH9A 1PEEA 1KGLA 3F8AA 3ZWEA 4MVKA 4QGXA 2KT4B 5FQ6E 3VG3A 5KIDA 1EI5A 4IMOA 1X8QA 4WFUA 5B29A 3QKGA 3TGAA 1MX8A 2YMSA 2NP1A 1BRPA 3B2LA 5EEEA 4AW8A 4DQ4A 3U0DA 3TGCA 1BSOA 2RD7C 4O3WA 1GGLA 4M6SA 5H9LA 5L8IA 1N0SA 1UREA 4ON1A 1OEJA 5L8NA 5IO7A 1ICMA 2WUTA 4HPDA 2FR3A 4YCHA 5F6BA 3K3LA 2A3FX 2WEWA 3PECA 1S44A 3KFIA 4GZVA 4TLJA 3ZW0A 1GT5A 2K23A 4I6SA 4QAEA 1EPBA 2HYSA 2MWHA 1A57A 4YMYA 1E5PA 1BJ7A 1QY2A 3KFFA 4OS3A 3HWDA 3P6HA 3CBCA 5D47A 4JGLA 3CMPA 2NNDA 5EDCA 2F09A 1IKEA 5LJKA 4XMDA 5LKFA 1X8NA 3FLLA 3KFGA 2N93A 4ZGUA 4CK4A 3RBYA 1QFTA 4Y0PA 1ACDA 4ZFXA 1YWAA 1BEBA 1RLBE 2LA7A 1AQBA 4I3DA 4HWMA 3TZSA 2XKLA 3FYFA 3O19A 1ZNKA 3BS2A 3O22A 2OVDA 3WJEA 4PSQA 4A8ZA 1SY2A 1G5WA 5D48A 2O62A 1GT3A 3HOEA 4MVIA 4NW4A 4BVMA 1BM5A 2DM5A 2MM3A 3PEDA 1YWCA 1HMSA 3T1DA 2OFRX 4N7CA 2AT5X 3D97A 4O3YA 3APUA 1TVQA 2BLGA 2POAA 3LV4A 1QQSA 3OE3A 4AZRA 3NP1A 4EDEA 4I95A 1T0VA 5H9AA 5EDBA 1FELA 1BSYA 3CBSA 5FFHA 4BOEA 3APWA 3VG2A 4GNWA 1ZNGA 1CBIA 4MISA 4OS8A 3VG6A 3CR6A 4PJ2A 2CZUA 4ZJ0A 2Q2MA 4AZPA 1OEEA 1PM1X 2RN4A 4YBPA 3BLGA 2HZRA 4QGWA 4EXZA 3SOTA 1X8PA 2BT9A 4Y0QA 3S5XA 2M4LA 3BY0A 2ANSA 1G74A 1NGLA 2GTFX 4ORXA 1LIFA 1DFVA 1QABE 2MO5A 1YIVA 4FGIB 1FTPA 2LFOA 4HPBA 4O3XB 4INNA 2YG2A 1X8UA 2AH7X 3B2JA 2FS7A 2NNEA 1JYJA 1SXXA 1GT1A 3WXQA 4RUUA 1QG5A 4YGGA 3D95A 2RCQA 5FENA 4A1HA 1MUPA 2WQAE 3S26A 2ACOA 2RA6A 4IB7A 1U18A 1TOWA 4XMEA 5HTDA 4QRLA 1QFVA 4FBRA 2QO5A 3NQ3A 4QZUA 1HMTA 1KZXA 2KTSA 4IB6A 2W2FA 1HBPA 2JU8A 3SAOA 2X8TA 4ORYA 2QOSC 5AJBA 5EPQA 4U3QA 5HA1A 3D4RA 1D3SA 3BSZE 4LKTA 4QZTA 3NQ9A 5LJHA 2WEXA 2JW1A 4YBUA 1JJXA 1BBPA 1O8VA 2FRSA 2JMBA 4GDZA 1B4MA 4HPAA 4NNTA 1TOUA 5D8JA 2G7BA 1A18A 1T68X 5LJDA 4BQUA 3GAQA 2AT6X 1MX7A 1CBRA 1PMPA 4TKJA 1OBQA 5LJCA 3FA9A 4LZVA 1KT4A 5H8TA 4ZHDA 2CBRA 2EU7X 2A2GA 2X46A 4ZCBA 3LHNA 2CBSA 3NX2A 2Q39A 3CQNA 2FS6A 2WSJA 5FAZA 3CQRA 3KQ0A 2A2UA 5BYPA 1E06A 1E00A 1RBPA 3FW4A 4O9SA 3UEXA 2AMMX 4YCEA 1GKAA 1MVGA 3STKA 1EPAA 1LIEA 3JS1A 3UEUA 1CBSA 1TXLA 2GTLN 1CBQA 1KT3A 1SY1A 2LKKA 2MJIA 4ORWA 1CRBA 5IO6A 4I9SA 4UU2A 3P02A 4IB8A 1YWBA 2RCTA 4ZHFA 2GC9A 5DG4A 3P6FA 1BWYA 1HQPA 4O4UA 3P24A 1JZUA 2FWVA 1O1UA 1Z24A 3PQUA 1JJJA 1JBHA 1OPAA 2Q4NA 1FDQA 1A3YA 1X89A 2W2BA 3G7XA 4GRJA 3AKMA 4HPCA 4ZHCA 1L6MA 3VG4A 3P6EA 3BU1A 1OBPA 1QWDA 2G79A 4GNYA 2CM4A 1FEMA 2G78A 4NP1A 4U8UN 3NBXX 4AYHA 3JSQA 1OEKA 2RQ0A 3P6GA 1ALBA 2LBAA 1IKJA 3VG5A 1SY0A 3PPTA 4MVEA 1ZNEA 3H3IA 3WBGA 4TKBA 5LKEA 3B2IA 4DQ3A 3FEKA 1OPBA 5K06A 1B8EA 2JU3A 1LICA 5D4AA 1SY3A 3U9PC 2JU7A 5LJBA 2KD2A 4KT5A 1R0UA 2WWPA 4MIRA 4YDAA 4YFPA 1LKEA 2GJ5A 1JYDA 3JQOA 3U03A 2F73A 3B2HA 4ODDA 1DZJA 4O3ZA 5BVQA 3S5VA 5B27A 3S60A 3ZI8A 4YFRA 4NNSA 1U0XA 3AKNA 2AT0X 3O2YA 3PH5A 1IFBA 2FLJA 2HLVA 3HTYA 3I17A 3WVMA 4HFOA 3P6DA 4TKHA 2PY1A 1EUOA 2LB6A 3HWFA 5D45A 1SXUA 1LIDA 1YP7A 5HWZA 4ALBA 2AKQA 1LNMA 1YUPA 1KT6A 5FQ8E 2KTDA 3MVFA 4KC8A 2FTBA 1I04A 1U17A 2ZAGA 3BX8A 3ELZA 3ZW1B 4OS0A 4YGHA 1DZKA 4QYNA 3WJGA 3UEWA 5JR8A 1KZWA 1SXWA 4N7DA 2HMBA 1DZMA 2WR6A 4XMFA 1ICNA 3HWEA 2LBVA 4NLIA 2NNQA 3IA8A 3BU9A 1TW4A 2R56A 2W2AA 3WJFA 4Y0RA 1VYGA 1EALA 1MDCA 2XSTA 1BRQA 4K19A 4U9CA 4U8UO 3FIQA 3HWGA 2Q2PA 4I3BA 4CV7A 2AT3X 3GE2A 3BRNA 4LKPA 3FEPA 3CWKA 4A1YA 3FA7A 4ZR2A 1YWDA 3N91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P8G A;  3ELX A;  1HBQ A;  1A2D A;  1EQD A;  5HZ9 A;  4Y0S A;  1AEL A;  1T8V A;  1HMR A;  1XCA A;  4ES7 A;  3FMZ A;  4GE1 A;  5LJG A;  1UZ2 X;  4TJZ A;  1ZNH A;  1CJ5 A;  1B56 A;  1QY1 A;  1JV4 A;  2JN3 A;  4A60 A;  1ERX A;  5H9N A;  1B0O A;  1SXY A;  1ERB A;  1XKI A;  3FW5 A;  4AZM A;  4UU3 A;  3WJB A;  5BVS A;  1NP4 A;  5F7G A;  2L5P A;  4GKC A;  4YKO A;  4ORU A;  2AT8 X;  3NPO A;  1H91 A;  2Q9S A;  3DSZ A;  2QM9 A;  1OBU A;  5F6Z A;  1LIB A;  3D96 A;  4IB9 A;  1IIU A;  5H9K A;  2ACP X;  1KT7 A;  4MVL A;  1DV9 A;  3WJD A;  4XMG A;  1O1V A;  1GM6 A;  3ZUI A;  3Q6L A;  4M7M A;  3APV A;  4ZHG A;  3KFH A;  1E02 A;  3UEV A;  5KHP A;  3FEN A;  2OVA A;  3APX A;  4YH0 A;  1ZNL A;  5DPQ A;  3NR3 A;  3NX1 A;  3L4R A;  5KIC A;  5HZQ A;  4NYR A;  4WBK A;  5HTE A;  1GXA A;  1LPJ A;  1AVG I;  1LFO A;  4YKM A;  2OZQ A;  1FEN A;  1KQX A;  4GET A;  5HAE A;  1EIO A;  3C77 X;  2HZQ A;  2L68 A;  2R74 A;  3NAD A;  3PP6 A;  5BVT A;  4LZU A;  1G7N A;  4XMC A;  4ALO A;  1D2U A;  5EZ2 A;  3STN A;  3ZQ3 A;  4ARH A;  5LJE A;  2A13 A;  1S2P A;  2FR2 A;  2QO6 A;  4RUN A;  2QO4 A;  1AB0 A;  5IO5 A;  3MBT A;  1GX9 A;  4IMN A;  1P6P A;  4YFQ A;  4D6A A;  1BSQ A;  1GX8 A;  2L9C A;  3STM X;  3EYC A;  3TF6 A;  3TGB A;  2OFM X;  1G85 A;  1X8O A;  2ALL X;  1I06 A;  4D6B A;  2ASN X;  4EEJ A;  4AZO A;  5HZ8 A;  5HCC C;  3PH6 A;  1DF3 A;  4ORR A;  1EW3 A;  5F1E A;  1BLR A;  3C78 X;  1I05 A;  4OMX A;  1ML7 A;  3FA6 A;  1S7D A;  2R73 A;  4KII A;  4IBA A;  2CZT A;  1VPR A;  4NLJ A;  4I3C A;  1KXO A;  5CE4 A;  2CM9 A;  3FR4 A;  1KQW A;  1I4U A;  4R0B A;  4ORS A;  1KT5 A;  1X71 A;  1SA8 A;  3FEL A;  4IAX A;  4EFG A;  4OMW A;  5EED A;  3I0A A;  5HCE C;  2IFB A;  3EM0 A;  5HZ5 A;  3FR5 A;  4XMH A;  1IW2 A;  1ZND A;  1GKA B;  2AL0 X;  2K62 A;  2WQ9 A;  3C76 X;  5F58 A;  5HCD C;  1DZP A;  4YGZ A;  1DC9 A;  2OVE A;  4AZN A;  1NP1 A;  2A0A A;  3DTQ A;  5HZ6 A;  4TNN A;  5HBS A;  1EII A;  1YP6 A;  1ADL A;  5AQ6 A;  1KOI A;  3EBK A;  4GH7 A;  2FT9 A;  2HNX A;  3FR2 A;  3RZY A;  3ZUO A;  4ZHH A;  1IFC A;  3HK1 A;  3KZA A;  3P6C A;  1FE3 A;  3RSW A;  1ZRY A;  4WFV A;  4YDB A;  4I9R A;  3WJC A;  4QGV A;  4TQ2 A;  1GT4 A;  5L8O A;  3EBW A;  4QYP A;  1QY0 A;  2L67 A;  1VYF A;  3EMM A;  1LF7 A;  5C0N A;  1EXS A;  1HN2 A;  3B2K A;  4AZQ A;  1PBO A;  3F9D A;  3VG7 A;  3FA8 A;  3BDR A;  2X45 A;  2E4J A;  3IFB A;  3BX7 A;  3OJY C;  4IAW A;  2JOZ A;  4NYQ A;  4ZH6 A;  5HA0 A;  4ZH9 A;  1PEE A;  1KGL A;  3F8A A;  4MVK A;  4QGX A;  2KT4 B;  3VG3 A;  5KID A;  4IMO A;  1X8Q A;  4WFU A;  5B29 A;  3QKG A;  3TGA A;  1MX8 A;  2NP1 A;  1BRP A;  3B2L A;  5EEE A;  4AW8 A;  4DQ4 A;  3U0D A;  3TGC A;  1BSO A;  2RD7 C;  1GGL A;  4M6S A;  5H9L A;  5L8I A;  1N0S A;  1URE A;  1OEJ A;  5L8N A;  5IO7 A;  1ICM A;  2WUT A;  4HPD A;  2FR3 A;  4YCH A;  5F6B A;  3K3L A;  2A3F X;  2WEW A;  3PEC A;  1S44 A;  3KFI A;  4TLJ A;  1GT5 A;  2K23 A;  4QAE A;  1EPB A;  2HYS A;  1A57 A;  4YMY A;  1E5P A;  1BJ7 A;  1QY2 A;  3KFF A;  4OS3 A;  3HWD A;  3P6H A;  3CBC A;  5D47 A;  3CMP A;  2NND A;  5EDC A;  1IKE A;  5LJK A;  4XMD A;  5LKF A;  1X8N A;  3FLL A;  3KFG A;  2N93 A;  4ZGU A;  4CK4 A;  1QFT A;  4Y0P A;  1ACD A;  4ZFX A;  1YWA A;  1BEB A;  1RLB E;  4I3D A;  1AQB A;  3TZS A;  2XKL A;  3O19 A;  1ZNK A;  3BS2 A;  3O22 A;  2OVD A;  3WJE A;  4PSQ A;  4A8Z A;  1SY2 A;  1G5W A;  5D48 A;  2O62 A;  1GT3 A;  4MVI A;  4BVM A;  1BM5 A;  2DM5 A;  2MM3 A;  3PED A;  1YWC A;  1HMS A;  3T1D A;  2OFR X;  4N7C A;  2AT5 X;  3D97 A;  3APU A;  1TVQ A;  2BLG A;  2POA A;  1QQS A;  4AZR A;  3NP1 A;  4EDE A;  1T0V A;  5H9A A;  5EDB A;  1FEL A;  1BSY A;  3CBS A;  5FFH A;  4BOE A;  3APW A;  3VG2 A;  4GNW A;  1ZNG A;  1CBI A;  4OS8 A;  3VG6 A;  3CR6 A;  2CZU A;  4ZJ0 A;  2Q2M A;  4AZP A;  1OEE A;  1PM1 X;  4YBP A;  3BLG A;  2HZR A;  4QGW A;  4EXZ A;  1X8P A;  4Y0Q A;  3BY0 A;  2ANS A;  1G74 A;  1NGL A;  2GTF X;  4ORX A;  1LIF A;  1DFV A;  1QAB E;  2MO5 A;  1YIV A;  1FTP A;  2LFO A;  4HPB A;  2YG2 A;  1X8U A;  2AH7 X;  3B2J A;  2FS7 A;  2NNE A;  1JYJ A;  1SXX A;  1GT1 A;  3WXQ A;  4RUU A;  1QG5 A;  4YGG A;  3D95 A;  2RCQ A;  5FEN A;  4A1H A;  1MUP A;  2WQA E;  3S26 A;  2ACO A;  2RA6 A;  4IB7 A;  1U18 A;  1TOW A;  4XME A;  5HTD A;  1QFV A;  2QO5 A;  3NQ3 A;  4QZU A;  1HMT A;  1KZX A;  4IB6 A;  2W2F A;  1HBP A;  2JU8 A;  3SAO A;  4ORY A;  2QOS C;  5EPQ A;  5HA1 A;  1D3S A;  3BSZ E;  4LKT A;  4QZT A;  3NQ9 A;  5LJH A;  2WEX A;  4YBU A;  1JJX A;  1BBP A;  1O8V A;  2FRS A;  1B4M A;  4HPA A;  4NNT A;  1TOU A;  5D8J A;  2G7B A;  1A18 A;  1T68 X;  5LJD A;  4BQU A;  3GAQ A;  2AT6 X;  1MX7 A;  1CBR A;  1PMP A;  4TKJ A;  1OBQ A;  5LJC A;  3FA9 A;  4LZV A;  1KT4 A;  5H8T A;  4ZHD A;  2CBR A;  2EU7 X;  2A2G A;  2X46 A;  4ZCB A;  2CBS A;  3NX2 A;  2Q39 A;  3CQN A;  2FS6 A;  2WSJ A;  5FAZ A;  3CQR A;  3KQ0 A;  2A2U A;  1E06 A;  1E00 A;  1RBP A;  3FW4 A;  4O9S A;  3UEX A;  2AMM X;  4YCE A;  1GKA A;  1MVG A;  3STK A;  1EPA A;  1LIE A;  3JS1 A;  3UEU A;  1CBS A;  1TXL A;  1CBQ A;  1KT3 A;  1SY1 A;  2LKK A;  2MJI A;  4ORW A;  1CRB A;  5IO6 A;  4I9S A;  4UU2 A;  4IB8 A;  1YWB A;  2RCT A;  4ZHF A;  2GC9 A;  5DG4 A;  3P6F A;  1BWY A;  1HQP A;  1JZU A;  2FWV A;  1O1U A;  1Z24 A;  1JJJ A;  1JBH A;  1OPA A;  2Q4N A;  1FDQ A;  1A3Y A;  1X89 A;  2W2B A;  3G7X A;  4GRJ A;  3AKM A;  4HPC A;  4ZHC A;  1L6M A;  3VG4 A;  3P6E A;  3BU1 A;  1OBP A;  1QWD A;  2G79 A;  4GNY A;  2CM4 A;  1FEM A;  2G78 A;  4NP1 A;  4AYH A;  3JSQ A;  1OEK A;  2RQ0 A;  3P6G A;  1ALB A;  2LBA A;  1IKJ A;  3VG5 A;  1SY0 A;  3PPT A;  4TKB A;  1ZNE A;  3WBG A;  5LKE A;  3B2I A;  4DQ3 A;  3FEK A;  1OPB A;  5K06 A;  1B8E A;  2JU3 A;  1LIC A;  5D4A A;  1SY3 A;  3U9P C;  2JU7 A;  5LJB A;  1R0U A;  2WWP A;  4YDA A;  4YFP A;  1LKE A;  2GJ5 A;  1JYD A;  3U03 A;  2F73 A;  3B2H A;  4ODD A;  1DZJ A;  5BVQ A;  5B27 A;  4YFR A;  4NNS A;  1U0X A;  3AKN A;  2AT0 X;  3O2Y A;  3PH5 A;  1IFB A;  2FLJ A;  2HLV A;  3I17 A;  3WVM A;  4HFO A;  3P6D A;  4TKH A;  2PY1 A;  1EUO A;  2LB6 A;  3HWF A;  5D45 A;  1SXU A;  1LID A;  1YP7 A;  5HWZ A;  4ALB A;  2AKQ A;  1LNM A;  1YUP A;  1KT6 A;  2KTD A;  3MVF A;  2FTB A;  1I04 A;  1U17 A;  3BX8 A;  3ELZ A;  4OS0 A;  4YGH A;  1DZK A;  4QYN A;  3WJG A;  3UEW A;  5JR8 A;  1KZW A;  1SXW A;  4N7D A;  2HMB A;  1DZM A;  2WR6 A;  4XMF A;  1ICN A;  3HWE A;  2LBV A;  4NLI A;  2NNQ A;  3IA8 A;  3BU9 A;  1TW4 A;  2R56 A;  2W2A A;  3WJF A;  4Y0R A;  1VYG A;  1EAL A;  1MDC A;  2XST A;  1BRQ A;  4K19 A;  3FIQ A;  3HWG A;  2Q2P A;  4I3B A;  2AT3 X;  3BRN A;  4LKP A;  3FEP A;  3CWK A;  4A1Y A;  3FA7 A;  4ZR2 A;  1YWD A; 
#chains in the Genus database with same CATH topology
 2P8G A;  3ELX A;  1HBQ A;  1A2D A;  1EQD A;  5HZ9 A;  4Y0S A;  5CYB A;  1AEL A;  1JMZ A;  1T8V A;  1HMR A;  4GDA A;  4CSB A;  1VWL B;  1XCA A;  1SLF B;  4FBV A;  4ES7 A;  3FMZ A;  2RTA A;  3QQ2 A;  4GE1 A;  1UZ2 X;  5LJG A;  2GTL M;  4TJZ A;  1ZNH A;  1CJ5 A;  1B56 A;  1QY1 A;  3VHM A;  1JV4 A;  2JN3 A;  4A60 A;  1ERX A;  3F6Z B;  5AEO A;  5H9N A;  1B0O A;  1SXY A;  1ERB A;  4BGF A;  1XKI A;  3FW5 A;  4AZM A;  4UU3 A;  3WJB A;  1SWD A;  5BVS A;  1NP4 A;  5F7G A;  2L5P A;  4GKC A;  3ZW1 A;  4YKO A;  4ORU A;  2AT8 X;  3NPO A;  4BCS A;  3ZW2 A;  1H91 A;  1Y53 X;  2Q9S A;  2QM9 A;  3DSZ A;  4IRW A;  1OBU A;  1AVD A;  5CSE A;  1LIB A;  5F6Z A;  3D96 A;  1KL3 A;  4IB9 A;  1IIU A;  1JIW I;  3HOL A;  4QGV A;  5H9K A;  2ACP X;  1KT7 A;  4MVL A;  1DV9 A;  3WJD A;  4XMG A;  1O1V A;  1SMP I;  2FKG A;  3D9W A;  1VWC B;  3T6L A;  3MG5 A;  1GM6 A;  3ZUI A;  2RTI B;  4QQ1 A;  3Q6L A;  3RY2 A;  2Z4H A;  4M7M A;  3APV A;  2BS5 A;  4FBR A;  4ZHG A;  4U8U M;  4WHI A;  1K24 A;  3KFH A;  1E02 A;  3UEV A;  4CDC A;  5KHP A;  3FEN A;  2FHL A;  2OVA A;  3APX A;  4OEM A;  2IZE B;  1ZNL A;  4YH0 A;  5F2B A;  5DPQ A;  5JD2 A;  4CPH A;  1SWN A;  2KW1 A;  3NR3 A;  3VPJ E;  3NX1 A;  1SWJ A;  4ZGF A;  4YVB A;  3L4R A;  4O4O A;  5KIC A;  4O49 A;  4GK9 A;  5HZQ A;  4NYR A;  1VWR B;  2X8S A;  4WBK A;  5HTE A;  1GXA A;  1LPJ A;  1AVG I;  1SLD B;  1LFO A;  4YKM A;  2OZQ A;  2OY5 O;  1LCZ A;  1FEN A;  4LQZ A;  1SWK A;  3V8U A;  5IXG A;  2OL6 O;  1KQX A;  4GET A;  5HAE A;  1EIO A;  3C77 X;  1Y55 X;  2ZSC A;  2HZQ A;  2L68 A;  2R74 A;  3NAD A;  3PP6 A;  2MHD A;  2RTR B;  3UAQ A;  3EW1 A;  2RTG B;  4L3R A;  4O4S A;  5BVT A;  4LZU A;  1G7N A;  4XMC A;  4ALO A;  1D2U A;  5EZ2 A;  3STN A;  3VU1 A;  3ZQ3 A;  1JMX A;  1SLE B;  1VWP B;  2A13 A;  1S2P A;  2FR2 A;  2QO6 A;  2RTQ B;  4GJV A;  5FQ7 E;  3WZQ A;  2OL7 A;  4RUN A;  4COT A;  5IRW A;  2QO4 A;  1AB0 A;  5IO5 A;  3MBT A;  1GX9 A;  2GH7 A;  3OBL A;  4IMN A;  1P6P A;  4KH8 A;  4YFQ A;  1BSQ A;  1GX8 A;  2L9C A;  4D6A A;  4CPE A;  3STM X;  3EYC A;  4ID2 A;  3TF6 A;  2BHV A;  3TGB A;  2OFM X;  1G85 A;  1X8O A;  2ALL X;  4EKV A;  4BX7 B;  1I06 A;  4D6B A;  4DNE A;  2ASN X;  4EEJ A;  4AZO A;  5HZ8 A;  5HCC C;  3PH6 A;  1DF3 A;  2OVS A;  4ORR A;  1EW3 A;  3VE1 A;  5F1E A;  1BLR A;  3C78 X;  1I05 A;  3RE5 A;  4O4X A;  4OMX A;  1ML7 A;  2Y3F A;  3FA6 A;  3T2W A;  4ARH A;  4FBO A;  1S7D A;  1I78 A;  4OEL A;  1VWD B;  2R73 A;  2X8F A;  3PQS A;  2GTL O;  4KII A;  4Z2V A;  4IBA A;  1VWJ B;  3AUM O;  2CZT A;  1KL4 A;  1VPR A;  2OY8 A;  3EW2 A;  4NLJ A;  4I3C A;  5B11 O;  3RDM A;  1UYN X;  1KXO A;  5CE4 A;  2CM9 A;  5AJC A;  3FR4 A;  1KQW A;  1I4U A;  2IZH B;  1RXJ A;  4R0B A;  1SRE A;  3RKG A;  1W6F A;  4ORS A;  1KT5 A;  2VFC A;  4CPF A;  1X71 A;  1SA8 A;  3FEL A;  4JO6 A;  1SWU A;  1HY2 A;  4ML7 B;  1Y9T A;  1NBX A;  3E3C A;  2Y3E A;  3RWX A;  3RY1 A;  4IAX A;  3OD9 A;  4NV8 A;  4EFG A;  4OMW A;  5EED A;  3I0A A;  5HCE C;  3WOV A;  3VE2 A;  2IFB A;  3EM0 A;  4IAB A;  4MEE A;  2QMI A;  5HZ5 A;  4L1N A;  4DCB A;  1STP A;  3FR5 A;  4XMH A;  1IW2 A;  1ZND A;  1GKA B;  2AL0 X;  2DJG A;  2K62 A;  2WQ9 A;  3C76 X;  3MX7 A;  2RTP B;  5F58 A;  1VYO A;  5HCD C;  1DZP A;  4KC7 A;  1DC9 A;  4YGZ A;  2OVE A;  1VWE B;  3ZZV A;  1NP1 A;  2A0A A;  3DTQ A;  4AZN A;  5HZ6 A;  4TNN A;  5HBS A;  1EII A;  4NV7 A;  1YP6 A;  1ADL A;  5AQ6 A;  1Y9L A;  2AVI A;  2QOM A;  1KOI A;  4EQA C;  1HQQ A;  3EBK A;  1VWA B;  4GH7 A;  2FT9 A;  2HNX A;  3FR2 A;  3RZY A;  3ZUO A;  1N4J A;  1IFC A;  3HK1 A;  1GX3 A;  3KZA A;  1DF8 A;  3P6C A;  4QNI A;  4JNJ A;  4CDE A;  1FE3 A;  3RSW A;  1ZRY A;  4WFV A;  4YDB A;  4I9R A;  5B2A O;  3NQK A;  3WJC A;  1N9Y A;  1GT4 A;  2BC3 A;  4BX7 A;  4I60 A;  5L8O A;  3EBW A;  4QYP A;  2A5B A;  1SWT A;  3MM0 A;  1QY0 A;  2L67 A;  1N9M A;  1VYF A;  3EC5 A;  5IRA A;  3PDF A;  3EMM A;  2C1Q A;  1JQP A;  1LF7 A;  4CPI A;  5C0N A;  3RDS A;  4JHQ A;  1EXS A;  1HN2 A;  5LJE A;  3B2K A;  4AZQ A;  4CDD A;  1PBO A;  1JJU A;  2ZAI A;  3F9D A;  3VG7 A;  3FA8 A;  4GU8 A;  3BDR A;  2X45 A;  2E4J A;  1W5R A;  4FQB B;  3IFB A;  3BX7 A;  3OJY C;  1LCW A;  2BS6 A;  4IAW A;  2JOZ A;  4NYQ A;  1VWG B;  2Z4I A;  4KCA A;  4ZH6 A;  5HA0 A;  4ZH9 A;  1PEE A;  1KGL A;  2VDF A;  3F8A A;  1VWH B;  3ZWE A;  1E2T A;  1SRI A;  4MVK A;  4QGX A;  2KT4 B;  5FQ6 E;  3VG3 A;  5KID A;  1EI5 A;  4IMO A;  3VHH A;  1X8Q A;  4WFU A;  5B29 A;  3QKG A;  3TGA A;  1MX8 A;  2YMS A;  2NP1 A;  3AEH A;  1BRP A;  3B2L A;  5EEE A;  3SZI A;  4AW8 A;  2IZG B;  4DQ4 A;  3U0D A;  3TGC A;  1BSO A;  2RD7 C;  4O3W A;  1GGL A;  4M6S A;  5H9L A;  5L8I A;  1N0S A;  1SWQ A;  1URE A;  4ON1 A;  1OEJ A;  5L8N A;  5IO7 A;  1ICM A;  2WUT A;  4HPD A;  2FR3 A;  4YCH A;  3WYP A;  4BX5 B;  2IZA A;  5F6B A;  3K3L A;  2A3F X;  2WEW A;  2QCB A;  3PEC A;  1S44 A;  3KFI A;  3RDO A;  4GZV A;  4TLJ A;  3ZW0 A;  1GT5 A;  2K23 A;  4I6S A;  5B10 O;  4QAE A;  1EPB A;  2OFB A;  2HYS A;  2MWH A;  1A57 A;  2IZF B;  1VWK B;  1E5P A;  1BJ7 A;  1QY2 A;  4YMY A;  2G5L A;  1VWO B;  3KFF A;  1OSP O;  4OS3 A;  3HWD A;  3P6H A;  3CBC A;  5D47 A;  4JGL A;  3CMP A;  2NND A;  5EDC A;  2F09 A;  1IKE A;  5LJK A;  4XMD A;  1W4T A;  5LKF A;  1VWQ B;  1X8N A;  3FLL A;  3KFG A;  2N93 A;  4ZGU A;  1SWE A;  4CK4 A;  3RBY A;  1RAV A;  5B5G A;  1QFT A;  4Y0P A;  1ACD A;  4ZFX A;  1YWA A;  1KFF A;  4GGT A;  1BEB A;  1STS B;  1RLB E;  1RSU B;  3RE6 A;  2LA7 A;  1AQB A;  4I3D A;  4HWM A;  3TZS A;  2XKL A;  3FYF A;  3O19 A;  1ZNK A;  3BS2 A;  1SRH A;  1RST B;  2OVD A;  3O22 A;  3WJE A;  4PSQ A;  4A8Z A;  1SY2 A;  1G5W A;  2RTD B;  5D48 A;  2O62 A;  1GT3 A;  3HOE A;  4MVI A;  4NW4 A;  4BVM A;  1BM5 A;  2DM5 A;  1I9H A;  2MM3 A;  3PED A;  1YWC A;  4BX6 B;  2IZB A;  1HMS A;  3T1D A;  2OFR X;  4N7C A;  2AT5 X;  3D97 A;  1LDQ A;  3APU A;  4O3Y A;  2FKJ A;  3VGW A;  1TVQ A;  2BLG A;  2POA A;  3LV4 A;  1QQS A;  3OE3 A;  1PBY A;  3NP1 A;  4AZR A;  2IZD B;  4EDE A;  4I95 A;  1T0V A;  5H9A A;  3WYQ A;  5EDB A;  1FEL A;  2RTE B;  3SLT A;  1BSY A;  1RXK A;  3CBS A;  5FFH A;  4BOE A;  3APW A;  3VG2 A;  2RTC B;  2BSZ A;  1FJ1 E;  4GNW A;  1ZNG A;  4BX5 A;  1CBI A;  4MIS A;  2VFB A;  4OS8 A;  2PI3 O;  3VG6 A;  1Y52 X;  3CR6 A;  4Z2O A;  4PJ2 A;  2OYB O;  1MM9 A;  2CZU A;  4ZJ0 A;  2Q2M A;  4AZP A;  2C1S A;  1OEE A;  1PM1 X;  2RN4 A;  4YBP A;  3BLG A;  2HZR A;  4GD9 A;  4QGW A;  3SOT A;  4EXZ A;  1X8P A;  2BT9 A;  4Y0Q A;  1VWM B;  3S5X A;  2M4L A;  3BY0 A;  2ANS A;  1G74 A;  1SRF A;  2X32 A;  1NGL A;  2GTF X;  2IZI A;  4ORX A;  1LIF A;  1DFV A;  1QAB E;  2A5C A;  2MO5 A;  1YIV A;  4FGI B;  1FTP A;  2LFO A;  4HPB A;  4O3X B;  3SLJ A;  4INN A;  3X00 A;  2YG2 A;  1X8U A;  2AH7 X;  3B2J A;  1SRJ A;  2FS7 A;  2NNE A;  1JYJ A;  1SXX A;  1GT1 A;  2OF8 A;  3WXQ A;  4RUU A;  1QG5 A;  4YGG A;  3D95 A;  1SWF A;  2RCQ A;  5FEN A;  4A1H A;  1MUP A;  2WQA E;  3S26 A;  4BBO A;  2ACO A;  2RA6 A;  4IB7 A;  4Z28 A;  1SWR A;  1TOW A;  1U18 A;  4XME A;  5HTD A;  4QRL A;  1QFV A;  3PK2 A;  2QO5 A;  1MOY A;  1IJ8 A;  3NQ3 A;  4GUZ A;  4QZU A;  1HMT A;  5CHK A;  2KTS A;  4IB6 A;  3SZJ A;  3Q34 A;  2W2F A;  4B55 A;  1KZX A;  1HBP A;  2JU8 A;  3SAO A;  2X8T A;  4ORY A;  2RTH B;  1SLG B;  2QOS C;  2A8G A;  5AJB A;  5EPQ A;  1SWB A;  4U3Q A;  5HA1 A;  1Y0G A;  1D3S A;  3BSZ E;  3D4R A;  4LKT A;  4QZT A;  3NQ9 A;  5LJH A;  2WEX A;  3WZO A;  1RXH A;  2F01 A;  2JW1 A;  4YBU A;  1JJX A;  1BBP A;  3CKF A;  1O8V A;  2FRS A;  4CPH B;  2JMB A;  4GDZ A;  1LEL A;  2IZJ A;  2RTM A;  2AF5 A;  1B4M A;  4HPA A;  4NNT A;  1TOU A;  1LUQ A;  2X4M A;  2G7B A;  5D8J A;  1A18 A;  1T68 X;  5LJD A;  4BQU A;  3GAQ A;  3CKG A;  1NQM A;  2AT6 X;  4Z27 A;  1MX7 A;  1CBR A;  1AVE A;  1PMP A;  2RTO B;  1OBQ A;  4TKJ A;  3T2X A;  5LJC A;  3FA9 A;  1MK5 A;  1KT4 A;  4LZV A;  5H8T A;  3VHI A;  4ZHD A;  2DJF A;  2CBR A;  2EU7 X;  2A2G A;  4Y59 A;  2X46 A;  4ZCB A;  3LHN A;  2CBS A;  2IZK A;  3NX2 A;  1SRG A;  2Q39 A;  3CQN A;  2FS6 A;  2WSJ A;  4GJS A;  3CQR A;  3KQ0 A;  5FAZ A;  2A2U A;  3WZN A;  1NQN A;  1E06 A;  3RDX A;  1E00 A;  1K3B A;  1PTS A;  1RBP A;  3FW4 A;  2RTK A;  4O9S A;  3UEX A;  2AMM X;  4YCE A;  1GKA A;  1MVG A;  3STK A;  1EPA A;  1LIE A;  3JS1 A;  3UEU A;  5K67 A;  1CBS A;  1TXL A;  2GTL N;  4U46 A;  1CBQ A;  1KT3 A;  1SWA A;  1SY1 A;  2MF6 A;  2LKK A;  2MJI A;  2RTF B;  4ORW A;  1CRB A;  1SWS A;  5IO6 A;  4I9S A;  4UU2 A;  1WBI A;  1VWI B;  3P02 A;  1KL5 A;  4IB8 A;  1YWB A;  2RCT A;  4ZHF A;  2GC9 A;  5DG4 A;  3P6F A;  3HPE A;  1BWY A;  1HQP A;  2HKD A;  2I5Z O;  3P24 A;  4O4U A;  3SZH A;  4TQ2 A;  2FWV A;  2FHN X;  4OKA A;  1JZU A;  1O1U A;  1Z24 A;  2FGS A;  3PQU A;  1JJJ A;  1JBH A;  1OPA A;  2Q4N A;  1VWB B;  1FDQ A;  1A3Y A;  1X89 A;  2OY7 A;  2W2B A;  1HXL A;  2OY1 O;  2UYW A;  3G7X A;  4GRJ A;  4ZHH A;  3AKM A;  3LTW A;  4HPC A;  4ZHC A;  1L6M A;  1SWL A;  3VG4 A;  3P6E A;  3BU1 A;  1OBP A;  1QWD A;  2G79 A;  4GNY A;  2CM4 A;  1FEM A;  2G78 A;  2WPU A;  4NP1 A;  4U8U N;  5IRU A;  3NBX X;  4AYH A;  3JSQ A;  1OEK A;  2RQ0 A;  3P6G A;  1ALB A;  2LBA A;  2G8C O;  1IKJ A;  1SWP A;  3VG5 A;  1LCV A;  3KVN A;  1SY0 A;  1LDO A;  3PPT A;  4MVE A;  1ZNE A;  3H3I A;  3WBG A;  4TKB A;  5LKE A;  3B2I A;  5B3M O;  1UYO X;  4DQ3 A;  1STR B;  3FEK A;  1OPB A;  5K06 A;  2Y32 A;  1B8E A;  2JU3 A;  1LIC A;  5D4A A;  1SY3 A;  2OFA A;  3U9P C;  2JU7 A;  5LJB A;  5K68 A;  2KD2 A;  4KT5 A;  4CDF A;  1R0U A;  2WWP A;  4MIR A;  4YDA A;  1VWN B;  4YFP A;  1LKE A;  2GJ5 A;  1WUB A;  1JYD A;  3JQO A;  3U03 A;  2F73 A;  4GGZ A;  3B2H A;  2RTL A;  4ODD A;  1DZJ A;  4O3Z A;  5BVQ A;  3S5V A;  5B27 A;  5L3Y A;  1SWH A;  3S60 A;  3ZI8 A;  4YFR A;  2JGS A;  4NNS A;  1U0X A;  3AKN A;  3T6F A;  2AT0 X;  3O2Y A;  4GGR A;  3PH5 A;  2IZL B;  2OL8 O;  1IFB A;  2FLJ A;  2HLV A;  3HTY A;  2UZ2 A;  3RDU A;  2I5V O;  4Z6J A;  5BYP A;  1NC9 A;  3I17 A;  3WVM A;  4HFO A;  3P6D A;  4TKH A;  4Y5D A;  2PY1 A;  1EUO A;  2LB6 A;  3FID A;  3HWF A;  5D45 A;  1SXU A;  1LID A;  1YP7 A;  5HWZ A;  4ALB A;  2AKQ A;  2X34 A;  5B5F A;  1LNM A;  1YUP A;  2RTN B;  1KT6 A;  3ZW0 B;  5FQ8 E;  2KTD A;  4Z2P A;  3MVF A;  1N7Y A;  4KC8 A;  3WZP A;  2C4I A;  2FTB A;  1I04 A;  1U17 A;  2ZAG A;  3BX8 A;  3ELZ A;  3ZW1 B;  4OS0 A;  4YGH A;  1DZK A;  4BJ8 A;  1MEP A;  4QYN A;  3WJG A;  3SLO A;  1SWG A;  2X55 A;  3UEW A;  5JR8 A;  1KZW A;  1SXW A;  1SWC A;  4N7D A;  2HMB A;  1DZM A;  2WR6 A;  4XMF A;  1ICN A;  4BX6 A;  3HWE A;  2LBV A;  4NLI A;  2NNQ A;  3FDC A;  3IA8 A;  3BU9 A;  1TW4 A;  2R56 A;  1VWF B;  2RTJ A;  2W2A A;  1N43 A;  3RDQ A;  3WJF A;  1SWO A;  2X56 A;  4Y0R A;  1VYG A;  1HXZ A;  2CAM A;  1EAL A;  1MDC A;  2XST A;  1BRQ A;  4K19 A;  4U9C A;  4U8U O;  2IZC B;  3FIQ A;  4C5P A;  3HWG A;  1NDJ A;  2OF9 A;  2Q2P A;  4I3B A;  4CV7 A;  2AT3 X;  3GE2 A;  3BRN A;  4LKP A;  3FEP A;  3CWK A;  4A1Y A;  3FA7 A;  4ZR2 A;  2RTB B;  1YWD A;  3N91 A; 
#chains in the Genus database with same CATH homology
 2P8G A;  3ELX A;  1HBQ A;  1A2D A;  1EQD A;  5HZ9 A;  4Y0S A;  5CYB A;  1AEL A;  1T8V A;  1HMR A;  4CSB A;  1XCA A;  4FBV A;  4ES7 A;  3FMZ A;  4GE1 A;  5LJG A;  1UZ2 X;  2GTL M;  4TJZ A;  1ZNH A;  1CJ5 A;  1B56 A;  1QY1 A;  1JV4 A;  2JN3 A;  4A60 A;  1ERX A;  3F6Z B;  5AEO A;  5H9N A;  1B0O A;  1SXY A;  1ERB A;  1XKI A;  3FW5 A;  4AZM A;  4UU3 A;  3WJB A;  5BVS A;  1NP4 A;  5F7G A;  2L5P A;  4GKC A;  3ZW1 A;  4YKO A;  4ORU A;  2AT8 X;  3NPO A;  3ZW2 A;  1H91 A;  2Q9S A;  3DSZ A;  2QM9 A;  1OBU A;  5F6Z A;  1LIB A;  3D96 A;  4IB9 A;  1IIU A;  1JIW I;  3HOL A;  5H9K A;  2ACP X;  1KT7 A;  4MVL A;  1DV9 A;  3WJD A;  4XMG A;  1O1V A;  1SMP I;  1GM6 A;  3ZUI A;  4QQ1 A;  3Q6L A;  2Z4H A;  4M7M A;  3APV A;  2BS5 A;  4ZHG A;  4U8U M;  4WHI A;  3KFH A;  1E02 A;  3UEV A;  5KHP A;  3FEN A;  2OVA A;  3APX A;  4YH0 A;  1ZNL A;  5DPQ A;  2KW1 A;  3NR3 A;  3VPJ E;  3NX1 A;  4ZGF A;  3L4R A;  4O4O A;  5KIC A;  4O49 A;  4GK9 A;  5HZQ A;  4NYR A;  2X8S A;  4WBK A;  5HTE A;  1GXA A;  1LPJ A;  1AVG I;  1LFO A;  4YKM A;  2OZQ A;  1FEN A;  4LQZ A;  3V8U A;  1KQX A;  4GET A;  5HAE A;  1EIO A;  3C77 X;  2HZQ A;  2L68 A;  2R74 A;  3NAD A;  3PP6 A;  2MHD A;  5BVT A;  3UAQ A;  4O4S A;  4L3R A;  4LZU A;  1G7N A;  4XMC A;  4ALO A;  1D2U A;  5EZ2 A;  3STN A;  3VU1 A;  3ZQ3 A;  5FQ7 E;  4ARH A;  5LJE A;  2A13 A;  1S2P A;  2FR2 A;  2QO6 A;  4COT A;  4RUN A;  2QO4 A;  1AB0 A;  5IO5 A;  3MBT A;  1GX9 A;  3OBL A;  4IMN A;  1P6P A;  4KH8 A;  4YFQ A;  1BSQ A;  1GX8 A;  2L9C A;  4D6A A;  3STM X;  3EYC A;  4ID2 A;  3TF6 A;  2BHV A;  3TGB A;  2OFM X;  1G85 A;  1X8O A;  2ALL X;  1I06 A;  4D6B A;  2ASN X;  4EEJ A;  4AZO A;  5HZ8 A;  5HCC C;  3PH6 A;  1DF3 A;  2OVS A;  4ORR A;  1EW3 A;  3VE1 A;  5F1E A;  1BLR A;  3C78 X;  1I05 A;  4O4X A;  4OMX A;  1ML7 A;  3FA6 A;  4FBO A;  1S7D A;  2R73 A;  2X8F A;  3PQS A;  2GTL O;  4KII A;  4IBA A;  2CZT A;  1VPR A;  4NLJ A;  4I3C A;  1KXO A;  5CE4 A;  2CM9 A;  5AJC A;  3FR4 A;  1KQW A;  1I4U A;  4R0B A;  3RKG A;  4ORS A;  1KT5 A;  1X71 A;  1SA8 A;  3FEL A;  4ML7 B;  1Y9T A;  3E3C A;  3RWX A;  4IAX A;  3OD9 A;  4EFG A;  4OMW A;  5EED A;  3I0A A;  5HCE C;  3WOV A;  3VE2 A;  2IFB A;  3EM0 A;  4IAB A;  5HZ5 A;  2QMI A;  4L1N A;  3FR5 A;  4XMH A;  1IW2 A;  1ZND A;  1GKA B;  2AL0 X;  2K62 A;  2WQ9 A;  3C76 X;  3MX7 A;  5F58 A;  5HCD C;  1DZP A;  4KC7 A;  1DC9 A;  4YGZ A;  2OVE A;  3ZZV A;  4AZN A;  1NP1 A;  2A0A A;  3DTQ A;  5HZ6 A;  4TNN A;  5HBS A;  1EII A;  1YP6 A;  1ADL A;  5AQ6 A;  1Y9L A;  1KOI A;  4EQA C;  3EBK A;  4GH7 A;  2FT9 A;  2HNX A;  3FR2 A;  3RZY A;  3ZUO A;  4QNI A;  1IFC A;  3HK1 A;  3KZA A;  3P6C A;  3ZW0 B;  4ZHH A;  1FE3 A;  3RSW A;  1ZRY A;  4WFV A;  4YDB A;  4I9R A;  3WJC A;  3NQK A;  4QGV A;  4TQ2 A;  1GT4 A;  5L8O A;  3EBW A;  4QYP A;  1QY0 A;  2L67 A;  1VYF A;  3EMM A;  1LF7 A;  5C0N A;  1EXS A;  1HN2 A;  3B2K A;  4AZQ A;  1PBO A;  2ZAI A;  3F9D A;  3VG7 A;  3FA8 A;  4GU8 A;  3BDR A;  2X45 A;  2E4J A;  4FQB B;  3IFB A;  3BX7 A;  3OJY C;  4IAW A;  2BS6 A;  2JOZ A;  4NYQ A;  2Z4I A;  4KCA A;  4ZH6 A;  5HA0 A;  4ZH9 A;  1PEE A;  1KGL A;  3F8A A;  3ZWE A;  4MVK A;  4QGX A;  2KT4 B;  5FQ6 E;  3VG3 A;  5KID A;  1EI5 A;  4IMO A;  1X8Q A;  4WFU A;  5B29 A;  3QKG A;  3TGA A;  1MX8 A;  2YMS A;  2NP1 A;  1BRP A;  3B2L A;  5EEE A;  4AW8 A;  4DQ4 A;  3U0D A;  3TGC A;  1BSO A;  2RD7 C;  4O3W A;  1GGL A;  4M6S A;  5H9L A;  5L8I A;  1N0S A;  1URE A;  4ON1 A;  1OEJ A;  5L8N A;  5IO7 A;  1ICM A;  2WUT A;  4HPD A;  2FR3 A;  4YCH A;  5F6B A;  3K3L A;  2A3F X;  2WEW A;  3PEC A;  1S44 A;  3KFI A;  4GZV A;  4TLJ A;  3ZW0 A;  1GT5 A;  2K23 A;  4I6S A;  4QAE A;  1EPB A;  2HYS A;  2MWH A;  1A57 A;  4YMY A;  1E5P A;  1BJ7 A;  1QY2 A;  3KFF A;  4OS3 A;  3HWD A;  3P6H A;  3CBC A;  5D47 A;  4JGL A;  3CMP A;  2NND A;  5EDC A;  2F09 A;  1IKE A;  5LJK A;  4XMD A;  5LKF A;  1X8N A;  3FLL A;  3KFG A;  2N93 A;  4ZGU A;  4CK4 A;  3RBY A;  1QFT A;  4Y0P A;  1ACD A;  4ZFX A;  1YWA A;  1BEB A;  1RLB E;  2LA7 A;  1AQB A;  4I3D A;  4HWM A;  3TZS A;  2XKL A;  3FYF A;  3O19 A;  1ZNK A;  3BS2 A;  3O22 A;  2OVD A;  3WJE A;  4PSQ A;  4A8Z A;  1SY2 A;  1G5W A;  5D48 A;  2O62 A;  1GT3 A;  3HOE A;  4MVI A;  4NW4 A;  4BVM A;  1BM5 A;  2DM5 A;  2MM3 A;  3PED A;  1YWC A;  1HMS A;  3T1D A;  2OFR X;  4N7C A;  2AT5 X;  3D97 A;  4O3Y A;  3APU A;  1TVQ A;  2BLG A;  2POA A;  3LV4 A;  1QQS A;  3OE3 A;  4AZR A;  3NP1 A;  4EDE A;  4I95 A;  1T0V A;  5H9A A;  5EDB A;  1FEL A;  1BSY A;  3CBS A;  5FFH A;  4BOE A;  3APW A;  3VG2 A;  4GNW A;  1ZNG A;  1CBI A;  4MIS A;  4OS8 A;  3VG6 A;  3CR6 A;  4PJ2 A;  2CZU A;  4ZJ0 A;  2Q2M A;  4AZP A;  1OEE A;  1PM1 X;  2RN4 A;  4YBP A;  3BLG A;  2HZR A;  4QGW A;  4EXZ A;  3SOT A;  1X8P A;  2BT9 A;  4Y0Q A;  3S5X A;  2M4L A;  3BY0 A;  2ANS A;  1G74 A;  1NGL A;  2GTF X;  4ORX A;  1LIF A;  1DFV A;  1QAB E;  2MO5 A;  1YIV A;  4FGI B;  1FTP A;  2LFO A;  4HPB A;  4O3X B;  4INN A;  2YG2 A;  1X8U A;  2AH7 X;  3B2J A;  2FS7 A;  2NNE A;  1JYJ A;  1SXX A;  1GT1 A;  3WXQ A;  4RUU A;  1QG5 A;  4YGG A;  3D95 A;  2RCQ A;  5FEN A;  4A1H A;  1MUP A;  2WQA E;  3S26 A;  2ACO A;  2RA6 A;  4IB7 A;  1U18 A;  1TOW A;  4XME A;  5HTD A;  4QRL A;  1QFV A;  4FBR A;  2QO5 A;  3NQ3 A;  4QZU A;  1HMT A;  1KZX A;  2KTS A;  4IB6 A;  2W2F A;  1HBP A;  2JU8 A;  3SAO A;  2X8T A;  4ORY A;  2QOS C;  5AJB A;  5EPQ A;  4U3Q A;  5HA1 A;  3D4R A;  1D3S A;  3BSZ E;  4LKT A;  4QZT A;  3NQ9 A;  5LJH A;  2WEX A;  2JW1 A;  4YBU A;  1JJX A;  1BBP A;  1O8V A;  2FRS A;  2JMB A;  4GDZ A;  1B4M A;  4HPA A;  4NNT A;  1TOU A;  5D8J A;  2G7B A;  1A18 A;  1T68 X;  5LJD A;  4BQU A;  3GAQ A;  2AT6 X;  1MX7 A;  1CBR A;  1PMP A;  4TKJ A;  1OBQ A;  5LJC A;  3FA9 A;  4LZV A;  1KT4 A;  5H8T A;  4ZHD A;  2CBR A;  2EU7 X;  2A2G A;  2X46 A;  4ZCB A;  3LHN A;  2CBS A;  3NX2 A;  2Q39 A;  3CQN A;  2FS6 A;  2WSJ A;  5FAZ A;  3CQR A;  3KQ0 A;  2A2U A;  5BYP A;  1E06 A;  1E00 A;  1RBP A;  3FW4 A;  4O9S A;  3UEX A;  2AMM X;  4YCE A;  1GKA A;  1MVG A;  3STK A;  1EPA A;  1LIE A;  3JS1 A;  3UEU A;  1CBS A;  1TXL A;  2GTL N;  1CBQ A;  1KT3 A;  1SY1 A;  2LKK A;  2MJI A;  4ORW A;  1CRB A;  5IO6 A;  4I9S A;  4UU2 A;  3P02 A;  4IB8 A;  1YWB A;  2RCT A;  4ZHF A;  2GC9 A;  5DG4 A;  3P6F A;  1BWY A;  1HQP A;  4O4U A;  3P24 A;  1JZU A;  2FWV A;  1O1U A;  1Z24 A;  3PQU A;  1JJJ A;  1JBH A;  1OPA A;  2Q4N A;  1FDQ A;  1A3Y A;  1X89 A;  2W2B A;  3G7X A;  4GRJ A;  3AKM A;  4HPC A;  4ZHC A;  1L6M A;  3VG4 A;  3P6E A;  3BU1 A;  1OBP A;  1QWD A;  2G79 A;  4GNY A;  2CM4 A;  1FEM A;  2G78 A;  4NP1 A;  4U8U N;  3NBX X;  4AYH A;  3JSQ A;  1OEK A;  2RQ0 A;  3P6G A;  1ALB A;  2LBA A;  1IKJ A;  3VG5 A;  1SY0 A;  3PPT A;  4MVE A;  1ZNE A;  3H3I A;  3WBG A;  4TKB A;  5LKE A;  3B2I A;  4DQ3 A;  3FEK A;  1OPB A;  5K06 A;  1B8E A;  2JU3 A;  1LIC A;  5D4A A;  1SY3 A;  3U9P C;  2JU7 A;  5LJB A;  2KD2 A;  4KT5 A;  1R0U A;  2WWP A;  4MIR A;  4YDA A;  4YFP A;  1LKE A;  2GJ5 A;  1JYD A;  3JQO A;  3U03 A;  2F73 A;  3B2H A;  4ODD A;  1DZJ A;  4O3Z A;  5BVQ A;  3S5V A;  5B27 A;  3S60 A;  3ZI8 A;  4YFR A;  4NNS A;  1U0X A;  3AKN A;  2AT0 X;  3O2Y A;  3PH5 A;  1IFB A;  2FLJ A;  2HLV A;  3HTY A;  3I17 A;  3WVM A;  4HFO A;  3P6D A;  4TKH A;  2PY1 A;  1EUO A;  2LB6 A;  3HWF A;  5D45 A;  1SXU A;  1LID A;  1YP7 A;  5HWZ A;  4ALB A;  2AKQ A;  1LNM A;  1YUP A;  1KT6 A;  5FQ8 E;  2KTD A;  3MVF A;  4KC8 A;  2FTB A;  1I04 A;  1U17 A;  2ZAG A;  3BX8 A;  3ELZ A;  3ZW1 B;  4OS0 A;  4YGH A;  1DZK A;  4QYN A;  3WJG A;  3UEW A;  5JR8 A;  1KZW A;  1SXW A;  4N7D A;  2HMB A;  1DZM A;  2WR6 A;  4XMF A;  1ICN A;  3HWE A;  2LBV A;  4NLI A;  2NNQ A;  3IA8 A;  3BU9 A;  1TW4 A;  2R56 A;  2W2A A;  3WJF A;  4Y0R A;  1VYG A;  1EAL A;  1MDC A;  2XST A;  1BRQ A;  4K19 A;  4U9C A;  4U8U O;  3FIQ A;  3HWG A;  2Q2P A;  4I3B A;  4CV7 A;  2AT3 X;  3GE2 A;  3BRN A;  4LKP A;  3FEP A;  3CWK A;  4A1Y A;  3FA7 A;  4ZR2 A;  1YWD A;  3N91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...