1DV9A

Structural changes accompanying ph-induced dissociation of the b-lactoglobulin dimer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
162
structure length
162
Chain Sequence
AYVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords BETA-LACTOGLOBULIN
publication title Structural changes accompanying pH-induced dissociation of the beta-lactoglobulin dimer.
pubmed doi rcsb
source organism Bos taurus
total genus 26
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2000-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1dv9A00
2LBVA 1CJ5A 4ES7A 5HCEC 3STKA 4ORWA 1EUOA 1QQSA 4WFUA 2L9CA 3BRNA 3MBTA 1ERBA 1LIDA 2ANSA 4BOEA 3B2HA 4XMEA 2E4JA 4A8ZA 2G7BA 4D6BA 1A18A 2HMBA 3C78X 4AW8A 1JJJA 2CBSA 1HQPA 2LFOA 1G7NA 3C77X 3TF6A 3HWDA 4CK4A 1X8PA 1ACDA 1KT7A 3CMPA 2JN3A 3STNA 1KT6A 3T1DA 1ZNLA 3EBWA 3I0AA 1X8UA 1HBPA 1CBIA 1SY3A 2QO4A 4YDAA 3NP1A 1DZJA 1BBPA 1MDCA 4EDEA 1ML7A 4YKMA 1HMTA 4ZFXA 1EW3A 1UREA 5LJEA 2FS7A 2R56A 1CBRA 2AT8X 1AQBA 4QYNA 4XMDA 2OZQA 3RSWA 1KZWA 1JJXA 1QABE 5D47A 2A0AA 4GRJA 3BX7A 1BRPA 3DSZA 1AB0A 3WJGA 2AL0X 4GNYA 3BY0A 3PH6A 4HPBA 4IMNA 3CR6A 5D8JA 4IMOA 2LKKA 1NGLA 1DF3A 1GX9A 1KXOA 1TVQA 1PEEA 1TW4A 2KT4B 4A60A 1QFVA 1N0SA 3EBKA 4QZUA 3HK1A 3C76X 4GE1A 4AZMA 1D2UA 1GM6A 4BVMA 2OVEA 4IB7A 3WJEA 5HTDA 3F8AA 1R0UA 3P6EA 4YGHA 5HA0A 2CM4A 4EFGA 4NLJA 4OS0A 1YWAA 4GH7A 1TXLA 1EIOA 4GNWA 4DQ4A 3WJFA 3ELZA 3PEDA 5B27A 2P8GA 3I17A 3P6FA 5KICA 2Q2PA 3VG7A 1SY1A 1LICA 3MVFA 4GKCA 5IO6A 2RCTA 1O8VA 4ORUA 4AZQA 4ODDA 2JU3A 1YP7A 1S44A 3FW5A 3G7XA 3NX1A 2OFRX 3STMX 4ZGUA 1EPBA 3OJYC 4YDBA 5HZ9A 2L67A 5EEDA 2F73A 2L68A 3FA6A 4YGZA 4AZRA 4LKTA 4QAEA 3VG3A 3KQ0A 1A57A 2MJIA 1LIEA 3WBGA 3SAOA 3CWKA 5L8OA 5D4AA 1PBOA 4M7MA 1IIUA 5HTEA 1AVGI 1E00A 4OS3A 1OPBA 3QKGA 3ZQ3A 5LKEA 1FDQA 4HFOA 1MUPA 4I3BA 1I4UA 3EMMA 3JSQA 3B2KA 1QY1A 3UEUA 1LKEA 4WFVA 3UEWA 3APWA 1EIIA 2AT5X 2WUTA 3APXA 2A13A 2RQ0A 3DTQA 3JS1A 2A2UA 1L6MA 3AKNA 1ZNKA 3GAQA 2Q39A 4LKPA 5EEEA 4IBAA 5FENA 3CQNA 2QO6A 2OVAA 5LJKA 4OMWA 3WJBA 1LIBA 1S2PA 5HWZA 5F7GA 3NQ9A 1YP6A 3EYCA 3PH5A 2XKLA 5HZ5A 1SXXA 5FFHA 4QYPA 3ZUIA 1DV9A 4XMFA 1LIFA 1B56A 4ZHHA 2GJ5A 4ZHDA 1MX7A 3PECA 4TNNA 4M6SA 2IFBA 2R74A 1E5PA 1QY0A 3HWGA 1IKJA 1JYDA 5EPQA 1KZXA 4XMGA 2O62A 3TGAA 1HMSA 1HN2A 4NP1A 1KT4A 1NP1A 3P6DA 3RZYA 3D96A 5HZ6A 4TQ2A 4DQ3A 1OEJA 1VYFA 1X8NA 1TOWA 4BQUA 1ZNGA 1ADLA 2G79A 2FWVA 4AZOA 1UZ2X 5HZQA 4I3CA 2AT3X 1GKAB 1EALA 2HZQA 4TKHA 5KHPA 1GGLA 5CE4A 2LBAA 2CBRA 5LJCA 1GT4A 1X8QA 4NNTA 1MX8A 2WQ9A 1FELA 3BLGA 5HZ8A 2CZTA 4NYQA 5H9NA 5HAEA 2A3FX 2ACPX 2HZRA 2NNDA 1FEMA 3K3LA 4TJZA 1RBPA 1QWDA 3F9DA 1DZMA 1FE3A 4TKBA 1B8EA 3KFIA 4UU3A 3TZSA 1H91A 5L8IA 3APVA 4N7DA 1KGLA 3AKMA 4K19A 1VYGA 1IW2A 3FW4A 4ZH9A 4D6AA 1DZKA 1ERXA 5BVSA 5JR8A 3B2LA 1B4MA 4LZVA 3FA8A 3NX2A 4RUUA 4QGVA 3FELA 1YWDA 1OBUA 4I9RA 4YKOA 4O9SA 4XMCA 1KQXA 4XMHA 1BSYA 1T8VA 2FRSA 2WEWA 1X71A 2W2FA 5B29A 1VPRA 3D95A 5BVQA 4ZHGA 1CBSA 3PPTA 1PM1X 4HPAA 2WQAE 2FR2A 3U03A 5HCDC 2HNXA 2PY1A 1AELA 2AMMX 4HPDA 2FS6A 1YWCA 2X46A 4ZHFA 4TKJA 1LPJA 3NQ3A 1X8OA 4ORYA 1SXYA 1BWYA 4KIIA 4HPCA 3ZUOA 3WJDA 1SA8A 3HWFA 1CBQA 4IB9A 5IO7A 4ZR2A 1U17A 3APUA 1OEEA 3FMZA 3IFBA 1ICMA 3FR4A 1GT5A 3O22A 4YFQA 1LF7A 1QY2A 2NP1A 1B0OA 2QOSC 1JV4A 1Z24A 3B2JA 1O1VA 3IA8A 1I06A 2FTBA 2R73A 1G5WA 3NADA 1MVGA 1TOUA 2HLVA 4QGXA 5AQ6A 5LJDA 4QZTA 1GT3A 2OVDA 3VG5A 1GT1A 5D48A 5L8NA 1OBPA 2WSJA 3WJCA 1BJ7A 3WXQA 1KOIA 1SXUA 2BLGA 1KT5A 5LJHA 1JBHA 1G85A 3FLLA 3NR3A 4YBUA 1BSOA 1FENA 1SY0A 4Y0SA 2LB6A 3P6CA 5D45A 2JU7A 4GETA 1IFCA 5EDCA 2EU7X 4Y0PA 1XCAA 2MM3A 4OMXA 4YCHA 1E02A 1YIVA 5H9LA 1ZRYA 3BU9A 3O19A 5HBSA 3S26A 4NYRA 3B2IA 1E06A 4ZJ0A 2G78A 1S7DA 3BU1A 5DG4A 1KQWA 1GKAA 4YMYA 2XSTA 1ZNDA 1RLBE 5LJGA 2QO5A 1U0XA 1OEKA 2KTDA 3BX8A 4WBKA 2L5PA 3D97A 3KZAA 1HBQA 4R0BA 2NNEA 3FR5A 5F6ZA 2WWPA 1O1UA 2K62A 2WR6A 3KFGA 5LKFA 2NNQA 2GC9A 5KIDA 2ASNX 2HYSA 4MVLA 4NNSA 4ALBA 1ALBA 2W2AA 3FEPA 1XKIA 1ICNA 4RUNA 4ORRA 2RA6A 5K06A 1YUPA 1JZUA 5H9AA 1SY2A 1U18A 1DC9A 3VG6A 4ZH6A 2GTFX 1SXWA 4NLIA 4YCEA 1PMPA 1YWBA 5FAZA 4A1YA 2MO5A 1GXAA 1LNMA 4MVKA 2AH7X 2JOZA 1IKEA 1NP4A 3KFHA 4OS8A 2RD7C 2WEXA 2QM9A 1FTPA 4A1HA 1GX8A 4IAXA 4YGGA 3HWEA 2N93A 1DFVA 2CZUA 4YFPA 3L4RA 1EPAA 1T0VA 5HA1A 3TGCA 1LFOA 5F1EA 1A2DA 5LJBA 4AZPA 2OFMX 3VG4A 5BVTA 1BM5A 1EQDA 4IB8A 4TLJA 4AYHA 2X45A 3WVMA 1QFTA 2Q9SA 4LZUA 5F6BA 4IB6A 3CQRA 4YFRA 3EM0A 3FEKA 5H8TA 3FR2A 4PSQA 1OBQA 4ORXA 3Q6LA 4Y0RA 3CBCA 4IAWA 3P6GA 1ZNHA 4ORSA 5EZ2A 3VG2A 2W2BA 5H9KA 4AZNA 3UEVA 3FIQA 3PP6A 1D3SA 3U0DA 2ACOA 2AT0X 4EEJA 1BEBA 4QGWA 1KT3A 2FT9A 2CM9A 2Q4NA 3BDRA 1I04A 4ALOA 2JU8A 4I9SA 4ZCBA 1BRQA 3NPOA 1I05A 1IFBA 2RCQA 4ZHCA 2FLJA 1CRBA 1P6PA 2A2GA 4MVIA 1BSQA 3FENA 2Q2MA 5IO5A 2AT6X 2ALLX 4N7CA 3O2YA 2YG2A 3U9PC 4Y0QA 3ELXA 3BSZE 3BS2A 3FA7A 1A3YA 1ZNEA 1G74A 2POAA 3CBSA 3UEXA 5DPQA 1T68X 4EXZA 3KFFA 4I3DA 5HCCC 4YBPA 2AKQA 3P6HA 4UU2A 5EDBA 5F58A 1DZPA 1OPAA 2K23A 1QG5A 1X89A 1BLRA 5C0NA 2FR3A 1EXSA 1HMRA 3FA9A 1JYJA 3TGBA 4YH0A 4ARHA 2DM5A
chains in the Genus database with same CATH superfamily
4JGLA 2LBVA 1CJ5A 1NBXA 2GH7A 4ES7A 5HCEC 4I60A 2RN4A 2A5CA 3ZI8A 3ZZVA 3STKA 4ORWA 1EUOA 1QQSA 4WFUA 2L9CA 3VHHA 3BRNA 3JQOA 1ERBA 3MBTA 1LIDA 2ANSA 4BOEA 3B2HA 4BX6B 4XMEA 2E4JA 4A8ZA 2IZKA 2G7BA 4ID2A 4D6BA 1A18A 2HMBA 3C78X 1PTSA 4AW8A 1JJJA 2CBSA 1HQPA 2LFOA 1G7NA 1VWMB 4Z27A 3C77X 1NQNA 3TF6A 3HWDA 4CK4A 1X8PA 1ACDA 1KT7A 3CMPA 2JN3A 3STNA 1KT6A 2OYBO 3T1DA 1ZNLA 3EBWA 3I0AA 1X8UA 1HBPA 1CBIA 1MK5A 1SY3A 2QO4A 4YDAA 3NP1A 3X00A 4CPEA 1DZJA 1BBPA 1LCZA 1MDCA 3RDOA 4EDEA 1ML7A 4YKMA 4KT5A 1HMTA 4ZFXA 1SWOA 1SRIA 1EW3A 3SLOA 1UREA 4ML7B 5LJEA 5B5GA 1VWQB 2FS7A 2R56A 2JW1A 4OKAA 1CBRA 2AT8X 1AQBA 2RTBB 4QYNA 4XMDA 2OZQA 5D4AA 3RSWA 1KZWA 1RSUB 1JJXA 1QABE 1SWNA 1STPA 1VWLB 2A0AA 3P02A 4GRJA 5D47A 5JD2A 3BX7A 1BRPA 1HXLA 1W6FA 1AB0A 3DSZA 3WJGA 2AL0X 4EQAC 4GGZA 4GNYA 4IABA 3BY0A 2OVSA 3PH6A 4HPBA 4IMNA 3CR6A 4KC7A 5D8JA 4IMOA 1RXKA 1SWLA 1NGLA 2LKKA 1GX9A 1SREA 1KXOA 1SWHA 1TVQA 2RTKA 3EC5A 1TW4A 2KT4B 1PEEA 1QFVA 4A60A 1N0SA 2GTLO 5B2AO 3EBKA 5HZ8A 3LV4A 3MM0A 3HK1A 1Y53X 3C76X 4GE1A 1LCVA 4QZUA 4AZMA 1D2UA 2A8GA 4GDAA 4NW4A 1GM6A 3S5VA 4BVMA 3NBXX 3T6LA 1NQMA 2OVEA 4IB7A 3WJEA 5HTDA 3F8AA 1R0UA 3P24A 3P6EA 1KFFA 4YGHA 5HA0A 2CM4A 4EFGA 3T6FA 1RXJA 1WUBA 4FQBB 4NLJA 4OS0A 3D9WA 1YWAA 4GH7A 1TXLA 3CKFA 1EIOA 3WZOA 4GNWA 4DQ4A 3WJFA 3ELZA 3HPEA 3PEDA 4CPHB 5B27A 5B5FA 2P8GA 3I17A 3P6FA 5FQ6E 5KICA 2Q2PA 3VG7A 1SWTA 2RTNB 1SY1A 1LICA 3MVFA 4FGIB 4GKCA 5IO6A 2RCTA 2Y3EA 1O8VA 3T2WA 4O3XB 4ORUA 2RTAA 4AZQA 2RTPB 1JJUA 2OY1O 4ODDA 2JU3A 2X55A 3RKGA 1YP7A 1S44A 3FW5A 3G7XA 4COTA 3NX1A 2OFRX 3STMX 4ZGUA 1EPBA 3OJYC 2Y3FA 4YDBA 4MVEA 5HZ9A 2L67A 5EEDA 2F73A 2L68A 5AJBA 3FA6A 4YGZA 4AZRA 4LKTA 4QAEA 1VWGB 4CPIA 3VG3A 3KQ0A 1A57A 2MJIA 1LIEA 2RTOB 3F6ZB 1SWSA 1I9HA 3SAOA 3WBGA 4BX5B 1SLDB 3CWKA 5L8OA 5CHKA 2MF6A 1PBOA 1N7YA 2QCBA 2RTLA 1IIUA 4M7MA 1AVGI 1E00A 4OS3A 1KL3A 1OPBA 3QKGA 5HTEA 2C1SA 3ZQ3A 1FDQA 5LKEA 4HFOA 1MUPA 4GJSA 5B10O 4I3BA 1I4UA 3EMMA 3JSQA 4BGFA 3B2KA 2RTIB 5BYPA 1QY1A 3UEUA 1LKEA 4WFVA 4O3WA 3APWA 3S60A 3UEWA 1EIIA 2AT5X 2AF5A 1HQQA 1VYOA 4L3RA 2WUTA 3APXA 2A13A 1SWPA 2OL7A 3MG5A 4O4UA 2RQ0A 3DTQA 3JS1A 5IRUA 2IZCB 4BX7B 1SRFA 2IZDB 2IZLB 2A2UA 2I5ZO 1L6MA 3AKNA 1ZNKA 4I95A 3GAQA 2Q39A 3PQSA 5IRWA 4LKPA 3H3IA 3HTYA 5EEEA 5K68A 4GD9A 2OL8O 4IBAA 5FENA 3CQNA 2QO6A 1Y52X 2OVAA 2UZ2A 4OMWA 2OY5O 5LJKA 3WJBA 1LIBA 3RY1A 1S2PA 5HWZA 2GTLM 5F7GA 3NQ9A 1YP6A 3EYCA 3PH5A 2XKLA 5HZ5A 1SXXA 3SOTA 1LELA 4QYPA 5FFHA 3ZUIA 1DV9A 4XMFA 5B11O 2ZAGA 1LIFA 1B56A 4ZHHA 2GJ5A 4ZHDA 2M4LA 1MX7A 3PECA 4TNNA 4M6SA 2IFBA 2DJGA 2R74A 1E5PA 1QY0A 3HWGA 1IKJA 2X56A 4CSBA 4U9CA 1JYDA 1SWKA 2RTDB 1N9MA 5EPQA 1KZXA 4XMGA 2O62A 3TGAA 1HMSA 1HN2A 4O3YA 4NP1A 1STSB 4QNIA 2OF8A 1KT4A 1NP1A 2C4IA 3WYQA 3P6DA 1UYOX 3RZYA 3D96A 5HZ6A 4TQ2A 3HOLA 4MIRA 1N43A 1VWBB 1N9YA 4Z28A 4DQ3A 1OEJA 4CDFA 1VYFA 1X8NA 4O4OA 1TOWA 2RTMA 4BQUA 1SWCA 1ADLA 1ZNGA 2FWVA 2G79A 4AZOA 1UZ2X 1STRB 1OSPO 3N91A 1SWUA 4I3CA 2IZBA 5HZQA 2AT3X 1GKAB 1EALA 2HZQA 4Z2VA 2KW1A 2PI3O 4TKHA 1IJ8A 5KHPA 1GGLA 5CE4A 2LBAA 2CBRA 4OEMA 2RTGB 5LJCA 1GT4A 1X8QA 4NNTA 1MX8A 1VWAB 2WQ9A 1FELA 3BLGA 4WHIA 1AVDA 2RTQB 4BCSA 2CZTA 4NYQA 5H9NA 4YVBA 2A3FX 2ACPX 2HZRA 2NNDA 1FEMA 3K3LA 3RDQA 5HAEA 4TJZA 1RBPA 2LA7A 1QWDA 1UYNX 2Z4IA 3F9DA 1DZMA 2BHVA 1FE3A 4TKBA 1B8EA 3KFIA 4UU3A 3TZSA 1H91A 1N4JA 5L8IA 3APVA 4N7DA 1KGLA 5IRAA 3AKMA 3VGWA 4K19A 1VYGA 1IW2A 3FW4A 3SLTA 4U8UM 4ZH9A 4D6AA 2VFCA 1JIWI 1DZKA 1ERXA 4KH8A 5BVSA 3B2LA 5JR8A 5CSEA 1B4MA 4LZVA 3FA8A 2C1QA 3NX2A 1VWKB 1VWCB 4RUUA 3PDFA 4QGVA 4CV7A 1SRJA 3FELA 4MISA 1YWDA 1OBUA 3QQ2A 4I9RA 2A5BA 2X4MA 4GK9A 4O9SA 4XMCA 4YKOA 3RDXA 4B55A 1Y0GA 1KQXA 4FBOA 1SWRA 4XMHA 1BSYA 1T8VA 2FRSA 2WEWA 3RBYA 1SLGB 1X71A 2W2FA 3OE3A 5B29A 2RTRB 2BSZA 1JQPA 4BJ8A 1VPRA 3D95A 5BVQA 5AEOA 4ZHGA 1CBSA 1E2TA 1PM1X 3PPTA 4HPAA 2WQAE 2FR2A 2IZGB 3U03A 4KCAA 2HNXA 2PY1A 5HCDC 2AMMX 3FIDA 3ZW1A 4HPDA 1AELA 2DJFA 2FS6A 4ON1A 1YWCA 2AVIA 2X46A 3OD9A 1SLEB 4ZHFA 1I78A 1MM9A 4TKJA 1LPJA 3NQ3A 2QOMA 4C5PA 1X8OA 4ORYA 1SXYA 1BWYA 1SLFB 3VU1A 4KIIA 4HPCA 4Z6JA 3ZUOA 3WJDA 4CPFA 3VHMA 1JMZA 1LDOA 1SA8A 2MHDA 3HWFA 4HWMA 1VWRB 1CBQA 4IB9A 5IO7A 3RY2A 4ZR2A 3WZNA 1RAVA 1U17A 3APUA 1OEEA 3FMZA 3IFBA 3WZQA 1ICMA 2OFBA 3FR4A 1VWJB 1GT5A 3O22A 4YFQA 1LF7A 1QY2A 2I5VO 2NP1A 3LTWA 1SWGA 4CDDA 1B0OA 5CYBA 2QOSC 1JV4A 1Z24A 3B2JA 1O1VA 3IA8A 4GDZA 3GE2A 1I06A 2FTBA 2R73A 3VE1A 4U8UO 5FQ7E 2RTHB 1VWIB 5K67A 3NADA 4GJVA 1G5WA 1MVGA 1TOUA 2BC3A 2HLVA 3FDCA 3NQKA 4QGXA 1Y9LA 5AQ6A 1SRGA 5LJDA 4GU8A 4QZTA 1GT3A 2OVDA 3VG5A 1GT1A 1SMPI 5D48A 5L8NA 1OBPA 1KL4A 2WSJA 3WJCA 1BJ7A 1HY2A 3WXQA 4BX6A 1FJ1E 1KOIA 1SXUA 2BLGA 1KT5A 2IZIA 5LJHA 1JBHA 1G85A 3FLLA 4GGTA 3NR3A 4YBUA 1BSOA 1GX3A 1FENA 1SY0A 4QQ1A 2LB6A 4NV8A 2G5LA 3P6CA 4Y0SA 5D45A 2JU7A 4GETA 2X8SA 1IFCA 5EDCA 2EU7X 4CDEA 1EI5A 4GUZA 2FKGA 1XCAA 2MM3A 4OMXA 4Y0PA 4YCHA 1E02A 1VWPB 1YIVA 5H9LA 3AUMO 1ZRYA 1W5RA 4L1NA 2VDFA 3BU9A 3O19A 5HBSA 2BS5A 3S26A 1Y9TA 4NYRA 3B2IA 2FKJA 2QMIA 1E06A 4ZJ0A 2G78A 1MOYA 2RTEB 1S7DA 2IZAA 3BU1A 4BBOA 1PBYA 1Y55X 4INNA 3ZW2A 3KVNA 5DG4A 1K3BA 1KQWA 1GKAA 4JHQA 4YMYA 2YMSA 2XSTA 4OELA 1ZNDA 3RE6A 1RLBE 5LJGA 2QO5A 5IXGA 4Z2OA 1U0XA 3RDMA 1OEKA 1SWAA 2F01A 2KTDA 1VWNB 3BX8A 3EW2A 3ZW0B 4WBKA 2FHNX 1SWEA 2L5PA 3D97A 3KZAA 1HBQA 2X34A 4R0BA 2CAMA 2UYWA 1NC9A 2NNEA 1VWEB 3FR5A 2WWPA 1K24A 4NV7A 5F6ZA 1O1UA 3EW1A 2K62A 1SWQA 3OBLA 2WR6A 3RE5A 3KFGA 5LKFA 1DF3A 2NNQA 2GC9A 5KIDA 2ASNX 2OL6O 2HYSA 4MVLA 4NNSA 2F09A 4ALBA 1DF8A 2OFAA 1ALBA 3LHNA 4FBVA 5AJCA 3SZJA 2Y32A 2W2AA 3FEPA 1XKIA 1ICNA 4RUNA 3E3CA 4ORRA 3V8UA 4CPHA 2RA6A 2RTJA 1YUPA 5K06A 1JZUA 5H9AA 1SY2A 3SZIA 1U18A 1DC9A 3VG6A 4ZH6A 2GTFX 4U46A 1VWHB 1SXWA 1NDJA 2OY8A 4NLIA 4JO6A 4YCEA 3TGCA 1PMPA 2X8FA 1YWBA 5FAZA 4A1YA 2FHLA 2MO5A 1GXAA 3ZWEA 1LNMA 3S5XA 5L3YA 4MVKA 2G8CO 2AH7X 2JOZA 4EKVA 1IKEA 1NP4A 3KFHA 4OS8A 2RD7C 2WEXA 2QM9A 1MEPA 1FTPA 2RTCB 2GTLN 4A1HA 1GX8A 4IAXA 4YGGA 3HWEA 2N93A 1DFVA 1JMXA 2RTFB 4DNEA 2CZUA 4YFPA 3L4RA 1EPAA 1T0VA 3FYFA 5HA1A 1VWFB 3SZHA 5B3MO 1LFOA 5F1EA 1A2DA 4BX5A 5LJBA 1SRHA 2OFMX 3VG4A 4AZPA 5BVTA 1EQDA 1BM5A 4Z2PA 1VWOB 4IB8A 4PJ2A 4TLJA 4GZVA 4AYHA 2X45A 3WVMA 1QFTA 3CKGA 2Q9SA 2WPUA 4LZUA 5F6BA 4DCBA 4IB6A 3CQRA 4YFRA 1WBIA 3EM0A 2JGSA 3FEKA 2JMBA 5H8TA 3FR2A 3PQUA 4PSQA 3T2XA 1OBQA 4JNJA 3Q6LA 4ORXA 3VPJE 2IZEB 2MWHA 3HOEA 3CBCA 4Y0RA 4IAWA 4ZGFA 3P6GA 1ZNHA 4ORSA 5EZ2A 3VG2A 4O49A 2VFBA 4QRLA 2W2BA 5H9KA 3VE2A 3WZPA 3UEVA 2KD2A 4AZNA 3UAQA 3FIQA 4O4SA 3PP6A 3WOVA 4BX7A 1D3SA 3U0DA 1VWDB 2ACOA 1SWJA 2AT0X 2FGSA 4EEJA 1SWDA 1BEBA 4QGWA 1KT3A 2FT9A 2CM9A 2OF9A 2Q4NA 3BDRA 1I04A 4ALOA 1RSTB 2JU8A 4MEEA 4I9SA 5F2BA 4ZCBA 3PK2A 1BRQA 4I6SA 1KL5A 3NPOA 1I05A 1IFBA 2IZJA 2RCQA 2BS6A 4Y59A 4FBRA 4ZHCA 2FLJA 3AEHA 1CRBA 1P6PA 2A2GA 4MVIA 1RXHA 3Q34A 1BSQA 3FENA 2Q2MA 4LQZA 2KTSA 3RDUA 1SWFA 3D4RA 5IO5A 4O4XA 2AT6X 2ALLX 1LDQA 3O2YA 4N7CA 3ZW1B 1LCWA 2IZHB 4CDCA 2YG2A 2ZAIA 3RDSA 1LUQA 3U9PC 4Y0QA 2OY7A 3ELXA 3BSZE 3SLJA 3BS2A 3FA7A 2X32A 1A3YA 1ZNEA 1G74A 4U8UN 2POAA 3RWXA 2ZSCA 2HKDA 3CBSA 3UEXA 5FQ8E 1W4TA 5DPQA 3VHIA 3WYPA 1T68X 1HXZA 4EXZA 2X8TA 4GGRA 4U3QA 3KFFA 4I3DA 5HCCC 4YBPA 4IRWA 4KC8A 2AKQA 1SWBA 3P6HA 4UU2A 5EDBA 5F58A 3ZW0A 2BT9A 2Z4HA 1DZPA 1OPAA 1AVEA 2K23A 1QG5A 1X89A 1BLRA 5C0NA 2FR3A 2IZFB 4Y5DA 1EXSA 4O3ZA 1HMRA 3FA9A 1JYJA 3TGBA 3MX7A 4YH0A 4ARHA 2DM5A
chains in the Genus database with same CATH topology
4JGLA 2LBVA 1CJ5A 4ES7A 5HCEC 2RN4A 3ZZVA 3ZI8A 3STKA 4ORWA 1EUOA 1QQSA 4WFUA 2L9CA 3BRNA 3JQOA 1ERBA 3MBTA 1LIDA 2ANSA 4BOEA 3B2HA 4XMEA 2E4JA 4A8ZA 2G7BA 4ID2A 4D6BA 1A18A 2HMBA 3C78X 4AW8A 1JJJA 2CBSA 1HQPA 2LFOA 1G7NA 3C77X 3TF6A 3HWDA 4CK4A 1X8PA 1ACDA 1KT7A 3CMPA 2JN3A 3STNA 1KT6A 3T1DA 1ZNLA 3EBWA 3I0AA 1X8UA 1HBPA 1CBIA 1SY3A 2QO4A 4YDAA 3NP1A 1DZJA 1BBPA 1MDCA 4EDEA 1ML7A 4YKMA 4KT5A 1HMTA 4ZFXA 1EW3A 1UREA 4ML7B 5LJEA 2FS7A 2R56A 2JW1A 1CBRA 2AT8X 1AQBA 4QYNA 4XMDA 2OZQA 3RSWA 1KZWA 1JJXA 1QABE 3P02A 5D47A 2A0AA 4GRJA 3BX7A 1BRPA 3DSZA 1AB0A 3WJGA 4EQAC 2AL0X 4GNYA 4IABA 3BY0A 2OVSA 3PH6A 4HPBA 4IMNA 3CR6A 4KC7A 5D8JA 4IMOA 2LKKA 1NGLA 1DF3A 1GX9A 1KXOA 1TVQA 1PEEA 1TW4A 2KT4B 4A60A 1QFVA 1N0SA 2GTLO 3EBKA 3LV4A 4QZUA 3HK1A 3C76X 4GE1A 4AZMA 1D2UA 4NW4A 1GM6A 3S5VA 4BVMA 3NBXX 2OVEA 4IB7A 3WJEA 5HTDA 3F8AA 1R0UA 3P24A 3P6EA 4YGHA 5HA0A 2CM4A 4EFGA 4FQBB 4NLJA 4OS0A 1YWAA 4GH7A 1TXLA 1EIOA 4GNWA 4DQ4A 3WJFA 3ELZA 3PEDA 5B27A 2P8GA 3I17A 3P6FA 5FQ6E 5KICA 2Q2PA 3VG7A 1SY1A 1LICA 3MVFA 4FGIB 4GKCA 5IO6A 2RCTA 1O8VA 4O3XB 4ORUA 4AZQA 4ODDA 2JU3A 3RKGA 1YP7A 1S44A 3FW5A 3G7XA 4COTA 3NX1A 2OFRX 3STMX 4ZGUA 1EPBA 3OJYC 4YDBA 4MVEA 5HZ9A 2L67A 5EEDA 2F73A 2L68A 5AJBA 3FA6A 4YGZA 4AZRA 4LKTA 4QAEA 3VG3A 3KQ0A 1A57A 2MJIA 1LIEA 3WBGA 3F6ZB 3SAOA 3CWKA 5L8OA 5D4AA 1PBOA 4M7MA 1IIUA 5HTEA 1AVGI 1E00A 4OS3A 1OPBA 3QKGA 3ZQ3A 5LKEA 1FDQA 4HFOA 1MUPA 4I3BA 1I4UA 3EMMA 3JSQA 3B2KA 5BYPA 1QY1A 3UEUA 1LKEA 4WFVA 4O3WA 3APWA 3S60A 3UEWA 1EIIA 2AT5X 4L3RA 2WUTA 3APXA 2A13A 4O4UA 2RQ0A 3DTQA 3JS1A 2A2UA 1L6MA 3AKNA 1ZNKA 4I95A 3GAQA 2Q39A 3PQSA 4LKPA 3H3IA 3HTYA 5EEEA 4IBAA 5FENA 3CQNA 2QO6A 2OVAA 5LJKA 4OMWA 3WJBA 1LIBA 1S2PA 5HWZA 2GTLM 5F7GA 3NQ9A 1YP6A 3EYCA 3PH5A 2XKLA 5HZ5A 1SXXA 3SOTA 5FFHA 4QYPA 3ZUIA 1DV9A 4XMFA 2ZAGA 1LIFA 1B56A 4ZHHA 2GJ5A 4ZHDA 2M4LA 1MX7A 3PECA 4TNNA 4M6SA 2IFBA 2R74A 1E5PA 1QY0A 3HWGA 1IKJA 4CSBA 4U9CA 1JYDA 5EPQA 1KZXA 4XMGA 2O62A 3TGAA 1HMSA 1HN2A 4O3YA 4NP1A 4QNIA 1KT4A 1NP1A 3P6DA 3RZYA 3D96A 5HZ6A 4TQ2A 3HOLA 4MIRA 4DQ3A 1OEJA 1VYFA 1X8NA 4O4OA 1TOWA 4BQUA 1ZNGA 1ADLA 2G79A 2FWVA 4AZOA 1UZ2X 3N91A 5HZQA 4I3CA 2AT3X 1GKAB 1EALA 2HZQA 2KW1A 4TKHA 5KHPA 1GGLA 5CE4A 2LBAA 2CBRA 5LJCA 1GT4A 1X8QA 4NNTA 1MX8A 2WQ9A 1FELA 3BLGA 4WHIA 5HZ8A 2CZTA 4NYQA 5H9NA 5HAEA 2A3FX 2ACPX 2HZRA 2NNDA 1FEMA 3K3LA 4TJZA 1RBPA 2LA7A 1QWDA 2Z4IA 3F9DA 1DZMA 2BHVA 1FE3A 4TKBA 1B8EA 3KFIA 4UU3A 3TZSA 1H91A 5L8IA 3APVA 4N7DA 1KGLA 3AKMA 4K19A 1VYGA 1IW2A 3FW4A 4U8UM 4ZH9A 4D6AA 4KH8A 1JIWI 1DZKA 1ERXA 5BVSA 5JR8A 3B2LA 1B4MA 4LZVA 3FA8A 3NX2A 4RUUA 4QGVA 4CV7A 3FELA 4MISA 1YWDA 1OBUA 4I9RA 4YKOA 4O9SA 4XMCA 4GK9A 4FBOA 1KQXA 4XMHA 1BSYA 1T8VA 2FRSA 2WEWA 3RBYA 1X71A 2W2FA 3OE3A 5B29A 1VPRA 3D95A 5BVQA 5AEOA 4ZHGA 1CBSA 3PPTA 1PM1X 4HPAA 2WQAE 2FR2A 3U03A 4KCAA 2HNXA 2PY1A 5HCDC 2AMMX 1AELA 3ZW1A 4HPDA 2FS6A 4ON1A 1YWCA 2X46A 3OD9A 4ZHFA 4TKJA 1LPJA 3NQ3A 1X8OA 4ORYA 1SXYA 1BWYA 3VU1A 4KIIA 4HPCA 3ZUOA 3WJDA 1SA8A 4HWMA 2MHDA 3HWFA 1CBQA 4IB9A 5IO7A 4ZR2A 1U17A 3APUA 1OEEA 3FMZA 3IFBA 1ICMA 3FR4A 1GT5A 3O22A 4YFQA 1LF7A 1QY2A 2NP1A 1B0OA 5CYBA 2QOSC 1JV4A 1Z24A 3B2JA 1O1VA 3IA8A 4GDZA 3GE2A 1I06A 2FTBA 2R73A 3VE1A 4U8UO 5FQ7E 1G5WA 3NADA 1MVGA 1TOUA 3NQKA 2HLVA 4QGXA 5AQ6A 1Y9LA 5LJDA 4GU8A 4QZTA 1GT3A 2OVDA 3VG5A 1GT1A 1SMPI 5D48A 5L8NA 1OBPA 2WSJA 3WJCA 1BJ7A 3WXQA 1KOIA 1SXUA 2BLGA 1KT5A 5LJHA 1JBHA 1G85A 3FLLA 3NR3A 4YBUA 1BSOA 1FENA 1SY0A 4QQ1A 2LB6A 4Y0SA 3P6CA 5D45A 2JU7A 4GETA 2X8SA 1IFCA 5EDCA 2EU7X 1EI5A 4Y0PA 1XCAA 2MM3A 4OMXA 4YCHA 1E02A 1YIVA 5H9LA 1ZRYA 4L1NA 3BU9A 3O19A 5HBSA 2BS5A 3S26A 1Y9TA 4NYRA 3B2IA 2QMIA 1E06A 4ZJ0A 2G78A 1S7DA 3BU1A 4INNA 3ZW2A 5DG4A 1KQWA 1GKAA 4YMYA 2YMSA 2XSTA 1ZNDA 1RLBE 5LJGA 2QO5A 1U0XA 1OEKA 2KTDA 3ZW0B 3BX8A 4WBKA 2L5PA 3D97A 3KZAA 1HBQA 4R0BA 2NNEA 3FR5A 5F6ZA 2WWPA 1O1UA 3OBLA 2K62A 2WR6A 3KFGA 5LKFA 2NNQA 2GC9A 5KIDA 2ASNX 2HYSA 4MVLA 4NNSA 2F09A 4ALBA 4FBVA 1ALBA 3LHNA 5AJCA 2W2AA 3FEPA 1XKIA 1ICNA 4RUNA 3E3CA 4ORRA 3V8UA 2RA6A 5K06A 1YUPA 1JZUA 5H9AA 1SY2A 1U18A 1DC9A 3VG6A 4ZH6A 2GTFX 1SXWA 4NLIA 4YCEA 1PMPA 2X8FA 1YWBA 5FAZA 4A1YA 2MO5A 1GXAA 3ZWEA 1LNMA 3S5XA 4MVKA 2AH7X 2JOZA 1IKEA 1NP4A 3KFHA 4OS8A 2RD7C 2WEXA 2QM9A 1FTPA 2GTLN 4A1HA 1GX8A 4IAXA 4YGGA 3HWEA 2N93A 1DFVA 2CZUA 4YFPA 3L4RA 1EPAA 1T0VA 3FYFA 5HA1A 3TGCA 1LFOA 5F1EA 1A2DA 5LJBA 4AZPA 2OFMX 3VG4A 5BVTA 1BM5A 1EQDA 4IB8A 4PJ2A 4TLJA 4GZVA 4AYHA 2X45A 3WVMA 1QFTA 2Q9SA 4LZUA 5F6BA 4IB6A 3CQRA 4YFRA 3EM0A 3FEKA 2JMBA 5H8TA 3FR2A 3PQUA 4PSQA 1OBQA 4ORXA 3Q6LA 3VPJE 2MWHA 3HOEA 3CBCA 4Y0RA 4IAWA 4ZGFA 3P6GA 1ZNHA 4ORSA 5EZ2A 3VG2A 4O49A 4QRLA 2W2BA 5H9KA 3VE2A 4AZNA 3UEVA 2KD2A 3UAQA 3FIQA 4O4SA 3PP6A 3WOVA 1D3SA 3U0DA 2ACOA 2AT0X 4EEJA 1BEBA 4QGWA 1KT3A 2FT9A 2CM9A 2Q4NA 3BDRA 1I04A 4ALOA 2JU8A 4I9SA 4ZCBA 1BRQA 4I6SA 3NPOA 1I05A 1IFBA 2RCQA 2BS6A 4FBRA 4ZHCA 2FLJA 1CRBA 1P6PA 2A2GA 4MVIA 1BSQA 3FENA 2Q2MA 4LQZA 2KTSA 3D4RA 5IO5A 4O4XA 2AT6X 2ALLX 4N7CA 3O2YA 3ZW1B 2YG2A 2ZAIA 3U9PC 4Y0QA 3ELXA 3BSZE 3BS2A 3FA7A 1A3YA 1ZNEA 1G74A 4U8UN 2POAA 3RWXA 3CBSA 3UEXA 5FQ8E 5DPQA 1T68X 4EXZA 2X8TA 4U3QA 3KFFA 4I3DA 5HCCC 4YBPA 4KC8A 2AKQA 3P6HA 4UU2A 5EDBA 5F58A 3ZW0A 2BT9A 2Z4HA 1DZPA 1OPAA 2K23A 1QG5A 1X89A 1BLRA 5C0NA 2FR3A 1EXSA 4O3ZA 1HMRA 3FA9A 1JYJA 3TGBA 3MX7A 4YH0A 4ARHA 2DM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBV A;  1CJ5 A;  4ES7 A;  5HCE C;  3STK A;  4ORW A;  1EUO A;  1QQS A;  4WFU A;  2L9C A;  3BRN A;  3MBT A;  1ERB A;  1LID A;  2ANS A;  4BOE A;  3B2H A;  4XME A;  2E4J A;  4A8Z A;  2G7B A;  4D6B A;  1A18 A;  2HMB A;  3C78 X;  4AW8 A;  1JJJ A;  2CBS A;  1HQP A;  2LFO A;  1G7N A;  3C77 X;  3TF6 A;  3HWD A;  4CK4 A;  1X8P A;  1ACD A;  1KT7 A;  3CMP A;  2JN3 A;  3STN A;  1KT6 A;  3T1D A;  1ZNL A;  3EBW A;  3I0A A;  1X8U A;  1HBP A;  1CBI A;  1SY3 A;  2QO4 A;  4YDA A;  3NP1 A;  1DZJ A;  1BBP A;  1MDC A;  4EDE A;  1ML7 A;  4YKM A;  1HMT A;  4ZFX A;  1EW3 A;  1URE A;  5LJE A;  2FS7 A;  2R56 A;  1CBR A;  2AT8 X;  1AQB A;  4QYN A;  4XMD A;  2OZQ A;  3RSW A;  1KZW A;  1JJX A;  1QAB E;  5D47 A;  2A0A A;  4GRJ A;  3BX7 A;  1BRP A;  3DSZ A;  1AB0 A;  3WJG A;  2AL0 X;  4GNY A;  3BY0 A;  3PH6 A;  4HPB A;  4IMN A;  3CR6 A;  5D8J A;  4IMO A;  2LKK A;  1NGL A;  1DF3 A;  1GX9 A;  1KXO A;  1TVQ A;  1PEE A;  1TW4 A;  2KT4 B;  4A60 A;  1QFV A;  1N0S A;  3EBK A;  4QZU A;  3HK1 A;  3C76 X;  4GE1 A;  4AZM A;  1D2U A;  1GM6 A;  4BVM A;  2OVE A;  4IB7 A;  3WJE A;  5HTD A;  3F8A A;  1R0U A;  3P6E A;  4YGH A;  5HA0 A;  2CM4 A;  4EFG A;  4NLJ A;  4OS0 A;  1YWA A;  4GH7 A;  1TXL A;  1EIO A;  4GNW A;  4DQ4 A;  3WJF A;  3ELZ A;  3PED A;  5B27 A;  2P8G A;  3I17 A;  3P6F A;  5KIC A;  2Q2P A;  3VG7 A;  1SY1 A;  1LIC A;  3MVF A;  4GKC A;  5IO6 A;  2RCT A;  1O8V A;  4ORU A;  4AZQ A;  4ODD A;  2JU3 A;  1YP7 A;  1S44 A;  3FW5 A;  3G7X A;  3NX1 A;  2OFR X;  3STM X;  4ZGU A;  1EPB A;  3OJY C;  4YDB A;  5HZ9 A;  2L67 A;  5EED A;  2F73 A;  2L68 A;  3FA6 A;  4YGZ A;  4AZR A;  4LKT A;  4QAE A;  3VG3 A;  3KQ0 A;  1A57 A;  2MJI A;  1LIE A;  3WBG A;  3SAO A;  3CWK A;  5L8O A;  5D4A A;  1PBO A;  4M7M A;  1IIU A;  5HTE A;  1AVG I;  1E00 A;  4OS3 A;  1OPB A;  3QKG A;  3ZQ3 A;  5LKE A;  1FDQ A;  4HFO A;  1MUP A;  4I3B A;  1I4U A;  3EMM A;  3JSQ A;  3B2K A;  1QY1 A;  3UEU A;  1LKE A;  4WFV A;  3UEW A;  3APW A;  1EII A;  2AT5 X;  2WUT A;  3APX A;  2A13 A;  2RQ0 A;  3DTQ A;  3JS1 A;  2A2U A;  1L6M A;  3AKN A;  1ZNK A;  3GAQ A;  2Q39 A;  4LKP A;  5EEE A;  4IBA A;  5FEN A;  3CQN A;  2QO6 A;  2OVA A;  5LJK A;  4OMW A;  3WJB A;  1LIB A;  1S2P A;  5HWZ A;  5F7G A;  3NQ9 A;  1YP6 A;  3EYC A;  3PH5 A;  2XKL A;  5HZ5 A;  1SXX A;  5FFH A;  4QYP A;  3ZUI A;  1DV9 A;  4XMF A;  1LIF A;  1B56 A;  4ZHH A;  2GJ5 A;  4ZHD A;  1MX7 A;  3PEC A;  4TNN A;  4M6S A;  2IFB A;  2R74 A;  1E5P A;  1QY0 A;  3HWG A;  1IKJ A;  1JYD A;  5EPQ A;  1KZX A;  4XMG A;  2O62 A;  3TGA A;  1HMS A;  1HN2 A;  4NP1 A;  1KT4 A;  1NP1 A;  3P6D A;  3RZY A;  3D96 A;  5HZ6 A;  4TQ2 A;  4DQ3 A;  1OEJ A;  1VYF A;  1X8N A;  1TOW A;  4BQU A;  1ZNG A;  1ADL A;  2G79 A;  2FWV A;  4AZO A;  1UZ2 X;  5HZQ A;  4I3C A;  2AT3 X;  1GKA B;  1EAL A;  2HZQ A;  4TKH A;  5KHP A;  1GGL A;  5CE4 A;  2LBA A;  2CBR A;  5LJC A;  1GT4 A;  1X8Q A;  4NNT A;  1MX8 A;  2WQ9 A;  1FEL A;  3BLG A;  5HZ8 A;  2CZT A;  4NYQ A;  5H9N A;  5HAE A;  2A3F X;  2ACP X;  2HZR A;  2NND A;  1FEM A;  3K3L A;  4TJZ A;  1RBP A;  1QWD A;  3F9D A;  1DZM A;  1FE3 A;  4TKB A;  1B8E A;  3KFI A;  4UU3 A;  3TZS A;  1H91 A;  5L8I A;  3APV A;  4N7D A;  1KGL A;  3AKM A;  4K19 A;  1VYG A;  1IW2 A;  3FW4 A;  4ZH9 A;  4D6A A;  1DZK A;  1ERX A;  5BVS A;  5JR8 A;  3B2L A;  1B4M A;  4LZV A;  3FA8 A;  3NX2 A;  4RUU A;  4QGV A;  3FEL A;  1YWD A;  1OBU A;  4I9R A;  4YKO A;  4O9S A;  4XMC A;  1KQX A;  4XMH A;  1BSY A;  1T8V A;  2FRS A;  2WEW A;  1X71 A;  2W2F A;  5B29 A;  1VPR A;  3D95 A;  5BVQ A;  4ZHG A;  1CBS A;  3PPT A;  1PM1 X;  4HPA A;  2WQA E;  2FR2 A;  3U03 A;  5HCD C;  2HNX A;  2PY1 A;  1AEL A;  2AMM X;  4HPD A;  2FS6 A;  1YWC A;  2X46 A;  4ZHF A;  4TKJ A;  1LPJ A;  3NQ3 A;  1X8O A;  4ORY A;  1SXY A;  1BWY A;  4KII A;  4HPC A;  3ZUO A;  3WJD A;  1SA8 A;  3HWF A;  1CBQ A;  4IB9 A;  5IO7 A;  4ZR2 A;  1U17 A;  3APU A;  1OEE A;  3FMZ A;  3IFB A;  1ICM A;  3FR4 A;  1GT5 A;  3O22 A;  4YFQ A;  1LF7 A;  1QY2 A;  2NP1 A;  1B0O A;  2QOS C;  1JV4 A;  1Z24 A;  3B2J A;  1O1V A;  3IA8 A;  1I06 A;  2FTB A;  2R73 A;  1G5W A;  3NAD A;  1MVG A;  1TOU A;  2HLV A;  4QGX A;  5AQ6 A;  5LJD A;  4QZT A;  1GT3 A;  2OVD A;  3VG5 A;  1GT1 A;  5D48 A;  5L8N A;  1OBP A;  2WSJ A;  3WJC A;  1BJ7 A;  3WXQ A;  1KOI A;  1SXU A;  2BLG A;  1KT5 A;  5LJH A;  1JBH A;  1G85 A;  3FLL A;  3NR3 A;  4YBU A;  1BSO A;  1FEN A;  1SY0 A;  4Y0S A;  2LB6 A;  3P6C A;  5D45 A;  2JU7 A;  4GET A;  1IFC A;  5EDC A;  2EU7 X;  4Y0P A;  1XCA A;  2MM3 A;  4OMX A;  4YCH A;  1E02 A;  1YIV A;  5H9L A;  1ZRY A;  3BU9 A;  3O19 A;  5HBS A;  3S26 A;  4NYR A;  3B2I A;  1E06 A;  4ZJ0 A;  2G78 A;  1S7D A;  3BU1 A;  5DG4 A;  1KQW A;  1GKA A;  4YMY A;  2XST A;  1ZND A;  1RLB E;  5LJG A;  2QO5 A;  1U0X A;  1OEK A;  2KTD A;  3BX8 A;  4WBK A;  2L5P A;  3D97 A;  3KZA A;  1HBQ A;  4R0B A;  2NNE A;  3FR5 A;  5F6Z A;  2WWP A;  1O1U A;  2K62 A;  2WR6 A;  3KFG A;  5LKF A;  2NNQ A;  2GC9 A;  5KID A;  2ASN X;  2HYS A;  4MVL A;  4NNS A;  4ALB A;  1ALB A;  2W2A A;  3FEP A;  1XKI A;  1ICN A;  4RUN A;  4ORR A;  2RA6 A;  5K06 A;  1YUP A;  1JZU A;  5H9A A;  1SY2 A;  1U18 A;  1DC9 A;  3VG6 A;  4ZH6 A;  2GTF X;  1SXW A;  4NLI A;  4YCE A;  1PMP A;  1YWB A;  5FAZ A;  4A1Y A;  2MO5 A;  1GXA A;  1LNM A;  4MVK A;  2AH7 X;  2JOZ A;  1IKE A;  1NP4 A;  3KFH A;  4OS8 A;  2RD7 C;  2WEX A;  2QM9 A;  1FTP A;  4A1H A;  1GX8 A;  4IAX A;  4YGG A;  3HWE A;  2N93 A;  1DFV A;  2CZU A;  4YFP A;  3L4R A;  1EPA A;  1T0V A;  5HA1 A;  3TGC A;  1LFO A;  5F1E A;  1A2D A;  5LJB A;  4AZP A;  2OFM X;  3VG4 A;  5BVT A;  1BM5 A;  1EQD A;  4IB8 A;  4TLJ A;  4AYH A;  2X45 A;  3WVM A;  1QFT A;  2Q9S A;  4LZU A;  5F6B A;  4IB6 A;  3CQR A;  4YFR A;  3EM0 A;  3FEK A;  5H8T A;  3FR2 A;  4PSQ A;  1OBQ A;  4ORX A;  3Q6L A;  4Y0R A;  3CBC A;  4IAW A;  3P6G A;  1ZNH A;  4ORS A;  5EZ2 A;  3VG2 A;  2W2B A;  5H9K A;  4AZN A;  3UEV A;  3FIQ A;  3PP6 A;  1D3S A;  3U0D A;  2ACO A;  2AT0 X;  4EEJ A;  1BEB A;  4QGW A;  1KT3 A;  2FT9 A;  2CM9 A;  2Q4N A;  3BDR A;  1I04 A;  4ALO A;  2JU8 A;  4I9S A;  4ZCB A;  1BRQ A;  3NPO A;  1I05 A;  1IFB A;  2RCQ A;  4ZHC A;  2FLJ A;  1CRB A;  1P6P A;  2A2G A;  4MVI A;  1BSQ A;  3FEN A;  2Q2M A;  5IO5 A;  2AT6 X;  2ALL X;  4N7C A;  3O2Y A;  2YG2 A;  3U9P C;  4Y0Q A;  3ELX A;  3BSZ E;  3BS2 A;  3FA7 A;  1A3Y A;  1ZNE A;  1G74 A;  2POA A;  3CBS A;  3UEX A;  5DPQ A;  1T68 X;  4EXZ A;  3KFF A;  4I3D A;  5HCC C;  4YBP A;  2AKQ A;  3P6H A;  4UU2 A;  5EDB A;  5F58 A;  1DZP A;  1OPA A;  2K23 A;  1QG5 A;  1X89 A;  1BLR A;  5C0N A;  2FR3 A;  1EXS A;  1HMR A;  3FA9 A;  1JYJ A;  3TGB A;  4YH0 A;  4ARH A;  2DM5 A; 
#chains in the Genus database with same CATH topology
 4JGL A;  2LBV A;  1CJ5 A;  1NBX A;  2GH7 A;  4ES7 A;  5HCE C;  4I60 A;  2RN4 A;  2A5C A;  3ZI8 A;  3ZZV A;  3STK A;  4ORW A;  1EUO A;  1QQS A;  4WFU A;  2L9C A;  3VHH A;  3BRN A;  3JQO A;  1ERB A;  3MBT A;  1LID A;  2ANS A;  4BOE A;  3B2H A;  4BX6 B;  4XME A;  2E4J A;  4A8Z A;  2IZK A;  2G7B A;  4ID2 A;  4D6B A;  1A18 A;  2HMB A;  3C78 X;  1PTS A;  4AW8 A;  1JJJ A;  2CBS A;  1HQP A;  2LFO A;  1G7N A;  1VWM B;  4Z27 A;  3C77 X;  1NQN A;  3TF6 A;  3HWD A;  4CK4 A;  1X8P A;  1ACD A;  1KT7 A;  3CMP A;  2JN3 A;  3STN A;  1KT6 A;  2OYB O;  3T1D A;  1ZNL A;  3EBW A;  3I0A A;  1X8U A;  1HBP A;  1CBI A;  1MK5 A;  1SY3 A;  2QO4 A;  4YDA A;  3NP1 A;  3X00 A;  4CPE A;  1DZJ A;  1BBP A;  1LCZ A;  1MDC A;  3RDO A;  4EDE A;  1ML7 A;  4YKM A;  4KT5 A;  1HMT A;  4ZFX A;  1SWO A;  1SRI A;  1EW3 A;  3SLO A;  1URE A;  4ML7 B;  5LJE A;  5B5G A;  1VWQ B;  2FS7 A;  2R56 A;  2JW1 A;  4OKA A;  1CBR A;  2AT8 X;  1AQB A;  2RTB B;  4QYN A;  4XMD A;  2OZQ A;  5D4A A;  3RSW A;  1KZW A;  1RSU B;  1JJX A;  1QAB E;  1SWN A;  1STP A;  1VWL B;  2A0A A;  3P02 A;  4GRJ A;  5D47 A;  5JD2 A;  3BX7 A;  1BRP A;  1HXL A;  1W6F A;  1AB0 A;  3DSZ A;  3WJG A;  2AL0 X;  4EQA C;  4GGZ A;  4GNY A;  4IAB A;  3BY0 A;  2OVS A;  3PH6 A;  4HPB A;  4IMN A;  3CR6 A;  4KC7 A;  5D8J A;  4IMO A;  1RXK A;  1SWL A;  1NGL A;  2LKK A;  1GX9 A;  1SRE A;  1KXO A;  1SWH A;  1TVQ A;  2RTK A;  3EC5 A;  1TW4 A;  2KT4 B;  1PEE A;  1QFV A;  4A60 A;  1N0S A;  2GTL O;  5B2A O;  3EBK A;  5HZ8 A;  3LV4 A;  3MM0 A;  3HK1 A;  1Y53 X;  3C76 X;  4GE1 A;  1LCV A;  4QZU A;  4AZM A;  1D2U A;  2A8G A;  4GDA A;  4NW4 A;  1GM6 A;  3S5V A;  4BVM A;  3NBX X;  3T6L A;  1NQM A;  2OVE A;  4IB7 A;  3WJE A;  5HTD A;  3F8A A;  1R0U A;  3P24 A;  3P6E A;  1KFF A;  4YGH A;  5HA0 A;  2CM4 A;  4EFG A;  3T6F A;  1RXJ A;  1WUB A;  4FQB B;  4NLJ A;  4OS0 A;  3D9W A;  1YWA A;  4GH7 A;  1TXL A;  3CKF A;  1EIO A;  3WZO A;  4GNW A;  4DQ4 A;  3WJF A;  3ELZ A;  3HPE A;  3PED A;  4CPH B;  5B27 A;  5B5F A;  2P8G A;  3I17 A;  3P6F A;  5FQ6 E;  5KIC A;  2Q2P A;  3VG7 A;  1SWT A;  2RTN B;  1SY1 A;  1LIC A;  3MVF A;  4FGI B;  4GKC A;  5IO6 A;  2RCT A;  2Y3E A;  1O8V A;  3T2W A;  4O3X B;  4ORU A;  2RTA A;  4AZQ A;  2RTP B;  1JJU A;  2OY1 O;  4ODD A;  2JU3 A;  2X55 A;  3RKG A;  1YP7 A;  1S44 A;  3FW5 A;  3G7X A;  4COT A;  3NX1 A;  2OFR X;  3STM X;  4ZGU A;  1EPB A;  3OJY C;  2Y3F A;  4YDB A;  4MVE A;  5HZ9 A;  2L67 A;  5EED A;  2F73 A;  2L68 A;  5AJB A;  3FA6 A;  4YGZ A;  4AZR A;  4LKT A;  4QAE A;  1VWG B;  4CPI A;  3VG3 A;  3KQ0 A;  1A57 A;  2MJI A;  1LIE A;  2RTO B;  3F6Z B;  1SWS A;  1I9H A;  3SAO A;  3WBG A;  4BX5 B;  1SLD B;  3CWK A;  5L8O A;  5CHK A;  2MF6 A;  1PBO A;  1N7Y A;  2QCB A;  2RTL A;  1IIU A;  4M7M A;  1AVG I;  1E00 A;  4OS3 A;  1KL3 A;  1OPB A;  3QKG A;  5HTE A;  2C1S A;  3ZQ3 A;  1FDQ A;  5LKE A;  4HFO A;  1MUP A;  4GJS A;  5B10 O;  4I3B A;  1I4U A;  3EMM A;  3JSQ A;  4BGF A;  3B2K A;  2RTI B;  5BYP A;  1QY1 A;  3UEU A;  1LKE A;  4WFV A;  4O3W A;  3APW A;  3S60 A;  3UEW A;  1EII A;  2AT5 X;  2AF5 A;  1HQQ A;  1VYO A;  4L3R A;  2WUT A;  3APX A;  2A13 A;  1SWP A;  2OL7 A;  3MG5 A;  4O4U A;  2RQ0 A;  3DTQ A;  3JS1 A;  5IRU A;  2IZC B;  4BX7 B;  1SRF A;  2IZD B;  2IZL B;  2A2U A;  2I5Z O;  1L6M A;  3AKN A;  1ZNK A;  4I95 A;  3GAQ A;  2Q39 A;  3PQS A;  5IRW A;  4LKP A;  3H3I A;  3HTY A;  5EEE A;  5K68 A;  4GD9 A;  2OL8 O;  4IBA A;  5FEN A;  3CQN A;  2QO6 A;  1Y52 X;  2OVA A;  2UZ2 A;  4OMW A;  2OY5 O;  5LJK A;  3WJB A;  1LIB A;  3RY1 A;  1S2P A;  5HWZ A;  2GTL M;  5F7G A;  3NQ9 A;  1YP6 A;  3EYC A;  3PH5 A;  2XKL A;  5HZ5 A;  1SXX A;  3SOT A;  1LEL A;  4QYP A;  5FFH A;  3ZUI A;  1DV9 A;  4XMF A;  5B11 O;  2ZAG A;  1LIF A;  1B56 A;  4ZHH A;  2GJ5 A;  4ZHD A;  2M4L A;  1MX7 A;  3PEC A;  4TNN A;  4M6S A;  2IFB A;  2DJG A;  2R74 A;  1E5P A;  1QY0 A;  3HWG A;  1IKJ A;  2X56 A;  4CSB A;  4U9C A;  1JYD A;  1SWK A;  2RTD B;  1N9M A;  5EPQ A;  1KZX A;  4XMG A;  2O62 A;  3TGA A;  1HMS A;  1HN2 A;  4O3Y A;  4NP1 A;  1STS B;  4QNI A;  2OF8 A;  1KT4 A;  1NP1 A;  2C4I A;  3WYQ A;  3P6D A;  1UYO X;  3RZY A;  3D96 A;  5HZ6 A;  4TQ2 A;  3HOL A;  4MIR A;  1N43 A;  1VWB B;  1N9Y A;  4Z28 A;  4DQ3 A;  1OEJ A;  4CDF A;  1VYF A;  1X8N A;  4O4O A;  1TOW A;  2RTM A;  4BQU A;  1SWC A;  1ADL A;  1ZNG A;  2FWV A;  2G79 A;  4AZO A;  1UZ2 X;  1STR B;  1OSP O;  3N91 A;  1SWU A;  4I3C A;  2IZB A;  5HZQ A;  2AT3 X;  1GKA B;  1EAL A;  2HZQ A;  4Z2V A;  2KW1 A;  2PI3 O;  4TKH A;  1IJ8 A;  5KHP A;  1GGL A;  5CE4 A;  2LBA A;  2CBR A;  4OEM A;  2RTG B;  5LJC A;  1GT4 A;  1X8Q A;  4NNT A;  1MX8 A;  1VWA B;  2WQ9 A;  1FEL A;  3BLG A;  4WHI A;  1AVD A;  2RTQ B;  4BCS A;  2CZT A;  4NYQ A;  5H9N A;  4YVB A;  2A3F X;  2ACP X;  2HZR A;  2NND A;  1FEM A;  3K3L A;  3RDQ A;  5HAE A;  4TJZ A;  1RBP A;  2LA7 A;  1QWD A;  1UYN X;  2Z4I A;  3F9D A;  1DZM A;  2BHV A;  1FE3 A;  4TKB A;  1B8E A;  3KFI A;  4UU3 A;  3TZS A;  1H91 A;  1N4J A;  5L8I A;  3APV A;  4N7D A;  1KGL A;  5IRA A;  3AKM A;  3VGW A;  4K19 A;  1VYG A;  1IW2 A;  3FW4 A;  3SLT A;  4U8U M;  4ZH9 A;  4D6A A;  2VFC A;  1JIW I;  1DZK A;  1ERX A;  4KH8 A;  5BVS A;  3B2L A;  5JR8 A;  5CSE A;  1B4M A;  4LZV A;  3FA8 A;  2C1Q A;  3NX2 A;  1VWK B;  1VWC B;  4RUU A;  3PDF A;  4QGV A;  4CV7 A;  1SRJ A;  3FEL A;  4MIS A;  1YWD A;  1OBU A;  3QQ2 A;  4I9R A;  2A5B A;  2X4M A;  4GK9 A;  4O9S A;  4XMC A;  4YKO A;  3RDX A;  4B55 A;  1Y0G A;  1KQX A;  4FBO A;  1SWR A;  4XMH A;  1BSY A;  1T8V A;  2FRS A;  2WEW A;  3RBY A;  1SLG B;  1X71 A;  2W2F A;  3OE3 A;  5B29 A;  2RTR B;  2BSZ A;  1JQP A;  4BJ8 A;  1VPR A;  3D95 A;  5BVQ A;  5AEO A;  4ZHG A;  1CBS A;  1E2T A;  1PM1 X;  3PPT A;  4HPA A;  2WQA E;  2FR2 A;  2IZG B;  3U03 A;  4KCA A;  2HNX A;  2PY1 A;  5HCD C;  2AMM X;  3FID A;  3ZW1 A;  4HPD A;  1AEL A;  2DJF A;  2FS6 A;  4ON1 A;  1YWC A;  2AVI A;  2X46 A;  3OD9 A;  1SLE B;  4ZHF A;  1I78 A;  1MM9 A;  4TKJ A;  1LPJ A;  3NQ3 A;  2QOM A;  4C5P A;  1X8O A;  4ORY A;  1SXY A;  1BWY A;  1SLF B;  3VU1 A;  4KII A;  4HPC A;  4Z6J A;  3ZUO A;  3WJD A;  4CPF A;  3VHM A;  1JMZ A;  1LDO A;  1SA8 A;  2MHD A;  3HWF A;  4HWM A;  1VWR B;  1CBQ A;  4IB9 A;  5IO7 A;  3RY2 A;  4ZR2 A;  3WZN A;  1RAV A;  1U17 A;  3APU A;  1OEE A;  3FMZ A;  3IFB A;  3WZQ A;  1ICM A;  2OFB A;  3FR4 A;  1VWJ B;  1GT5 A;  3O22 A;  4YFQ A;  1LF7 A;  1QY2 A;  2I5V O;  2NP1 A;  3LTW A;  1SWG A;  4CDD A;  1B0O A;  5CYB A;  2QOS C;  1JV4 A;  1Z24 A;  3B2J A;  1O1V A;  3IA8 A;  4GDZ A;  3GE2 A;  1I06 A;  2FTB A;  2R73 A;  3VE1 A;  4U8U O;  5FQ7 E;  2RTH B;  1VWI B;  5K67 A;  3NAD A;  4GJV A;  1G5W A;  1MVG A;  1TOU A;  2BC3 A;  2HLV A;  3FDC A;  3NQK A;  4QGX A;  1Y9L A;  5AQ6 A;  1SRG A;  5LJD A;  4GU8 A;  4QZT A;  1GT3 A;  2OVD A;  3VG5 A;  1GT1 A;  1SMP I;  5D48 A;  5L8N A;  1OBP A;  1KL4 A;  2WSJ A;  3WJC A;  1BJ7 A;  1HY2 A;  3WXQ A;  4BX6 A;  1FJ1 E;  1KOI A;  1SXU A;  2BLG A;  1KT5 A;  2IZI A;  5LJH A;  1JBH A;  1G85 A;  3FLL A;  4GGT A;  3NR3 A;  4YBU A;  1BSO A;  1GX3 A;  1FEN A;  1SY0 A;  4QQ1 A;  2LB6 A;  4NV8 A;  2G5L A;  3P6C A;  4Y0S A;  5D45 A;  2JU7 A;  4GET A;  2X8S A;  1IFC A;  5EDC A;  2EU7 X;  4CDE A;  1EI5 A;  4GUZ A;  2FKG A;  1XCA A;  2MM3 A;  4OMX A;  4Y0P A;  4YCH A;  1E02 A;  1VWP B;  1YIV A;  5H9L A;  3AUM O;  1ZRY A;  1W5R A;  4L1N A;  2VDF A;  3BU9 A;  3O19 A;  5HBS A;  2BS5 A;  3S26 A;  1Y9T A;  4NYR A;  3B2I A;  2FKJ A;  2QMI A;  1E06 A;  4ZJ0 A;  2G78 A;  1MOY A;  2RTE B;  1S7D A;  2IZA A;  3BU1 A;  4BBO A;  1PBY A;  1Y55 X;  4INN A;  3ZW2 A;  3KVN A;  5DG4 A;  1K3B A;  1KQW A;  1GKA A;  4JHQ A;  4YMY A;  2YMS A;  2XST A;  4OEL A;  1ZND A;  3RE6 A;  1RLB E;  5LJG A;  2QO5 A;  5IXG A;  4Z2O A;  1U0X A;  3RDM A;  1OEK A;  1SWA A;  2F01 A;  2KTD A;  1VWN B;  3BX8 A;  3EW2 A;  3ZW0 B;  4WBK A;  2FHN X;  1SWE A;  2L5P A;  3D97 A;  3KZA A;  1HBQ A;  2X34 A;  4R0B A;  2CAM A;  2UYW A;  1NC9 A;  2NNE A;  1VWE B;  3FR5 A;  2WWP A;  1K24 A;  4NV7 A;  5F6Z A;  1O1U A;  3EW1 A;  2K62 A;  1SWQ A;  3OBL A;  2WR6 A;  3RE5 A;  3KFG A;  5LKF A;  1DF3 A;  2NNQ A;  2GC9 A;  5KID A;  2ASN X;  2OL6 O;  2HYS A;  4MVL A;  4NNS A;  2F09 A;  4ALB A;  1DF8 A;  2OFA A;  1ALB A;  3LHN A;  4FBV A;  5AJC A;  3SZJ A;  2Y32 A;  2W2A A;  3FEP A;  1XKI A;  1ICN A;  4RUN A;  3E3C A;  4ORR A;  3V8U A;  4CPH A;  2RA6 A;  2RTJ A;  1YUP A;  5K06 A;  1JZU A;  5H9A A;  1SY2 A;  3SZI A;  1U18 A;  1DC9 A;  3VG6 A;  4ZH6 A;  2GTF X;  4U46 A;  1VWH B;  1SXW A;  1NDJ A;  2OY8 A;  4NLI A;  4JO6 A;  4YCE A;  3TGC A;  1PMP A;  2X8F A;  1YWB A;  5FAZ A;  4A1Y A;  2FHL A;  2MO5 A;  1GXA A;  3ZWE A;  1LNM A;  3S5X A;  5L3Y A;  4MVK A;  2G8C O;  2AH7 X;  2JOZ A;  4EKV A;  1IKE A;  1NP4 A;  3KFH A;  4OS8 A;  2RD7 C;  2WEX A;  2QM9 A;  1MEP A;  1FTP A;  2RTC B;  2GTL N;  4A1H A;  1GX8 A;  4IAX A;  4YGG A;  3HWE A;  2N93 A;  1DFV A;  1JMX A;  2RTF B;  4DNE A;  2CZU A;  4YFP A;  3L4R A;  1EPA A;  1T0V A;  3FYF A;  5HA1 A;  1VWF B;  3SZH A;  5B3M O;  1LFO A;  5F1E A;  1A2D A;  4BX5 A;  5LJB A;  1SRH A;  2OFM X;  3VG4 A;  4AZP A;  5BVT A;  1EQD A;  1BM5 A;  4Z2P A;  1VWO B;  4IB8 A;  4PJ2 A;  4TLJ A;  4GZV A;  4AYH A;  2X45 A;  3WVM A;  1QFT A;  3CKG A;  2Q9S A;  2WPU A;  4LZU A;  5F6B A;  4DCB A;  4IB6 A;  3CQR A;  4YFR A;  1WBI A;  3EM0 A;  2JGS A;  3FEK A;  2JMB A;  5H8T A;  3FR2 A;  3PQU A;  4PSQ A;  3T2X A;  1OBQ A;  4JNJ A;  3Q6L A;  4ORX A;  3VPJ E;  2IZE B;  2MWH A;  3HOE A;  3CBC A;  4Y0R A;  4IAW A;  4ZGF A;  3P6G A;  1ZNH A;  4ORS A;  5EZ2 A;  3VG2 A;  4O49 A;  2VFB A;  4QRL A;  2W2B A;  5H9K A;  3VE2 A;  3WZP A;  3UEV A;  2KD2 A;  4AZN A;  3UAQ A;  3FIQ A;  4O4S A;  3PP6 A;  3WOV A;  4BX7 A;  1D3S A;  3U0D A;  1VWD B;  2ACO A;  1SWJ A;  2AT0 X;  2FGS A;  4EEJ A;  1SWD A;  1BEB A;  4QGW A;  1KT3 A;  2FT9 A;  2CM9 A;  2OF9 A;  2Q4N A;  3BDR A;  1I04 A;  4ALO A;  1RST B;  2JU8 A;  4MEE A;  4I9S A;  5F2B A;  4ZCB A;  3PK2 A;  1BRQ A;  4I6S A;  1KL5 A;  3NPO A;  1I05 A;  1IFB A;  2IZJ A;  2RCQ A;  2BS6 A;  4Y59 A;  4FBR A;  4ZHC A;  2FLJ A;  3AEH A;  1CRB A;  1P6P A;  2A2G A;  4MVI A;  1RXH A;  3Q34 A;  1BSQ A;  3FEN A;  2Q2M A;  4LQZ A;  2KTS A;  3RDU A;  1SWF A;  3D4R A;  5IO5 A;  4O4X A;  2AT6 X;  2ALL X;  1LDQ A;  3O2Y A;  4N7C A;  3ZW1 B;  1LCW A;  2IZH B;  4CDC A;  2YG2 A;  2ZAI A;  3RDS A;  1LUQ A;  3U9P C;  4Y0Q A;  2OY7 A;  3ELX A;  3BSZ E;  3SLJ A;  3BS2 A;  3FA7 A;  2X32 A;  1A3Y A;  1ZNE A;  1G74 A;  4U8U N;  2POA A;  3RWX A;  2ZSC A;  2HKD A;  3CBS A;  3UEX A;  5FQ8 E;  1W4T A;  5DPQ A;  3VHI A;  3WYP A;  1T68 X;  1HXZ A;  4EXZ A;  2X8T A;  4GGR A;  4U3Q A;  3KFF A;  4I3D A;  5HCC C;  4YBP A;  4IRW A;  4KC8 A;  2AKQ A;  1SWB A;  3P6H A;  4UU2 A;  5EDB A;  5F58 A;  3ZW0 A;  2BT9 A;  2Z4H A;  1DZP A;  1OPA A;  1AVE A;  2K23 A;  1QG5 A;  1X89 A;  1BLR A;  5C0N A;  2FR3 A;  2IZF B;  4Y5D A;  1EXS A;  4O3Z A;  1HMR A;  3FA9 A;  1JYJ A;  3TGB A;  3MX7 A;  4YH0 A;  4ARH A;  2DM5 A; 
#chains in the Genus database with same CATH homology
 4JGL A;  2LBV A;  1CJ5 A;  4ES7 A;  5HCE C;  2RN4 A;  3ZZV A;  3ZI8 A;  3STK A;  4ORW A;  1EUO A;  1QQS A;  4WFU A;  2L9C A;  3BRN A;  3JQO A;  1ERB A;  3MBT A;  1LID A;  2ANS A;  4BOE A;  3B2H A;  4XME A;  2E4J A;  4A8Z A;  2G7B A;  4ID2 A;  4D6B A;  1A18 A;  2HMB A;  3C78 X;  4AW8 A;  1JJJ A;  2CBS A;  1HQP A;  2LFO A;  1G7N A;  3C77 X;  3TF6 A;  3HWD A;  4CK4 A;  1X8P A;  1ACD A;  1KT7 A;  3CMP A;  2JN3 A;  3STN A;  1KT6 A;  3T1D A;  1ZNL A;  3EBW A;  3I0A A;  1X8U A;  1HBP A;  1CBI A;  1SY3 A;  2QO4 A;  4YDA A;  3NP1 A;  1DZJ A;  1BBP A;  1MDC A;  4EDE A;  1ML7 A;  4YKM A;  4KT5 A;  1HMT A;  4ZFX A;  1EW3 A;  1URE A;  4ML7 B;  5LJE A;  2FS7 A;  2R56 A;  2JW1 A;  1CBR A;  2AT8 X;  1AQB A;  4QYN A;  4XMD A;  2OZQ A;  3RSW A;  1KZW A;  1JJX A;  1QAB E;  3P02 A;  5D47 A;  2A0A A;  4GRJ A;  3BX7 A;  1BRP A;  3DSZ A;  1AB0 A;  3WJG A;  4EQA C;  2AL0 X;  4GNY A;  4IAB A;  3BY0 A;  2OVS A;  3PH6 A;  4HPB A;  4IMN A;  3CR6 A;  4KC7 A;  5D8J A;  4IMO A;  2LKK A;  1NGL A;  1DF3 A;  1GX9 A;  1KXO A;  1TVQ A;  1PEE A;  1TW4 A;  2KT4 B;  4A60 A;  1QFV A;  1N0S A;  2GTL O;  3EBK A;  3LV4 A;  4QZU A;  3HK1 A;  3C76 X;  4GE1 A;  4AZM A;  1D2U A;  4NW4 A;  1GM6 A;  3S5V A;  4BVM A;  3NBX X;  2OVE A;  4IB7 A;  3WJE A;  5HTD A;  3F8A A;  1R0U A;  3P24 A;  3P6E A;  4YGH A;  5HA0 A;  2CM4 A;  4EFG A;  4FQB B;  4NLJ A;  4OS0 A;  1YWA A;  4GH7 A;  1TXL A;  1EIO A;  4GNW A;  4DQ4 A;  3WJF A;  3ELZ A;  3PED A;  5B27 A;  2P8G A;  3I17 A;  3P6F A;  5FQ6 E;  5KIC A;  2Q2P A;  3VG7 A;  1SY1 A;  1LIC A;  3MVF A;  4FGI B;  4GKC A;  5IO6 A;  2RCT A;  1O8V A;  4O3X B;  4ORU A;  4AZQ A;  4ODD A;  2JU3 A;  3RKG A;  1YP7 A;  1S44 A;  3FW5 A;  3G7X A;  4COT A;  3NX1 A;  2OFR X;  3STM X;  4ZGU A;  1EPB A;  3OJY C;  4YDB A;  4MVE A;  5HZ9 A;  2L67 A;  5EED A;  2F73 A;  2L68 A;  5AJB A;  3FA6 A;  4YGZ A;  4AZR A;  4LKT A;  4QAE A;  3VG3 A;  3KQ0 A;  1A57 A;  2MJI A;  1LIE A;  3WBG A;  3F6Z B;  3SAO A;  3CWK A;  5L8O A;  5D4A A;  1PBO A;  4M7M A;  1IIU A;  5HTE A;  1AVG I;  1E00 A;  4OS3 A;  1OPB A;  3QKG A;  3ZQ3 A;  5LKE A;  1FDQ A;  4HFO A;  1MUP A;  4I3B A;  1I4U A;  3EMM A;  3JSQ A;  3B2K A;  5BYP A;  1QY1 A;  3UEU A;  1LKE A;  4WFV A;  4O3W A;  3APW A;  3S60 A;  3UEW A;  1EII A;  2AT5 X;  4L3R A;  2WUT A;  3APX A;  2A13 A;  4O4U A;  2RQ0 A;  3DTQ A;  3JS1 A;  2A2U A;  1L6M A;  3AKN A;  1ZNK A;  4I95 A;  3GAQ A;  2Q39 A;  3PQS A;  4LKP A;  3H3I A;  3HTY A;  5EEE A;  4IBA A;  5FEN A;  3CQN A;  2QO6 A;  2OVA A;  5LJK A;  4OMW A;  3WJB A;  1LIB A;  1S2P A;  5HWZ A;  2GTL M;  5F7G A;  3NQ9 A;  1YP6 A;  3EYC A;  3PH5 A;  2XKL A;  5HZ5 A;  1SXX A;  3SOT A;  5FFH A;  4QYP A;  3ZUI A;  1DV9 A;  4XMF A;  2ZAG A;  1LIF A;  1B56 A;  4ZHH A;  2GJ5 A;  4ZHD A;  2M4L A;  1MX7 A;  3PEC A;  4TNN A;  4M6S A;  2IFB A;  2R74 A;  1E5P A;  1QY0 A;  3HWG A;  1IKJ A;  4CSB A;  4U9C A;  1JYD A;  5EPQ A;  1KZX A;  4XMG A;  2O62 A;  3TGA A;  1HMS A;  1HN2 A;  4O3Y A;  4NP1 A;  4QNI A;  1KT4 A;  1NP1 A;  3P6D A;  3RZY A;  3D96 A;  5HZ6 A;  4TQ2 A;  3HOL A;  4MIR A;  4DQ3 A;  1OEJ A;  1VYF A;  1X8N A;  4O4O A;  1TOW A;  4BQU A;  1ZNG A;  1ADL A;  2G79 A;  2FWV A;  4AZO A;  1UZ2 X;  3N91 A;  5HZQ A;  4I3C A;  2AT3 X;  1GKA B;  1EAL A;  2HZQ A;  2KW1 A;  4TKH A;  5KHP A;  1GGL A;  5CE4 A;  2LBA A;  2CBR A;  5LJC A;  1GT4 A;  1X8Q A;  4NNT A;  1MX8 A;  2WQ9 A;  1FEL A;  3BLG A;  4WHI A;  5HZ8 A;  2CZT A;  4NYQ A;  5H9N A;  5HAE A;  2A3F X;  2ACP X;  2HZR A;  2NND A;  1FEM A;  3K3L A;  4TJZ A;  1RBP A;  2LA7 A;  1QWD A;  2Z4I A;  3F9D A;  1DZM A;  2BHV A;  1FE3 A;  4TKB A;  1B8E A;  3KFI A;  4UU3 A;  3TZS A;  1H91 A;  5L8I A;  3APV A;  4N7D A;  1KGL A;  3AKM A;  4K19 A;  1VYG A;  1IW2 A;  3FW4 A;  4U8U M;  4ZH9 A;  4D6A A;  4KH8 A;  1JIW I;  1DZK A;  1ERX A;  5BVS A;  5JR8 A;  3B2L A;  1B4M A;  4LZV A;  3FA8 A;  3NX2 A;  4RUU A;  4QGV A;  4CV7 A;  3FEL A;  4MIS A;  1YWD A;  1OBU A;  4I9R A;  4YKO A;  4O9S A;  4XMC A;  4GK9 A;  4FBO A;  1KQX A;  4XMH A;  1BSY A;  1T8V A;  2FRS A;  2WEW A;  3RBY A;  1X71 A;  2W2F A;  3OE3 A;  5B29 A;  1VPR A;  3D95 A;  5BVQ A;  5AEO A;  4ZHG A;  1CBS A;  3PPT A;  1PM1 X;  4HPA A;  2WQA E;  2FR2 A;  3U03 A;  4KCA A;  2HNX A;  2PY1 A;  5HCD C;  2AMM X;  1AEL A;  3ZW1 A;  4HPD A;  2FS6 A;  4ON1 A;  1YWC A;  2X46 A;  3OD9 A;  4ZHF A;  4TKJ A;  1LPJ A;  3NQ3 A;  1X8O A;  4ORY A;  1SXY A;  1BWY A;  3VU1 A;  4KII A;  4HPC A;  3ZUO A;  3WJD A;  1SA8 A;  4HWM A;  2MHD A;  3HWF A;  1CBQ A;  4IB9 A;  5IO7 A;  4ZR2 A;  1U17 A;  3APU A;  1OEE A;  3FMZ A;  3IFB A;  1ICM A;  3FR4 A;  1GT5 A;  3O22 A;  4YFQ A;  1LF7 A;  1QY2 A;  2NP1 A;  1B0O A;  5CYB A;  2QOS C;  1JV4 A;  1Z24 A;  3B2J A;  1O1V A;  3IA8 A;  4GDZ A;  3GE2 A;  1I06 A;  2FTB A;  2R73 A;  3VE1 A;  4U8U O;  5FQ7 E;  1G5W A;  3NAD A;  1MVG A;  1TOU A;  3NQK A;  2HLV A;  4QGX A;  5AQ6 A;  1Y9L A;  5LJD A;  4GU8 A;  4QZT A;  1GT3 A;  2OVD A;  3VG5 A;  1GT1 A;  1SMP I;  5D48 A;  5L8N A;  1OBP A;  2WSJ A;  3WJC A;  1BJ7 A;  3WXQ A;  1KOI A;  1SXU A;  2BLG A;  1KT5 A;  5LJH A;  1JBH A;  1G85 A;  3FLL A;  3NR3 A;  4YBU A;  1BSO A;  1FEN A;  1SY0 A;  4QQ1 A;  2LB6 A;  4Y0S A;  3P6C A;  5D45 A;  2JU7 A;  4GET A;  2X8S A;  1IFC A;  5EDC A;  2EU7 X;  1EI5 A;  4Y0P A;  1XCA A;  2MM3 A;  4OMX A;  4YCH A;  1E02 A;  1YIV A;  5H9L A;  1ZRY A;  4L1N A;  3BU9 A;  3O19 A;  5HBS A;  2BS5 A;  3S26 A;  1Y9T A;  4NYR A;  3B2I A;  2QMI A;  1E06 A;  4ZJ0 A;  2G78 A;  1S7D A;  3BU1 A;  4INN A;  3ZW2 A;  5DG4 A;  1KQW A;  1GKA A;  4YMY A;  2YMS A;  2XST A;  1ZND A;  1RLB E;  5LJG A;  2QO5 A;  1U0X A;  1OEK A;  2KTD A;  3ZW0 B;  3BX8 A;  4WBK A;  2L5P A;  3D97 A;  3KZA A;  1HBQ A;  4R0B A;  2NNE A;  3FR5 A;  5F6Z A;  2WWP A;  1O1U A;  3OBL A;  2K62 A;  2WR6 A;  3KFG A;  5LKF A;  2NNQ A;  2GC9 A;  5KID A;  2ASN X;  2HYS A;  4MVL A;  4NNS A;  2F09 A;  4ALB A;  4FBV A;  1ALB A;  3LHN A;  5AJC A;  2W2A A;  3FEP A;  1XKI A;  1ICN A;  4RUN A;  3E3C A;  4ORR A;  3V8U A;  2RA6 A;  5K06 A;  1YUP A;  1JZU A;  5H9A A;  1SY2 A;  1U18 A;  1DC9 A;  3VG6 A;  4ZH6 A;  2GTF X;  1SXW A;  4NLI A;  4YCE A;  1PMP A;  2X8F A;  1YWB A;  5FAZ A;  4A1Y A;  2MO5 A;  1GXA A;  3ZWE A;  1LNM A;  3S5X A;  4MVK A;  2AH7 X;  2JOZ A;  1IKE A;  1NP4 A;  3KFH A;  4OS8 A;  2RD7 C;  2WEX A;  2QM9 A;  1FTP A;  2GTL N;  4A1H A;  1GX8 A;  4IAX A;  4YGG A;  3HWE A;  2N93 A;  1DFV A;  2CZU A;  4YFP A;  3L4R A;  1EPA A;  1T0V A;  3FYF A;  5HA1 A;  3TGC A;  1LFO A;  5F1E A;  1A2D A;  5LJB A;  4AZP A;  2OFM X;  3VG4 A;  5BVT A;  1BM5 A;  1EQD A;  4IB8 A;  4PJ2 A;  4TLJ A;  4GZV A;  4AYH A;  2X45 A;  3WVM A;  1QFT A;  2Q9S A;  4LZU A;  5F6B A;  4IB6 A;  3CQR A;  4YFR A;  3EM0 A;  3FEK A;  2JMB A;  5H8T A;  3FR2 A;  3PQU A;  4PSQ A;  1OBQ A;  4ORX A;  3Q6L A;  3VPJ E;  2MWH A;  3HOE A;  3CBC A;  4Y0R A;  4IAW A;  4ZGF A;  3P6G A;  1ZNH A;  4ORS A;  5EZ2 A;  3VG2 A;  4O49 A;  4QRL A;  2W2B A;  5H9K A;  3VE2 A;  4AZN A;  3UEV A;  2KD2 A;  3UAQ A;  3FIQ A;  4O4S A;  3PP6 A;  3WOV A;  1D3S A;  3U0D A;  2ACO A;  2AT0 X;  4EEJ A;  1BEB A;  4QGW A;  1KT3 A;  2FT9 A;  2CM9 A;  2Q4N A;  3BDR A;  1I04 A;  4ALO A;  2JU8 A;  4I9S A;  4ZCB A;  1BRQ A;  4I6S A;  3NPO A;  1I05 A;  1IFB A;  2RCQ A;  2BS6 A;  4FBR A;  4ZHC A;  2FLJ A;  1CRB A;  1P6P A;  2A2G A;  4MVI A;  1BSQ A;  3FEN A;  2Q2M A;  4LQZ A;  2KTS A;  3D4R A;  5IO5 A;  4O4X A;  2AT6 X;  2ALL X;  4N7C A;  3O2Y A;  3ZW1 B;  2YG2 A;  2ZAI A;  3U9P C;  4Y0Q A;  3ELX A;  3BSZ E;  3BS2 A;  3FA7 A;  1A3Y A;  1ZNE A;  1G74 A;  4U8U N;  2POA A;  3RWX A;  3CBS A;  3UEX A;  5FQ8 E;  5DPQ A;  1T68 X;  4EXZ A;  2X8T A;  4U3Q A;  3KFF A;  4I3D A;  5HCC C;  4YBP A;  4KC8 A;  2AKQ A;  3P6H A;  4UU2 A;  5EDB A;  5F58 A;  3ZW0 A;  2BT9 A;  2Z4H A;  1DZP A;  1OPA A;  2K23 A;  1QG5 A;  1X89 A;  1BLR A;  5C0N A;  2FR3 A;  1EXS A;  4O3Z A;  1HMR A;  3FA9 A;  1JYJ A;  3TGB A;  3MX7 A;  4YH0 A;  4ARH A;  2DM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...