1EALA

Nmr study of ileal lipid binding protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
127
structure length
127
Chain Sequence
AFTGKYEIESEKNYDEFMKRLALPSDAIDKARNLKIISEVKQDGQNFTWSQQYPGGHSITNTFTIGKECDIETIGGKKFKATVQMEGGKVVVNSPNYHHTAEIVDGKLVEVSTVGGVSYERVSKKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fatty acid binding protein
molecule keywords ILEAL LIPID BINDING PROTEIN
publication title Flexibility is a likely determinant of binding specificity in the case of ileal lipid binding protein.
pubmed doi rcsb
source organism Sus scrofa
total genus 17
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 1996-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1ealA00
3FEKA 1JBHA 5HAEA 1YWAA 1AQBA 3BRNA 4TKBA 4GETA 2ACPX 4AZQA 3O22A 3U0DA 5EPQA 1OEEA 3GAQA 4IB6A 4ORXA 3PECA 4NLIA 5D4AA 1JYJA 1HN2A 5HZ6A 2HNXA 2JOZA 3FIQA 1X8OA 3TZSA 5LJHA 1BSOA 1S7DA 3BSZE 3I17A 4QZUA 3C78X 5BVQA 3EMMA 1CJ5A 1ZNEA 1OEJA 2BLGA 4ZFXA 1H91A 5HCDC 4EEJA 1KXOA 2POAA 1KQWA 1KT4A 1DZKA 2OVDA 4Y0SA 1MX7A 5H9AA 5LJCA 5B29A 2GC9A 5B27A 1X8NA 5FFHA 1CBQA 4IAWA 5LKFA 3OJYC 1CBSA 1KT6A 1ZNGA 2LBVA 1U0XA 1KGLA 5F6ZA 2LKKA 1TXLA 1R0UA 3BU1A 1MUPA 4QGWA 4TLJA 1QFVA 2K23A 4ZHCA 5LJKA 1JJXA 5H9KA 5HTEA 3HWEA 3FA9A 4BOEA 1HMTA 4Y0QA 2FR2A 2JN3A 5EZ2A 1JV4A 1MVGA 1SXXA 2HYSA 5HTDA 2FS6A 5KHPA 2WQ9A 2FT9A 3CQNA 1YP7A 1BEBA 2CZUA 2RD7C 3PH6A 1AB0A 4A8ZA 1ADLA 5HCCC 2AH7X 1KZWA 3KFHA 5D45A 4YKOA 3SAOA 3ZUOA 4YKMA 1A57A 3U03A 1ML7A 2HMBA 3AKMA 4QYPA 4R0BA 5JR8A 5F6BA 5K06A 1T8VA 2OVEA 4I3BA 3KZAA 1EPAA 4QGXA 4AZRA 3B2KA 3Q6LA 3WBGA 4I9RA 4HPDA 4DQ4A 4GH7A 1GM6A 3ELZA 1IW2A 1LIEA 1JYDA 4TQ2A 3B2IA 4YMYA 2AT6X 1EIOA 4ZH6A 1DFVA 1B56A 4ORSA 1X8UA 3JS1A 4DQ3A 1KT5A 2NNEA 4QYNA 4ORWA 1T68X 1HBQA 3RSWA 2XSTA 3UEXA 5D8JA 1NGLA 1PMPA 1BWYA 1GX9A 5KIDA 1QQSA 1LIDA 1LF7A 3BY0A 2L68A 4NYQA 1X71A 2KT4B 2P8GA 1ALBA 3FW4A 3PEDA 1U18A 4ZH9A 3STKA 2CBSA 4GE1A 2AT3X 4BQUA 3F9DA 2X46A 1SY0A 3HWFA 2KTDA 1I04A 2AT8X 1FELA 1KT3A 4WFVA 3BLGA 5AQ6A 5IO6A 1IFCA 1JJJA 2CM9A 1LKEA 4XMHA 5HCEC 3UEUA 5H9LA 5IO5A 4QGVA 1PBOA 1QY0A 3CR6A 2L9CA 4RUNA 1CBRA 4ZCBA 5FAZA 2OFMX 3BU9A 1X8QA 4EFGA 3TF6A 3CMPA 1N0SA 3CQRA 4AZOA 3KFIA 1YWCA 2QOSC 3D95A 1T0VA 2RQ0A 4CK4A 2A13A 1DZPA 3NX2A 3DTQA 3FENA 3BDRA 4PSQA 2WSJA 3WJEA 3NADA 2Q9SA 1AVGI 1SXWA 4YFRA 3APVA 1LFOA 4YCHA 5F7GA 2W2BA 1U17A 3NPOA 1GKAA 3WVMA 3APUA 4TJZA 1DV9A 3B2LA 3NR3A 2CBRA 4LZUA 1QABE 2LFOA 1EXSA 4GRJA 1TOUA 2AT5X 3WJFA 4QAEA 4ES7A 1OEKA 1SXUA 1FEMA 3FA8A 3MVFA 1YUPA 3APWA 3FR2A 4KIIA 5HA0A 4ZGUA 1LICA 4HPAA 4K19A 2Q2MA 1MX8A 4WBKA 1BRPA 3UEWA 1EIIA 2A3FX 2R73A 3NP1A 1IKEA 4GKCA 1IKJA 2RA6A 2WQAE 2X45A 4RUUA 2IFBA 1JZUA 2K62A 3AKNA 5LKEA 1OBPA 4ORRA 3QKGA 1VYGA 2Q4NA 2ANSA 3WJGA 1ZNDA 1P6PA 4N7DA 4YGHA 2WEXA 4M7MA 3FLLA 2A2UA 4OMWA 3P6HA 3CBCA 3HK1A 1FTPA 4A60A 1IIUA 4MVIA 2FS7A 1DF3A 1QWDA 1O1UA 1QY1A 2MJIA 1ERBA 1KZXA 1E06A 3EBKA 3FMZA 4I9SA 1B4MA 2MM3A 1DZJA 1EPBA 2DM5A 1OBQA 1HBPA 1GKAB 1QFTA 2OVAA 4ZHHA 1B0OA 5EDBA 3IFBA 4IB9A 2A2GA 5F1EA 3FEPA 1VPRA 2FR3A 3B2JA 3BX8A 1ACDA 1BLRA 4D6BA 1SY3A 2ACOA 4EXZA 1KOIA 2LBAA 1BRQA 4M6SA 5LJBA 1I06A 2HZRA 4NP1A 5L8IA 4ALOA 1AELA 4YCEA 1X8PA 3L4RA 5BVSA 4MVKA 1G5WA 2GJ5A 2N93A 2AL0X 1QY2A 1BM5A 3WJDA 1VYFA 1EQDA 4ZHDA 1KQXA 1OPBA 3PP6A 3UEVA 1OBUA 1E02A 2EU7X 1O1VA 4ALBA 1LIFA 1EUOA 1RLBE 2JU7A 5EDCA 5LJGA 2L5PA 2FTBA 4LKTA 1LNMA 5D48A 5IO7A 3ZUIA 2E4JA 3EM0A 3G7XA 5HWZA 5HZ8A 3KQ0A 4UU2A 3P6GA 4OS3A 3NQ9A 1GT1A 2JU3A 1BSYA 1FE3A 3BX7A 5F58A 1GT5A 1ICNA 2HZQA 1EALA 3C76X 4AZPA 1I05A 3CBSA 5LJDA 1FENA 3O19A 1D3SA 4EDEA 3VG7A 1ERXA 4A1YA 4XMEA 3TGCA 2LB6A 3S26A 4N7CA 3K3LA 1GGLA 3VG6A 2ASNX 1ZRYA 4QZTA 3P6FA 2YG2A 4YBUA 1YWDA 4ORYA 4AZMA 3STMX 4I3CA 5CE4A 2RCQA 1ZNHA 5LJEA 4XMDA 1LPJA 2A0AA 5C0NA 4YH0A 3JSQA 2OZQA 1TVQA 5HBSA 3NX1A 1TOWA 3WJBA 1A3YA 5HZQA 2NNQA 1G74A 2JU8A 5H9NA 2FWVA 2F73A 3RZYA 3TGBA 4YGGA 4YDBA 3VG2A 4UU3A 1HMSA 3T1DA 1RBPA 2AT0X 3P6EA 4BVMA 1HQPA 4YFPA 2W2AA 2G78A 4IB7A 4I3DA 4YBPA 4IMNA 4IB8A 4Y0RA 4AW8A 4D6AA 3ZQ3A 3I0AA 2ALLX 4OS8A 1GX8A 4TNNA 3WJCA 4ODDA 4GNYA 2NP1A 3D96A 5D47A 4YGZA 1UZ2X 5HA1A 2WWPA 1YWBA 3FA6A 1XCAA 4ZJ0A 4OS0A 2GTFX 3HWDA 4YDAA 4ORUA 4ARHA 1EW3A 2FLJA 3PH5A 2O62A 2PY1A 3WXQA 5KICA 2CZTA 3D97A 3KFGA 2XKLA 1FDQA 1PM1X 2HLVA 1GXAA 4GNWA 2RCTA 4HFOA 2Q39A 4MVLA 4NLJA 3EBWA 2CM4A 1A2DA 3FR4A 2W2FA 4IMOA 3APXA 4ZHFA 2QO6A 5L8NA 5L8OA 1G85A 1QG5A 5DPQA 1CRBA 4XMCA 3PPTA 4LKPA 3FA7A 3FELA 1OPAA 1PEEA 4XMGA 1ZNLA 1BSQA 4YFQA 2QO4A 1E5PA 3HWGA 1NP1A 1YP6A 4NNSA 5HZ9A 4AZNA 1XKIA 3TGAA 1BJ7A 1YIVA 2G79A 4OMXA 4A1HA 4AYHA 1Z24A 3P6CA 4NNTA 2AKQA 3STNA 3DSZA 5EEDA 1L6MA 5BVTA 3C77X 2MO5A 1MDCA 1DC9A 1DZMA 3F8AA 3VG3A 1BBPA 2AMMX 4ZHGA 4Y0PA 4HPCA 1D2UA 2NNDA 1ICMA 3EYCA 3FW5A 2WEWA 3IA8A 1UREA 1B8EA 1SY2A 1LIBA 3CWKA 1G7NA 1SA8A 3O2YA 1IFBA 2OFRX 4IAXA 1O8VA 3FR5A 2R56A 3P6DA 4TKJA 1CBIA 4TKHA 3BS2A 3B2HA 3KFFA 4O9SA 1I4UA 1E00A 2WR6A 4XMFA 3ELXA 4WFUA 2QO5A 3MBTA 4NYRA 4ZR2A 4IBAA 5DG4A 2R74A 3U9PC 3VG5A 3NQ3A 5EEEA 2FRSA 5H8TA 1S44A 2QM9A 1SY1A 2G7BA 1X89A 4HPBA 1S2PA 5FENA 1GT3A 2L67A 2WUTA 5HZ5A 1HMRA 3VG4A 1SXYA 1TW4A 1ZNKA 1A18A 1NP4A 4LZVA 2Q2PA 1GT4A 1KT7A
chains in the Genus database with same CATH superfamily
1LDOA 2OF9A 3FEKA 3HOEA 1SWNA 5HAEA 3SLJA 1JBHA 2RTRB 1YWAA 1AQBA 1LDQA 3BRNA 3RDMA 4GETA 4TKBA 3JQOA 2ACPX 4AZQA 2GH7A 1SWJA 3O22A 4O4UA 5EPQA 3U0DA 1OEEA 3GAQA 4IB6A 4ORXA 2BSZA 3PECA 4NLIA 5D4AA 1JYJA 1JJUA 5BYPA 1HN2A 1SWAA 2OFAA 5HZ6A 1JIWI 2HNXA 2JOZA 3FIQA 3PQUA 4IRWA 4CPIA 1X8OA 3TZSA 5LJHA 1I78A 3ZI8A 1BSOA 1S7DA 3BSZE 3I17A 1AVDA 3PK2A 4QZUA 4Z2OA 3C78X 4JNJA 3EW1A 4WHIA 3EMMA 5BVQA 4CPHA 1ZNEA 1OEJA 2BLGA 2X8FA 4ZFXA 1CJ5A 1H91A 5HCDC 4EEJA 1KXOA 2POAA 1KQWA 3PDFA 1KT4A 1DZKA 2OVDA 4Y0SA 1SWKA 4U8UO 1MX7A 5H9AA 2G8CO 5LJCA 2OY7A 5B29A 2GC9A 5B27A 1X8NA 5FFHA 3SZJA 1CBQA 4IAWA 5LKFA 3FDCA 3OJYC 1CBSA 1KT6A 1ZNGA 2LBVA 1U0XA 3ZW2A 1KGLA 1VWRB 1K24A 5F6ZA 2Z4IA 4COTA 3OD9A 2LKKA 1TXLA 4I6SA 1R0UA 3BU1A 5IRWA 4NW4A 1JMZA 1MUPA 4QGWA 4TLJA 2OL8O 1QFVA 2K23A 4ZHCA 5LJKA 3WZNA 1JJXA 5H9KA 5HTEA 3HWEA 3FA9A 2BHVA 4BOEA 2I5VO 1HMTA 2IZHB 2FR2A 2JN3A 4Y0QA 5EZ2A 1JV4A 2DJGA 1MVGA 1SXXA 2RN4A 2IZEB 2HYSA 5HTDA 2IZLB 2FS6A 5KHPA 1VWBB 2WQ9A 1VWAB 3F6ZB 2FT9A 4BCSA 3CQNA 1STSB 1BEBA 1YP7A 2CZUA 2QCBA 2RD7C 1KL3A 3RDXA 3PH6A 1SLGB 1PTSA 1SRFA 2AVIA 1AB0A 4A8ZA 1ADLA 2A5CA 5HCCC 4L1NA 2AH7X 1KZWA 2UYWA 3KFHA 4N7DA 5D45A 4O49A 3SZIA 4YKOA 1MEPA 3SAOA 4U46A 5CSEA 1STPA 4ON1A 3ZUOA 4YKMA 4O3ZA 1A57A 1VWQB 1ML7A 3U03A 2HMBA 3AKMA 4QYPA 4R0BA 2IZIA 5IRAA 1SWRA 5JR8A 5F6BA 5K06A 1T8VA 2OVEA 4I3BA 4MIRA 1I9HA 3KZAA 1EPAA 1VWFB 2X55A 4QGXA 5JD2A 4AZRA 3B2KA 3Q6LA 3S60A 3WBGA 4I9RA 4HPDA 4DQ4A 3FIDA 1GM6A 3ELZA 1IW2A 4GH7A 1LIEA 1JYDA 2X8TA 5F2BA 3SZHA 3B2IA 4TQ2A 2AT6X 4YMYA 1EIOA 4ZH6A 1DFVA 1B56A 4ORSA 4CDFA 1X8UA 3JS1A 4FQBB 4MEEA 3SLOA 4DQ3A 3H3IA 1KT5A 2NNEA 4GGTA 4ID2A 4ORWA 1T68X 4QYNA 1RXHA 3N91A 1HBQA 3RSWA 1SWPA 1N7YA 2XSTA 1VWLB 3UEXA 2MWHA 2Z4HA 4MVEA 5CYBA 1NGLA 1PMPA 2X4MA 5D8JA 5FQ6E 1MK5A 1BWYA 5AJCA 1NDJA 1GX9A 3RDUA 1SWQA 1QQSA 3NBXX 1LIDA 5KIDA 1LF7A 3BY0A 2ZAIA 2L68A 2PI3O 2RTKA 2C1QA 4NYQA 1X71A 2KT4B 2P8GA 2VFCA 1NQMA 1ALBA 3FW4A 3PEDA 1U18A 4ZH9A 3STKA 2CBSA 2MF6A 4GE1A 2AT3X 3T2WA 4BQUA 3F9DA 2X46A 1SY0A 3HWFA 4GJSA 2KTDA 1I04A 5L3YA 3VHIA 2AT8X 1FELA 1KT3A 4WFVA 1SLFB 3BLGA 5AQ6A 3RDQA 1IFCA 4DNEA 2CM9A 1LKEA 2OF8A 4GD9A 4XMHA 5IO6A 1JJJA 1STRB 5HCEC 5B3MO 5K68A 3UEUA 5H9LA 5IO5A 4O3XB 4U8UN 1PBOA 1QY0A 3CR6A 4LQZA 2L9CA 4RUNA 3RDOA 1RAVA 1CBRA 1SWOA 4ZCBA 5FAZA 3CKGA 4Y5DA 2OFMX 3BU9A 1X8QA 3VHMA 4EFGA 1SRGA 3VGWA 4BJ8A 3TF6A 3CMPA 1N0SA 3CQRA 4FBVA 4AZOA 3RWXA 3KFIA 1YWCA 2QOSC 3D95A 3RBYA 1T0VA 2RQ0A 1SREA 4CDEA 2YMSA 4CK4A 2OFBA 2A13A 1DZPA 3NX2A 3FYFA 3D9WA 3DTQA 3BDRA 3FENA 4PSQA 2WSJA 5IXGA 3WZQA 3WJEA 3NADA 4Z27A 4JGLA 2Q9SA 3MG5A 1MOYA 3HTYA 1AVGI 1SXWA 2OYBO 3APVA 4YFRA 1JQPA 1LFOA 4YCHA 1VWMB 5F7GA 3AEHA 1LUQA 4O3YA 1W5RA 2W2BA 1U17A 3NPOA 1GKAA 3WVMA 3APUA 1SRJA 4GDZA 2RTEB 3P24A 4TJZA 2JGSA 1SWLA 2F01A 4CV7A 1DV9A 3B2LA 3NR3A 2CBRA 4LZUA 1KFFA 1DF8A 1QABE 2KD2A 2LFOA 2RTNB 2OY8A 1EXSA 4GRJA 2FKJA 1TOUA 2AT5X 3WJFA 4QAEA 4KC7A 5B5FA 2KW1A 4GK9A 4ES7A 1OEKA 1SXUA 1FEMA 2IZBA 3FA8A 3MVFA 3X00A 1YUPA 5K67A 3P02A 3APWA 3FR2A 4KIIA 5HA0A 3HPEA 4ZGUA 1LICA 2GTLO 4HPAA 1Y55X 4K19A 2Q2MA 1MX8A 3E3CA 1BRPA 2RTFB 1Y52X 2C4IA 4NV8A 4WBKA 3UEWA 2A3FX 1EIIA 3WZOA 2R73A 1SWTA 3NP1A 1IKEA 2A8GA 4GKCA 2RTQB 1IKJA 2RA6A 2WQAE 2F09A 2X45A 4RUUA 2IFBA 1JZUA 1SWGA 2K62A 1Y9TA 1VWIB 3AKNA 4OELA 5LKEA 1OBPA 1SWHA 4CSBA 1Y9LA 4ORRA 3QKGA 1VYGA 2BS6A 3T2XA 2Q4NA 4O4SA 2ANSA 3WJGA 3MM0A 1ZNDA 1P6PA 2RTIB 4KH8A 2WEXA 3D4RA 4INNA 3FLLA 2A2UA 4M7MA 3P6HA 2Y3FA 4OMWA 4BX7A 5FQ8E 1KL4A 3CBCA 3HK1A 1FTPA 4A60A 1IIUA 4MVIA 2FS7A 3RDSA 1DF3A 1VWJB 1QWDA 1O1UA 1QY1A 1ERBA 2MJIA 5B11O 4ZGFA 1E06A 1KZXA 4ML7B 4EKVA 3EBKA 2OY1O 3FMZA 4I9SA 4CDDA 1B4MA 2MM3A 3VE1A 2MHDA 4CPHB 1DZJA 2JW1A 1HXLA 3EC5A 1EPBA 1OBQA 1HBPA 1QFTA 1GKAB 2DM5A 2BS5A 2OVAA 2RTCB 4CDCA 4ZHHA 1B0OA 1VWGB 2BC3A 2ZAGA 5EDBA 1G5WA 3IFBA 4IB9A 1SLEB 4U3QA 1SWEA 2A2GA 4QGVA 5F1EA 3FEPA 1VPRA 2CAMA 2IZKA 3ZZVA 2FR3A 3B2JA 3BX8A 3LV4A 1ACDA 1BLRA 4D6BA 1SY3A 2ACOA 2FHLA 1RXJA 1SWUA 4EXZA 2VDFA 1KOIA 1Y0GA 2Y32A 2LBAA 3LHNA 2OL6O 2IZAA 4Z2PA 1BRQA 4M6SA 5B2AO 5LJBA 1I06A 2HZRA 4BGFA 4NP1A 4JO6A 5L8IA 4ALOA 2G5LA 2UZ2A 1AELA 4YCEA 1X8PA 3L4RA 5BVSA 1VWNB 1VYOA 2GJ5A 2OL7A 2WPUA 2N93A 3PQSA 4MVKA 2AL0X 4B55A 4GUZA 4MISA 4YGHA 1QY2A 4GGZA 2IZDB 3RE6A 1BM5A 3WJDA 1VYFA 1EQDA 2LA7A 5CHKA 4ZHDA 1KQXA 2RTPB 2RTBB 2X56A 3GE2A 1OPBA 4O3WA 1SMPI 3PP6A 3UEVA 1OBUA 1E02A 1RSTB 2EU7X 1LELA 1O1VA 1LIFA 2FKGA 4ALBA 1EUOA 1RLBE 2JU7A 5EDCA 3WYPA 5LJGA 1HY2A 1WUBA 2L5PA 2FTBA 4GZVA 3EW2A 4BX7B 2RTLA 5AEOA 4LKTA 1W6FA 2A5BA 1LNMA 5D48A 5IO7A 3ZUIA 4Z28A 1KL5A 2E4JA 3EM0A 3G7XA 5HWZA 5HZ8A 1GX3A 1WBIA 3KQ0A 4UU2A 3P6GA 4OS3A 3NQ9A 1GT1A 2JU3A 1BSYA 1FE3A 3BX7A 1SWCA 1VWDB 5F58A 4QNIA 1GT5A 1ICNA 2HZQA 3ZWEA 2IZJA 1EALA 3C76X 2AF5A 1I05A 4AZPA 1N4JA 3CBSA 4CPFA 5LJDA 5IRUA 3ZW1A 1FENA 2GTLN 1D3SA 3O19A 4EDEA 3VG7A 1ERXA 4U8UM 4A1YA 2C1SA 1E2TA 4XMEA 2KTSA 3TGCA 2LB6A 4O4XA 2RTGB 3S26A 1UYNX 3K3LA 1GGLA 4N7CA 4QQ1A 3VG6A 2ASNX 1Y53X 1ZRYA 4QZTA 3P6FA 2YG2A 3SLTA 4IABA 1LCWA 1LCZA 2RTAA 4YBUA 5B10O 1YWDA 4ORYA 3RY1A 4AZMA 3STMX 2BT9A 4I3CA 5CE4A 2RCQA 4GGRA 1ZNHA 5LJEA 4XMDA 1LPJA 2A0AA 3QQ2A 5C0NA 2FGSA 1SRHA 4YH0A 3WOVA 3JSQA 2OZQA 1TVQA 5HBSA 5AJBA 3NX1A 1TOWA 3WJBA 2Y3EA 1A3YA 1K3BA 2NNQA 1G74A 2JU8A 5HZQA 5H9NA 2FWVA 2F73A 3KVNA 3RZYA 3TGBA 4YGGA 2RTJA 4YDBA 3VG2A 4UU3A 1HMSA 4KCAA 1HQQA 3T1DA 1RBPA 3VU1A 1JMXA 2AT0X 4Z6JA 3P6EA 2RTDB 3ZW0A 1HQPA 4KC8A 4BVMA 4YFPA 2W2AA 2G78A 4IB7A 4I3DA 4YBPA 2DJFA 4Z2VA 4IMNA 4IB8A 4Y0RA 4AW8A 1LCVA 1OSPO 1VWOB 1RXKA 2QMIA 3ZQ3A 3I0AA 4D6AA 1VWPB 2ALLX 4OS8A 1GX8A 4TNNA 3WJCA 4ODDA 4FBRA 4GNYA 1VWKB 2NP1A 3D96A 5D47A 4L3RA 4YGZA 2IZCB 1UZ2X 5HA1A 3ZW1B 2WWPA 1YWBA 3FA6A 1XCAA 3VPJE 4O4OA 1VWHB 4DCBA 2VFBA 4ZJ0A 1MM9A 4BX6A 4OS0A 2IZFB 2GTFX 3HWDA 4YDAA 4ORUA 3SOTA 3UAQA 4ARHA 1EW3A 1SWFA 1VWEB 2FLJA 3PH5A 1UYOX 2O62A 5B5GA 2PY1A 1IJ8A 2X32A 3WZPA 3WXQA 5KICA 3RKGA 2CZTA 3D97A 3KFGA 2XKLA 1FDQA 1PM1X 2HLVA 1GXAA 4GNWA 1W4TA 2RCTA 4HFOA 4BX5A 2Q39A 4MVLA 4NLJA 2RTOB 3EBWA 1NQNA 2CM4A 4GDAA 1A2DA 3FR4A 2W2FA 4IMOA 3APXA 2I5ZO 2QO6A 2OY5O 4ZHFA 5L8NA 3VHHA 4EQAC 1G85A 5L8OA 1QG5A 5DPQA 1CRBA 4XMCA 3PPTA 4LKPA 3FA7A 3FELA 1OPAA 1PEEA 4FGIB 3RE5A 4XMGA 1ZNLA 1BSQA 3OBLA 2QO4A 4YFQA 1E5PA 3HWGA 1NP1A 1YP6A 1EI5A 4NNSA 5HZ9A 4AZNA 1XKIA 3TGAA 1BJ7A 1YIVA 2G79A 2M4LA 3ZW0B 4OMXA 3RY2A 4A1HA 1N43A 4YVBA 4FBOA 4OEMA 4QRLA 1HXZA 4AYHA 1RSUB 1Z24A 1SWBA 2AKQA 3P6CA 4NNTA 3DSZA 2QOMA 1L6MA 4PJ2A 5EEDA 3STNA 4BBOA 3C77X 5BVTA 2MO5A 1MDCA 1DC9A 2X34A 1DZMA 3OE3A 3NQKA 3F8AA 3Q34A 1BBPA 4GU8A 3T6LA 3VG3A 1PBYA 3WYQA 2AMMX 3AUMO 3CKFA 4Y0PA 4ZHGA 4HPCA 4I95A 1D2UA 4HWMA 2NNDA 1SWSA 4I60A 1ICMA 3EYCA 3FW5A 3MX7A 4JHQA 4BX6B 1NBXA 2WEWA 3IA8A 1UREA 1B8EA 1SY2A 2X8SA 1LIBA 3CWKA 2RTHB 2RTMA 1G7NA 1SA8A 4Y59A 3O2YA 1SWDA 1IFBA 2OFRX 3HOLA 4IAXA 1O8VA 3FR5A 2R56A 4BX5B 3P6DA 4TKJA 1CBIA 4TKHA 1FJ1E 3BS2A 3B2HA 2ZSCA 3KFFA 1AVEA 1N9MA 2FHNX 1I4UA 1E00A 2WR6A 4O9SA 4U9CA 1SLDB 1SRIA 3ELXA 4XMFA 1N9YA 4WFUA 2QO5A 3MBTA 4NYRA 5FQ7E 4ZR2A 4IBAA 3S5XA 5DG4A 2R74A 3U9PC 3V8UA 3VG5A 2JMBA 3NQ3A 3LTWA 2FRSA 5EEEA 5H8TA 1S44A 2QM9A 4CPEA 2OVSA 1SY1A 2G7BA 1X89A 4HPBA 1S2PA 5FENA 2HKDA 3S5VA 3T6FA 1GT3A 2L67A 1NC9A 4OKAA 2WUTA 4NV7A 5HZ5A 1HMRA 4C5PA 2IZGB 3VE2A 2GTLM 3VG4A 1SXYA 1TW4A 4KT5A 1ZNKA 1VWCB 1A18A 1NP4A 4GJVA 4LZVA 2Q2PA 1GT4A 1KT7A
chains in the Genus database with same CATH topology
3FEKA 3HOEA 1JBHA 5HAEA 1YWAA 1AQBA 3BRNA 4TKBA 4GETA 3JQOA 2ACPX 4AZQA 3O22A 4O4UA 5EPQA 3U0DA 1OEEA 3GAQA 4IB6A 4ORXA 3PECA 4NLIA 5D4AA 1JYJA 5BYPA 1HN2A 5HZ6A 1JIWI 2HNXA 2JOZA 3FIQA 3PQUA 1X8OA 3TZSA 5LJHA 3ZI8A 1BSOA 1S7DA 3BSZE 3I17A 4QZUA 3C78X 4WHIA 5BVQA 3EMMA 1CJ5A 1ZNEA 1OEJA 2BLGA 2X8FA 4ZFXA 1H91A 5HCDC 4EEJA 1KXOA 2POAA 1KQWA 1KT4A 1DZKA 2OVDA 4Y0SA 4U8UO 1MX7A 5H9AA 5LJCA 5B29A 2GC9A 5B27A 1X8NA 5FFHA 1CBQA 4IAWA 5LKFA 3OJYC 1CBSA 1KT6A 1ZNGA 2LBVA 1U0XA 3ZW2A 1KGLA 5F6ZA 2Z4IA 4COTA 3OD9A 2LKKA 1TXLA 4I6SA 1R0UA 3BU1A 4NW4A 1MUPA 4QGWA 4TLJA 1QFVA 2K23A 4ZHCA 5LJKA 1JJXA 5H9KA 5HTEA 3HWEA 3FA9A 2BHVA 4BOEA 1HMTA 4Y0QA 2FR2A 2JN3A 5EZ2A 1JV4A 1MVGA 1SXXA 2RN4A 2HYSA 5HTDA 2FS6A 5KHPA 3F6ZB 2WQ9A 2FT9A 3CQNA 1YP7A 1BEBA 2CZUA 2RD7C 3PH6A 1AB0A 4A8ZA 1ADLA 5HCCC 4L1NA 2AH7X 1KZWA 3KFHA 5D45A 4O49A 4YKOA 3SAOA 4ON1A 3ZUOA 4YKMA 4O3ZA 1A57A 3U03A 1ML7A 2HMBA 3AKMA 4QYPA 4R0BA 5JR8A 5F6BA 5K06A 1T8VA 2OVEA 4I3BA 4MIRA 3KZAA 1EPAA 4QGXA 4AZRA 3B2KA 3Q6LA 3S60A 3WBGA 4I9RA 4HPDA 4DQ4A 4GH7A 1GM6A 3ELZA 1IW2A 1LIEA 1JYDA 2X8TA 4TQ2A 3B2IA 4YMYA 2AT6X 1EIOA 4ZH6A 1DFVA 1B56A 4ORSA 1X8UA 3JS1A 4FQBB 4DQ3A 3H3IA 1KT5A 2NNEA 4QYNA 4ID2A 4ORWA 1T68X 3N91A 1HBQA 3RSWA 2XSTA 3UEXA 2MWHA 2Z4HA 4MVEA 5CYBA 1NGLA 1PMPA 5D8JA 5FQ6E 1BWYA 5AJCA 1GX9A 5KIDA 1QQSA 3NBXX 1LIDA 1LF7A 3BY0A 2ZAIA 2L68A 4NYQA 1X71A 2KT4B 2P8GA 1ALBA 3FW4A 3PEDA 1U18A 4ZH9A 3STKA 2CBSA 4GE1A 2AT3X 4BQUA 3F9DA 2X46A 1SY0A 3HWFA 2KTDA 1I04A 2AT8X 1FELA 1KT3A 4WFVA 3BLGA 5AQ6A 5IO6A 1IFCA 1JJJA 2CM9A 1LKEA 4XMHA 5HCEC 3UEUA 5H9LA 5IO5A 4O3XB 4U8UN 1PBOA 1QY0A 3CR6A 4LQZA 2L9CA 4RUNA 4QGVA 1CBRA 4ZCBA 5FAZA 2OFMX 3BU9A 1X8QA 4EFGA 3TF6A 3CMPA 1N0SA 3CQRA 4FBVA 4AZOA 3RWXA 3KFIA 1YWCA 2QOSC 3D95A 3RBYA 1T0VA 2RQ0A 2YMSA 4CK4A 2A13A 1DZPA 3NX2A 3FYFA 3DTQA 3FENA 3BDRA 4PSQA 2WSJA 3WJEA 3NADA 4JGLA 2Q9SA 3HTYA 1AVGI 1SXWA 4YFRA 3APVA 1LFOA 4YCHA 5F7GA 4O3YA 2W2BA 1U17A 3NPOA 1GKAA 3WVMA 3APUA 4GDZA 3P24A 4TJZA 4CV7A 1DV9A 3B2LA 3NR3A 2CBRA 4LZUA 1QABE 2KD2A 2LFOA 1EXSA 4GRJA 1TOUA 2AT5X 3WJFA 4QAEA 4KC7A 2KW1A 4GK9A 4ES7A 1OEKA 1SXUA 1FEMA 3FA8A 3MVFA 1YUPA 3P02A 3APWA 3FR2A 4KIIA 5HA0A 4ZGUA 1LICA 2GTLO 4HPAA 4K19A 2Q2MA 1MX8A 3E3CA 1BRPA 4WBKA 3UEWA 1EIIA 2A3FX 2R73A 3NP1A 1IKEA 4GKCA 1IKJA 2RA6A 2WQAE 2F09A 2X45A 4RUUA 2IFBA 1JZUA 2K62A 1Y9TA 3AKNA 5LKEA 1OBPA 4CSBA 1Y9LA 4ORRA 3QKGA 1VYGA 2BS6A 2Q4NA 4O4SA 2ANSA 3WJGA 1ZNDA 1P6PA 4N7DA 4KH8A 2WEXA 3D4RA 4INNA 3FLLA 2A2UA 4M7MA 3P6HA 4OMWA 5FQ8E 3CBCA 3HK1A 1FTPA 4A60A 1IIUA 4MVIA 2FS7A 1DF3A 1QWDA 1O1UA 1QY1A 2MJIA 1ERBA 4ZGFA 1KZXA 1E06A 4ML7B 3EBKA 3FMZA 4I9SA 1B4MA 2MM3A 3VE1A 2MHDA 1DZJA 2JW1A 1EPBA 2DM5A 1OBQA 1HBPA 1GKAB 1QFTA 2BS5A 2OVAA 4ZHHA 1B0OA 5EDBA 2ZAGA 3IFBA 4IB9A 4U3QA 2A2GA 5F1EA 3FEPA 1VPRA 3ZZVA 2FR3A 3B2JA 3BX8A 3LV4A 1ACDA 1BLRA 4D6BA 1SY3A 2ACOA 4EXZA 1KOIA 2LBAA 3LHNA 1BRQA 4M6SA 5LJBA 1I06A 2HZRA 4NP1A 5L8IA 4ALOA 1AELA 4YCEA 1X8PA 3L4RA 5BVSA 4MVKA 3PQSA 2GJ5A 1G5WA 2N93A 2AL0X 4MISA 4YGHA 1QY2A 1BM5A 3WJDA 1VYFA 1EQDA 2LA7A 4ZHDA 1KQXA 4O3WA 3GE2A 1OPBA 1SMPI 3PP6A 3UEVA 1OBUA 1E02A 2EU7X 1O1VA 4ALBA 1LIFA 1EUOA 1RLBE 2JU7A 5EDCA 5LJGA 2L5PA 4GZVA 2FTBA 5AEOA 4LKTA 1LNMA 5D48A 5IO7A 3ZUIA 2E4JA 3EM0A 3G7XA 5HWZA 5HZ8A 3KQ0A 4UU2A 3P6GA 4OS3A 3NQ9A 1GT1A 2JU3A 1BSYA 1FE3A 3BX7A 5F58A 4QNIA 1GT5A 1ICNA 2HZQA 3ZWEA 1EALA 3C76X 4AZPA 1I05A 3CBSA 5LJDA 3ZW1A 1FENA 2GTLN 1D3SA 3O19A 4EDEA 3VG7A 1ERXA 4U8UM 4A1YA 4XMEA 2KTSA 3TGCA 2LB6A 4O4XA 3S26A 4N7CA 3K3LA 1GGLA 4QQ1A 3VG6A 2ASNX 1ZRYA 4QZTA 3P6FA 2YG2A 4IABA 4YBUA 1YWDA 4ORYA 4AZMA 3STMX 2BT9A 4I3CA 5CE4A 2RCQA 1ZNHA 5LJEA 4XMDA 1LPJA 2A0AA 5C0NA 4YH0A 3WOVA 3JSQA 2OZQA 1TVQA 5HBSA 5AJBA 3NX1A 1TOWA 3WJBA 1A3YA 5HZQA 2NNQA 1G74A 2JU8A 5H9NA 2FWVA 2F73A 3RZYA 3TGBA 4YGGA 4YDBA 3VG2A 4UU3A 1HMSA 4KCAA 3T1DA 1RBPA 3VU1A 2AT0X 3P6EA 4BVMA 3ZW0A 1HQPA 4KC8A 4YFPA 2W2AA 2G78A 4IB7A 4I3DA 4YBPA 4IMNA 4IB8A 4Y0RA 4AW8A 4D6AA 2QMIA 3ZQ3A 3I0AA 2ALLX 4OS8A 1GX8A 4TNNA 3WJCA 4ODDA 4FBRA 4GNYA 2NP1A 3D96A 5D47A 4L3RA 4YGZA 1UZ2X 5HA1A 3ZW1B 2WWPA 1YWBA 3FA6A 1XCAA 3VPJE 4O4OA 4ZJ0A 4OS0A 2GTFX 3HWDA 4YDAA 4ORUA 3SOTA 3UAQA 4ARHA 1EW3A 2FLJA 3PH5A 2O62A 2PY1A 3WXQA 5KICA 3RKGA 2CZTA 3D97A 3KFGA 2XKLA 1FDQA 1PM1X 2HLVA 1GXAA 4GNWA 2RCTA 4HFOA 2Q39A 4MVLA 4NLJA 3EBWA 2CM4A 1A2DA 3FR4A 2W2FA 4IMOA 3APXA 4ZHFA 2QO6A 5L8NA 4EQAC 1G85A 5L8OA 1QG5A 5DPQA 1CRBA 4XMCA 3PPTA 4LKPA 3FA7A 3FELA 1OPAA 1PEEA 4FGIB 4XMGA 1ZNLA 1BSQA 3OBLA 2QO4A 4YFQA 1E5PA 3HWGA 1NP1A 1YP6A 1EI5A 4NNSA 5HZ9A 4AZNA 1XKIA 3TGAA 1BJ7A 1YIVA 2G79A 2M4LA 3ZW0B 4OMXA 4A1HA 4FBOA 4QRLA 4AYHA 1Z24A 3P6CA 4NNTA 2AKQA 3STNA 3DSZA 4PJ2A 1L6MA 5EEDA 5BVTA 3C77X 2MO5A 1MDCA 1DC9A 1DZMA 3OE3A 3NQKA 3F8AA 3VG3A 1BBPA 4GU8A 2AMMX 4ZHGA 4Y0PA 4HPCA 4I95A 1D2UA 4HWMA 2NNDA 1ICMA 3EYCA 3FW5A 3MX7A 2WEWA 3IA8A 1UREA 1B8EA 1SY2A 2X8SA 1LIBA 3CWKA 1G7NA 1SA8A 3O2YA 1IFBA 2OFRX 3HOLA 4IAXA 1O8VA 3FR5A 2R56A 3P6DA 4TKJA 1CBIA 4TKHA 3BS2A 3B2HA 3KFFA 4U9CA 4O9SA 1I4UA 1E00A 2WR6A 4XMFA 3ELXA 4WFUA 2QO5A 3MBTA 4NYRA 5FQ7E 4ZR2A 4IBAA 3S5XA 5DG4A 2R74A 3U9PC 3V8UA 3VG5A 2JMBA 3NQ3A 5EEEA 2FRSA 5H8TA 1S44A 2QM9A 2OVSA 1SY1A 2G7BA 1X89A 4HPBA 1S2PA 5FENA 3S5VA 1GT3A 2L67A 2WUTA 5HZ5A 1HMRA 3VE2A 2GTLM 3VG4A 1SXYA 1TW4A 4KT5A 1ZNKA 1A18A 1NP4A 4LZVA 2Q2PA 1GT4A 1KT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEK A;  1JBH A;  5HAE A;  1YWA A;  1AQB A;  3BRN A;  4TKB A;  4GET A;  2ACP X;  4AZQ A;  3O22 A;  3U0D A;  5EPQ A;  1OEE A;  3GAQ A;  4IB6 A;  4ORX A;  3PEC A;  4NLI A;  5D4A A;  1JYJ A;  1HN2 A;  5HZ6 A;  2HNX A;  2JOZ A;  3FIQ A;  1X8O A;  3TZS A;  5LJH A;  1BSO A;  1S7D A;  3BSZ E;  3I17 A;  4QZU A;  3C78 X;  5BVQ A;  3EMM A;  1CJ5 A;  1ZNE A;  1OEJ A;  2BLG A;  4ZFX A;  1H91 A;  5HCD C;  4EEJ A;  1KXO A;  2POA A;  1KQW A;  1KT4 A;  1DZK A;  2OVD A;  4Y0S A;  1MX7 A;  5H9A A;  5LJC A;  5B29 A;  2GC9 A;  5B27 A;  1X8N A;  5FFH A;  1CBQ A;  4IAW A;  5LKF A;  3OJY C;  1CBS A;  1KT6 A;  1ZNG A;  2LBV A;  1U0X A;  1KGL A;  5F6Z A;  2LKK A;  1TXL A;  1R0U A;  3BU1 A;  1MUP A;  4QGW A;  4TLJ A;  1QFV A;  2K23 A;  4ZHC A;  5LJK A;  1JJX A;  5H9K A;  5HTE A;  3HWE A;  3FA9 A;  4BOE A;  1HMT A;  4Y0Q A;  2FR2 A;  2JN3 A;  5EZ2 A;  1JV4 A;  1MVG A;  1SXX A;  2HYS A;  5HTD A;  2FS6 A;  5KHP A;  2WQ9 A;  2FT9 A;  3CQN A;  1YP7 A;  1BEB A;  2CZU A;  2RD7 C;  3PH6 A;  1AB0 A;  4A8Z A;  1ADL A;  5HCC C;  2AH7 X;  1KZW A;  3KFH A;  5D45 A;  4YKO A;  3SAO A;  3ZUO A;  4YKM A;  1A57 A;  3U03 A;  1ML7 A;  2HMB A;  3AKM A;  4QYP A;  4R0B A;  5JR8 A;  5F6B A;  5K06 A;  1T8V A;  2OVE A;  4I3B A;  3KZA A;  1EPA A;  4QGX A;  4AZR A;  3B2K A;  3Q6L A;  3WBG A;  4I9R A;  4HPD A;  4DQ4 A;  4GH7 A;  1GM6 A;  3ELZ A;  1IW2 A;  1LIE A;  1JYD A;  4TQ2 A;  3B2I A;  4YMY A;  2AT6 X;  1EIO A;  4ZH6 A;  1DFV A;  1B56 A;  4ORS A;  1X8U A;  3JS1 A;  4DQ3 A;  1KT5 A;  2NNE A;  4QYN A;  4ORW A;  1T68 X;  1HBQ A;  3RSW A;  2XST A;  3UEX A;  5D8J A;  1NGL A;  1PMP A;  1BWY A;  1GX9 A;  5KID A;  1QQS A;  1LID A;  1LF7 A;  3BY0 A;  2L68 A;  4NYQ A;  1X71 A;  2KT4 B;  2P8G A;  1ALB A;  3FW4 A;  3PED A;  1U18 A;  4ZH9 A;  3STK A;  2CBS A;  4GE1 A;  2AT3 X;  4BQU A;  3F9D A;  2X46 A;  1SY0 A;  3HWF A;  2KTD A;  1I04 A;  2AT8 X;  1FEL A;  1KT3 A;  4WFV A;  3BLG A;  5AQ6 A;  5IO6 A;  1IFC A;  1JJJ A;  2CM9 A;  1LKE A;  4XMH A;  5HCE C;  3UEU A;  5H9L A;  5IO5 A;  4QGV A;  1PBO A;  1QY0 A;  3CR6 A;  2L9C A;  4RUN A;  1CBR A;  4ZCB A;  5FAZ A;  2OFM X;  3BU9 A;  1X8Q A;  4EFG A;  3TF6 A;  3CMP A;  1N0S A;  3CQR A;  4AZO A;  3KFI A;  1YWC A;  2QOS C;  3D95 A;  1T0V A;  2RQ0 A;  4CK4 A;  2A13 A;  1DZP A;  3NX2 A;  3DTQ A;  3FEN A;  3BDR A;  4PSQ A;  2WSJ A;  3WJE A;  3NAD A;  2Q9S A;  1AVG I;  1SXW A;  4YFR A;  3APV A;  1LFO A;  4YCH A;  5F7G A;  2W2B A;  1U17 A;  3NPO A;  1GKA A;  3WVM A;  3APU A;  4TJZ A;  1DV9 A;  3B2L A;  3NR3 A;  2CBR A;  4LZU A;  1QAB E;  2LFO A;  1EXS A;  4GRJ A;  1TOU A;  2AT5 X;  3WJF A;  4QAE A;  4ES7 A;  1OEK A;  1SXU A;  1FEM A;  3FA8 A;  3MVF A;  1YUP A;  3APW A;  3FR2 A;  4KII A;  5HA0 A;  4ZGU A;  1LIC A;  4HPA A;  4K19 A;  2Q2M A;  1MX8 A;  4WBK A;  1BRP A;  3UEW A;  1EII A;  2A3F X;  2R73 A;  3NP1 A;  1IKE A;  4GKC A;  1IKJ A;  2RA6 A;  2WQA E;  2X45 A;  4RUU A;  2IFB A;  1JZU A;  2K62 A;  3AKN A;  5LKE A;  1OBP A;  4ORR A;  3QKG A;  1VYG A;  2Q4N A;  2ANS A;  3WJG A;  1ZND A;  1P6P A;  4N7D A;  4YGH A;  2WEX A;  4M7M A;  3FLL A;  2A2U A;  4OMW A;  3P6H A;  3CBC A;  3HK1 A;  1FTP A;  4A60 A;  1IIU A;  4MVI A;  2FS7 A;  1DF3 A;  1QWD A;  1O1U A;  1QY1 A;  2MJI A;  1ERB A;  1KZX A;  1E06 A;  3EBK A;  3FMZ A;  4I9S A;  1B4M A;  2MM3 A;  1DZJ A;  1EPB A;  2DM5 A;  1OBQ A;  1HBP A;  1GKA B;  1QFT A;  2OVA A;  4ZHH A;  1B0O A;  5EDB A;  3IFB A;  4IB9 A;  2A2G A;  5F1E A;  3FEP A;  1VPR A;  2FR3 A;  3B2J A;  3BX8 A;  1ACD A;  1BLR A;  4D6B A;  1SY3 A;  2ACO A;  4EXZ A;  1KOI A;  2LBA A;  1BRQ A;  4M6S A;  5LJB A;  1I06 A;  2HZR A;  4NP1 A;  5L8I A;  4ALO A;  1AEL A;  4YCE A;  1X8P A;  3L4R A;  5BVS A;  4MVK A;  1G5W A;  2GJ5 A;  2N93 A;  2AL0 X;  1QY2 A;  1BM5 A;  3WJD A;  1VYF A;  1EQD A;  4ZHD A;  1KQX A;  1OPB A;  3PP6 A;  3UEV A;  1OBU A;  1E02 A;  2EU7 X;  1O1V A;  4ALB A;  1LIF A;  1EUO A;  1RLB E;  2JU7 A;  5EDC A;  5LJG A;  2L5P A;  2FTB A;  4LKT A;  1LNM A;  5D48 A;  5IO7 A;  3ZUI A;  2E4J A;  3EM0 A;  3G7X A;  5HWZ A;  5HZ8 A;  3KQ0 A;  4UU2 A;  3P6G A;  4OS3 A;  3NQ9 A;  1GT1 A;  2JU3 A;  1BSY A;  1FE3 A;  3BX7 A;  5F58 A;  1GT5 A;  1ICN A;  2HZQ A;  1EAL A;  3C76 X;  4AZP A;  1I05 A;  3CBS A;  5LJD A;  1FEN A;  3O19 A;  1D3S A;  4EDE A;  3VG7 A;  1ERX A;  4A1Y A;  4XME A;  3TGC A;  2LB6 A;  3S26 A;  4N7C A;  3K3L A;  1GGL A;  3VG6 A;  2ASN X;  1ZRY A;  4QZT A;  3P6F A;  2YG2 A;  4YBU A;  1YWD A;  4ORY A;  4AZM A;  3STM X;  4I3C A;  5CE4 A;  2RCQ A;  1ZNH A;  5LJE A;  4XMD A;  1LPJ A;  2A0A A;  5C0N A;  4YH0 A;  3JSQ A;  2OZQ A;  1TVQ A;  5HBS A;  3NX1 A;  1TOW A;  3WJB A;  1A3Y A;  5HZQ A;  2NNQ A;  1G74 A;  2JU8 A;  5H9N A;  2FWV A;  2F73 A;  3RZY A;  3TGB A;  4YGG A;  4YDB A;  3VG2 A;  4UU3 A;  1HMS A;  3T1D A;  1RBP A;  2AT0 X;  3P6E A;  4BVM A;  1HQP A;  4YFP A;  2W2A A;  2G78 A;  4IB7 A;  4I3D A;  4YBP A;  4IMN A;  4IB8 A;  4Y0R A;  4AW8 A;  4D6A A;  3ZQ3 A;  3I0A A;  2ALL X;  4OS8 A;  1GX8 A;  4TNN A;  3WJC A;  4ODD A;  4GNY A;  2NP1 A;  3D96 A;  5D47 A;  4YGZ A;  1UZ2 X;  5HA1 A;  2WWP A;  1YWB A;  3FA6 A;  1XCA A;  4ZJ0 A;  4OS0 A;  2GTF X;  3HWD A;  4YDA A;  4ORU A;  4ARH A;  1EW3 A;  2FLJ A;  3PH5 A;  2O62 A;  2PY1 A;  3WXQ A;  5KIC A;  2CZT A;  3D97 A;  3KFG A;  2XKL A;  1FDQ A;  1PM1 X;  2HLV A;  1GXA A;  4GNW A;  2RCT A;  4HFO A;  2Q39 A;  4MVL A;  4NLJ A;  3EBW A;  2CM4 A;  1A2D A;  3FR4 A;  2W2F A;  4IMO A;  3APX A;  4ZHF A;  2QO6 A;  5L8N A;  5L8O A;  1G85 A;  1QG5 A;  5DPQ A;  1CRB A;  4XMC A;  3PPT A;  4LKP A;  3FA7 A;  3FEL A;  1OPA A;  1PEE A;  4XMG A;  1ZNL A;  1BSQ A;  4YFQ A;  2QO4 A;  1E5P A;  3HWG A;  1NP1 A;  1YP6 A;  4NNS A;  5HZ9 A;  4AZN A;  1XKI A;  3TGA A;  1BJ7 A;  1YIV A;  2G79 A;  4OMX A;  4A1H A;  4AYH A;  1Z24 A;  3P6C A;  4NNT A;  2AKQ A;  3STN A;  3DSZ A;  5EED A;  1L6M A;  5BVT A;  3C77 X;  2MO5 A;  1MDC A;  1DC9 A;  1DZM A;  3F8A A;  3VG3 A;  1BBP A;  2AMM X;  4ZHG A;  4Y0P A;  4HPC A;  1D2U A;  2NND A;  1ICM A;  3EYC A;  3FW5 A;  2WEW A;  3IA8 A;  1URE A;  1B8E A;  1SY2 A;  1LIB A;  3CWK A;  1G7N A;  1SA8 A;  3O2Y A;  1IFB A;  2OFR X;  4IAX A;  1O8V A;  3FR5 A;  2R56 A;  3P6D A;  4TKJ A;  1CBI A;  4TKH A;  3BS2 A;  3B2H A;  3KFF A;  4O9S A;  1I4U A;  1E00 A;  2WR6 A;  4XMF A;  3ELX A;  4WFU A;  2QO5 A;  3MBT A;  4NYR A;  4ZR2 A;  4IBA A;  5DG4 A;  2R74 A;  3U9P C;  3VG5 A;  3NQ3 A;  5EEE A;  2FRS A;  5H8T A;  1S44 A;  2QM9 A;  1SY1 A;  2G7B A;  1X89 A;  4HPB A;  1S2P A;  5FEN A;  1GT3 A;  2L67 A;  2WUT A;  5HZ5 A;  1HMR A;  3VG4 A;  1SXY A;  1TW4 A;  1ZNK A;  1A18 A;  1NP4 A;  4LZV A;  2Q2P A;  1GT4 A;  1KT7 A; 
#chains in the Genus database with same CATH topology
 1LDO A;  2OF9 A;  3FEK A;  3HOE A;  1SWN A;  5HAE A;  3SLJ A;  1JBH A;  2RTR B;  1YWA A;  1AQB A;  1LDQ A;  3BRN A;  3RDM A;  4GET A;  4TKB A;  3JQO A;  2ACP X;  4AZQ A;  2GH7 A;  1SWJ A;  3O22 A;  4O4U A;  5EPQ A;  3U0D A;  1OEE A;  3GAQ A;  4IB6 A;  4ORX A;  2BSZ A;  3PEC A;  4NLI A;  5D4A A;  1JYJ A;  1JJU A;  5BYP A;  1HN2 A;  1SWA A;  2OFA A;  5HZ6 A;  1JIW I;  2HNX A;  2JOZ A;  3FIQ A;  3PQU A;  4IRW A;  4CPI A;  1X8O A;  3TZS A;  5LJH A;  1I78 A;  3ZI8 A;  1BSO A;  1S7D A;  3BSZ E;  3I17 A;  1AVD A;  3PK2 A;  4QZU A;  4Z2O A;  3C78 X;  4JNJ A;  3EW1 A;  4WHI A;  3EMM A;  5BVQ A;  4CPH A;  1ZNE A;  1OEJ A;  2BLG A;  2X8F A;  4ZFX A;  1CJ5 A;  1H91 A;  5HCD C;  4EEJ A;  1KXO A;  2POA A;  1KQW A;  3PDF A;  1KT4 A;  1DZK A;  2OVD A;  4Y0S A;  1SWK A;  4U8U O;  1MX7 A;  5H9A A;  2G8C O;  5LJC A;  2OY7 A;  5B29 A;  2GC9 A;  5B27 A;  1X8N A;  5FFH A;  3SZJ A;  1CBQ A;  4IAW A;  5LKF A;  3FDC A;  3OJY C;  1CBS A;  1KT6 A;  1ZNG A;  2LBV A;  1U0X A;  3ZW2 A;  1KGL A;  1VWR B;  1K24 A;  5F6Z A;  2Z4I A;  4COT A;  3OD9 A;  2LKK A;  1TXL A;  4I6S A;  1R0U A;  3BU1 A;  5IRW A;  4NW4 A;  1JMZ A;  1MUP A;  4QGW A;  4TLJ A;  2OL8 O;  1QFV A;  2K23 A;  4ZHC A;  5LJK A;  3WZN A;  1JJX A;  5H9K A;  5HTE A;  3HWE A;  3FA9 A;  2BHV A;  4BOE A;  2I5V O;  1HMT A;  2IZH B;  2FR2 A;  2JN3 A;  4Y0Q A;  5EZ2 A;  1JV4 A;  2DJG A;  1MVG A;  1SXX A;  2RN4 A;  2IZE B;  2HYS A;  5HTD A;  2IZL B;  2FS6 A;  5KHP A;  1VWB B;  2WQ9 A;  1VWA B;  3F6Z B;  2FT9 A;  4BCS A;  3CQN A;  1STS B;  1BEB A;  1YP7 A;  2CZU A;  2QCB A;  2RD7 C;  1KL3 A;  3RDX A;  3PH6 A;  1SLG B;  1PTS A;  1SRF A;  2AVI A;  1AB0 A;  4A8Z A;  1ADL A;  2A5C A;  5HCC C;  4L1N A;  2AH7 X;  1KZW A;  2UYW A;  3KFH A;  4N7D A;  5D45 A;  4O49 A;  3SZI A;  4YKO A;  1MEP A;  3SAO A;  4U46 A;  5CSE A;  1STP A;  4ON1 A;  3ZUO A;  4YKM A;  4O3Z A;  1A57 A;  1VWQ B;  1ML7 A;  3U03 A;  2HMB A;  3AKM A;  4QYP A;  4R0B A;  2IZI A;  5IRA A;  1SWR A;  5JR8 A;  5F6B A;  5K06 A;  1T8V A;  2OVE A;  4I3B A;  4MIR A;  1I9H A;  3KZA A;  1EPA A;  1VWF B;  2X55 A;  4QGX A;  5JD2 A;  4AZR A;  3B2K A;  3Q6L A;  3S60 A;  3WBG A;  4I9R A;  4HPD A;  4DQ4 A;  3FID A;  1GM6 A;  3ELZ A;  1IW2 A;  4GH7 A;  1LIE A;  1JYD A;  2X8T A;  5F2B A;  3SZH A;  3B2I A;  4TQ2 A;  2AT6 X;  4YMY A;  1EIO A;  4ZH6 A;  1DFV A;  1B56 A;  4ORS A;  4CDF A;  1X8U A;  3JS1 A;  4FQB B;  4MEE A;  3SLO A;  4DQ3 A;  3H3I A;  1KT5 A;  2NNE A;  4GGT A;  4ID2 A;  4ORW A;  1T68 X;  4QYN A;  1RXH A;  3N91 A;  1HBQ A;  3RSW A;  1SWP A;  1N7Y A;  2XST A;  1VWL B;  3UEX A;  2MWH A;  2Z4H A;  4MVE A;  5CYB A;  1NGL A;  1PMP A;  2X4M A;  5D8J A;  5FQ6 E;  1MK5 A;  1BWY A;  5AJC A;  1NDJ A;  1GX9 A;  3RDU A;  1SWQ A;  1QQS A;  3NBX X;  1LID A;  5KID A;  1LF7 A;  3BY0 A;  2ZAI A;  2L68 A;  2PI3 O;  2RTK A;  2C1Q A;  4NYQ A;  1X71 A;  2KT4 B;  2P8G A;  2VFC A;  1NQM A;  1ALB A;  3FW4 A;  3PED A;  1U18 A;  4ZH9 A;  3STK A;  2CBS A;  2MF6 A;  4GE1 A;  2AT3 X;  3T2W A;  4BQU A;  3F9D A;  2X46 A;  1SY0 A;  3HWF A;  4GJS A;  2KTD A;  1I04 A;  5L3Y A;  3VHI A;  2AT8 X;  1FEL A;  1KT3 A;  4WFV A;  1SLF B;  3BLG A;  5AQ6 A;  3RDQ A;  1IFC A;  4DNE A;  2CM9 A;  1LKE A;  2OF8 A;  4GD9 A;  4XMH A;  5IO6 A;  1JJJ A;  1STR B;  5HCE C;  5B3M O;  5K68 A;  3UEU A;  5H9L A;  5IO5 A;  4O3X B;  4U8U N;  1PBO A;  1QY0 A;  3CR6 A;  4LQZ A;  2L9C A;  4RUN A;  3RDO A;  1RAV A;  1CBR A;  1SWO A;  4ZCB A;  5FAZ A;  3CKG A;  4Y5D A;  2OFM X;  3BU9 A;  1X8Q A;  3VHM A;  4EFG A;  1SRG A;  3VGW A;  4BJ8 A;  3TF6 A;  3CMP A;  1N0S A;  3CQR A;  4FBV A;  4AZO A;  3RWX A;  3KFI A;  1YWC A;  2QOS C;  3D95 A;  3RBY A;  1T0V A;  2RQ0 A;  1SRE A;  4CDE A;  2YMS A;  4CK4 A;  2OFB A;  2A13 A;  1DZP A;  3NX2 A;  3FYF A;  3D9W A;  3DTQ A;  3BDR A;  3FEN A;  4PSQ A;  2WSJ A;  5IXG A;  3WZQ A;  3WJE A;  3NAD A;  4Z27 A;  4JGL A;  2Q9S A;  3MG5 A;  1MOY A;  3HTY A;  1AVG I;  1SXW A;  2OYB O;  3APV A;  4YFR A;  1JQP A;  1LFO A;  4YCH A;  1VWM B;  5F7G A;  3AEH A;  1LUQ A;  4O3Y A;  1W5R A;  2W2B A;  1U17 A;  3NPO A;  1GKA A;  3WVM A;  3APU A;  1SRJ A;  4GDZ A;  2RTE B;  3P24 A;  4TJZ A;  2JGS A;  1SWL A;  2F01 A;  4CV7 A;  1DV9 A;  3B2L A;  3NR3 A;  2CBR A;  4LZU A;  1KFF A;  1DF8 A;  1QAB E;  2KD2 A;  2LFO A;  2RTN B;  2OY8 A;  1EXS A;  4GRJ A;  2FKJ A;  1TOU A;  2AT5 X;  3WJF A;  4QAE A;  4KC7 A;  5B5F A;  2KW1 A;  4GK9 A;  4ES7 A;  1OEK A;  1SXU A;  1FEM A;  2IZB A;  3FA8 A;  3MVF A;  3X00 A;  1YUP A;  5K67 A;  3P02 A;  3APW A;  3FR2 A;  4KII A;  5HA0 A;  3HPE A;  4ZGU A;  1LIC A;  2GTL O;  4HPA A;  1Y55 X;  4K19 A;  2Q2M A;  1MX8 A;  3E3C A;  1BRP A;  2RTF B;  1Y52 X;  2C4I A;  4NV8 A;  4WBK A;  3UEW A;  2A3F X;  1EII A;  3WZO A;  2R73 A;  1SWT A;  3NP1 A;  1IKE A;  2A8G A;  4GKC A;  2RTQ B;  1IKJ A;  2RA6 A;  2WQA E;  2F09 A;  2X45 A;  4RUU A;  2IFB A;  1JZU A;  1SWG A;  2K62 A;  1Y9T A;  1VWI B;  3AKN A;  4OEL A;  5LKE A;  1OBP A;  1SWH A;  4CSB A;  1Y9L A;  4ORR A;  3QKG A;  1VYG A;  2BS6 A;  3T2X A;  2Q4N A;  4O4S A;  2ANS A;  3WJG A;  3MM0 A;  1ZND A;  1P6P A;  2RTI B;  4KH8 A;  2WEX A;  3D4R A;  4INN A;  3FLL A;  2A2U A;  4M7M A;  3P6H A;  2Y3F A;  4OMW A;  4BX7 A;  5FQ8 E;  1KL4 A;  3CBC A;  3HK1 A;  1FTP A;  4A60 A;  1IIU A;  4MVI A;  2FS7 A;  3RDS A;  1DF3 A;  1VWJ B;  1QWD A;  1O1U A;  1QY1 A;  1ERB A;  2MJI A;  5B11 O;  4ZGF A;  1E06 A;  1KZX A;  4ML7 B;  4EKV A;  3EBK A;  2OY1 O;  3FMZ A;  4I9S A;  4CDD A;  1B4M A;  2MM3 A;  3VE1 A;  2MHD A;  4CPH B;  1DZJ A;  2JW1 A;  1HXL A;  3EC5 A;  1EPB A;  1OBQ A;  1HBP A;  1QFT A;  1GKA B;  2DM5 A;  2BS5 A;  2OVA A;  2RTC B;  4CDC A;  4ZHH A;  1B0O A;  1VWG B;  2BC3 A;  2ZAG A;  5EDB A;  1G5W A;  3IFB A;  4IB9 A;  1SLE B;  4U3Q A;  1SWE A;  2A2G A;  4QGV A;  5F1E A;  3FEP A;  1VPR A;  2CAM A;  2IZK A;  3ZZV A;  2FR3 A;  3B2J A;  3BX8 A;  3LV4 A;  1ACD A;  1BLR A;  4D6B A;  1SY3 A;  2ACO A;  2FHL A;  1RXJ A;  1SWU A;  4EXZ A;  2VDF A;  1KOI A;  1Y0G A;  2Y32 A;  2LBA A;  3LHN A;  2OL6 O;  2IZA A;  4Z2P A;  1BRQ A;  4M6S A;  5B2A O;  5LJB A;  1I06 A;  2HZR A;  4BGF A;  4NP1 A;  4JO6 A;  5L8I A;  4ALO A;  2G5L A;  2UZ2 A;  1AEL A;  4YCE A;  1X8P A;  3L4R A;  5BVS A;  1VWN B;  1VYO A;  2GJ5 A;  2OL7 A;  2WPU A;  2N93 A;  3PQS A;  4MVK A;  2AL0 X;  4B55 A;  4GUZ A;  4MIS A;  4YGH A;  1QY2 A;  4GGZ A;  2IZD B;  3RE6 A;  1BM5 A;  3WJD A;  1VYF A;  1EQD A;  2LA7 A;  5CHK A;  4ZHD A;  1KQX A;  2RTP B;  2RTB B;  2X56 A;  3GE2 A;  1OPB A;  4O3W A;  1SMP I;  3PP6 A;  3UEV A;  1OBU A;  1E02 A;  1RST B;  2EU7 X;  1LEL A;  1O1V A;  1LIF A;  2FKG A;  4ALB A;  1EUO A;  1RLB E;  2JU7 A;  5EDC A;  3WYP A;  5LJG A;  1HY2 A;  1WUB A;  2L5P A;  2FTB A;  4GZV A;  3EW2 A;  4BX7 B;  2RTL A;  5AEO A;  4LKT A;  1W6F A;  2A5B A;  1LNM A;  5D48 A;  5IO7 A;  3ZUI A;  4Z28 A;  1KL5 A;  2E4J A;  3EM0 A;  3G7X A;  5HWZ A;  5HZ8 A;  1GX3 A;  1WBI A;  3KQ0 A;  4UU2 A;  3P6G A;  4OS3 A;  3NQ9 A;  1GT1 A;  2JU3 A;  1BSY A;  1FE3 A;  3BX7 A;  1SWC A;  1VWD B;  5F58 A;  4QNI A;  1GT5 A;  1ICN A;  2HZQ A;  3ZWE A;  2IZJ A;  1EAL A;  3C76 X;  2AF5 A;  1I05 A;  4AZP A;  1N4J A;  3CBS A;  4CPF A;  5LJD A;  5IRU A;  3ZW1 A;  1FEN A;  2GTL N;  1D3S A;  3O19 A;  4EDE A;  3VG7 A;  1ERX A;  4U8U M;  4A1Y A;  2C1S A;  1E2T A;  4XME A;  2KTS A;  3TGC A;  2LB6 A;  4O4X A;  2RTG B;  3S26 A;  1UYN X;  3K3L A;  1GGL A;  4N7C A;  4QQ1 A;  3VG6 A;  2ASN X;  1Y53 X;  1ZRY A;  4QZT A;  3P6F A;  2YG2 A;  3SLT A;  4IAB A;  1LCW A;  1LCZ A;  2RTA A;  4YBU A;  5B10 O;  1YWD A;  4ORY A;  3RY1 A;  4AZM A;  3STM X;  2BT9 A;  4I3C A;  5CE4 A;  2RCQ A;  4GGR A;  1ZNH A;  5LJE A;  4XMD A;  1LPJ A;  2A0A A;  3QQ2 A;  5C0N A;  2FGS A;  1SRH A;  4YH0 A;  3WOV A;  3JSQ A;  2OZQ A;  1TVQ A;  5HBS A;  5AJB A;  3NX1 A;  1TOW A;  3WJB A;  2Y3E A;  1A3Y A;  1K3B A;  2NNQ A;  1G74 A;  2JU8 A;  5HZQ A;  5H9N A;  2FWV A;  2F73 A;  3KVN A;  3RZY A;  3TGB A;  4YGG A;  2RTJ A;  4YDB A;  3VG2 A;  4UU3 A;  1HMS A;  4KCA A;  1HQQ A;  3T1D A;  1RBP A;  3VU1 A;  1JMX A;  2AT0 X;  4Z6J A;  3P6E A;  2RTD B;  3ZW0 A;  1HQP A;  4KC8 A;  4BVM A;  4YFP A;  2W2A A;  2G78 A;  4IB7 A;  4I3D A;  4YBP A;  2DJF A;  4Z2V A;  4IMN A;  4IB8 A;  4Y0R A;  4AW8 A;  1LCV A;  1OSP O;  1VWO B;  1RXK A;  2QMI A;  3ZQ3 A;  3I0A A;  4D6A A;  1VWP B;  2ALL X;  4OS8 A;  1GX8 A;  4TNN A;  3WJC A;  4ODD A;  4FBR A;  4GNY A;  1VWK B;  2NP1 A;  3D96 A;  5D47 A;  4L3R A;  4YGZ A;  2IZC B;  1UZ2 X;  5HA1 A;  3ZW1 B;  2WWP A;  1YWB A;  3FA6 A;  1XCA A;  3VPJ E;  4O4O A;  1VWH B;  4DCB A;  2VFB A;  4ZJ0 A;  1MM9 A;  4BX6 A;  4OS0 A;  2IZF B;  2GTF X;  3HWD A;  4YDA A;  4ORU A;  3SOT A;  3UAQ A;  4ARH A;  1EW3 A;  1SWF A;  1VWE B;  2FLJ A;  3PH5 A;  1UYO X;  2O62 A;  5B5G A;  2PY1 A;  1IJ8 A;  2X32 A;  3WZP A;  3WXQ A;  5KIC A;  3RKG A;  2CZT A;  3D97 A;  3KFG A;  2XKL A;  1FDQ A;  1PM1 X;  2HLV A;  1GXA A;  4GNW A;  1W4T A;  2RCT A;  4HFO A;  4BX5 A;  2Q39 A;  4MVL A;  4NLJ A;  2RTO B;  3EBW A;  1NQN A;  2CM4 A;  4GDA A;  1A2D A;  3FR4 A;  2W2F A;  4IMO A;  3APX A;  2I5Z O;  2QO6 A;  2OY5 O;  4ZHF A;  5L8N A;  3VHH A;  4EQA C;  1G85 A;  5L8O A;  1QG5 A;  5DPQ A;  1CRB A;  4XMC A;  3PPT A;  4LKP A;  3FA7 A;  3FEL A;  1OPA A;  1PEE A;  4FGI B;  3RE5 A;  4XMG A;  1ZNL A;  1BSQ A;  3OBL A;  2QO4 A;  4YFQ A;  1E5P A;  3HWG A;  1NP1 A;  1YP6 A;  1EI5 A;  4NNS A;  5HZ9 A;  4AZN A;  1XKI A;  3TGA A;  1BJ7 A;  1YIV A;  2G79 A;  2M4L A;  3ZW0 B;  4OMX A;  3RY2 A;  4A1H A;  1N43 A;  4YVB A;  4FBO A;  4OEM A;  4QRL A;  1HXZ A;  4AYH A;  1RSU B;  1Z24 A;  1SWB A;  2AKQ A;  3P6C A;  4NNT A;  3DSZ A;  2QOM A;  1L6M A;  4PJ2 A;  5EED A;  3STN A;  4BBO A;  3C77 X;  5BVT A;  2MO5 A;  1MDC A;  1DC9 A;  2X34 A;  1DZM A;  3OE3 A;  3NQK A;  3F8A A;  3Q34 A;  1BBP A;  4GU8 A;  3T6L A;  3VG3 A;  1PBY A;  3WYQ A;  2AMM X;  3AUM O;  3CKF A;  4Y0P A;  4ZHG A;  4HPC A;  4I95 A;  1D2U A;  4HWM A;  2NND A;  1SWS A;  4I60 A;  1ICM A;  3EYC A;  3FW5 A;  3MX7 A;  4JHQ A;  4BX6 B;  1NBX A;  2WEW A;  3IA8 A;  1URE A;  1B8E A;  1SY2 A;  2X8S A;  1LIB A;  3CWK A;  2RTH B;  2RTM A;  1G7N A;  1SA8 A;  4Y59 A;  3O2Y A;  1SWD A;  1IFB A;  2OFR X;  3HOL A;  4IAX A;  1O8V A;  3FR5 A;  2R56 A;  4BX5 B;  3P6D A;  4TKJ A;  1CBI A;  4TKH A;  1FJ1 E;  3BS2 A;  3B2H A;  2ZSC A;  3KFF A;  1AVE A;  1N9M A;  2FHN X;  1I4U A;  1E00 A;  2WR6 A;  4O9S A;  4U9C A;  1SLD B;  1SRI A;  3ELX A;  4XMF A;  1N9Y A;  4WFU A;  2QO5 A;  3MBT A;  4NYR A;  5FQ7 E;  4ZR2 A;  4IBA A;  3S5X A;  5DG4 A;  2R74 A;  3U9P C;  3V8U A;  3VG5 A;  2JMB A;  3NQ3 A;  3LTW A;  2FRS A;  5EEE A;  5H8T A;  1S44 A;  2QM9 A;  4CPE A;  2OVS A;  1SY1 A;  2G7B A;  1X89 A;  4HPB A;  1S2P A;  5FEN A;  2HKD A;  3S5V A;  3T6F A;  1GT3 A;  2L67 A;  1NC9 A;  4OKA A;  2WUT A;  4NV7 A;  5HZ5 A;  1HMR A;  4C5P A;  2IZG B;  3VE2 A;  2GTL M;  3VG4 A;  1SXY A;  1TW4 A;  4KT5 A;  1ZNK A;  1VWC B;  1A18 A;  1NP4 A;  4GJV A;  4LZV A;  2Q2P A;  1GT4 A;  1KT7 A; 
#chains in the Genus database with same CATH homology
 3FEK A;  3HOE A;  1JBH A;  5HAE A;  1YWA A;  1AQB A;  3BRN A;  4TKB A;  4GET A;  3JQO A;  2ACP X;  4AZQ A;  3O22 A;  4O4U A;  5EPQ A;  3U0D A;  1OEE A;  3GAQ A;  4IB6 A;  4ORX A;  3PEC A;  4NLI A;  5D4A A;  1JYJ A;  5BYP A;  1HN2 A;  5HZ6 A;  1JIW I;  2HNX A;  2JOZ A;  3FIQ A;  3PQU A;  1X8O A;  3TZS A;  5LJH A;  3ZI8 A;  1BSO A;  1S7D A;  3BSZ E;  3I17 A;  4QZU A;  3C78 X;  4WHI A;  5BVQ A;  3EMM A;  1CJ5 A;  1ZNE A;  1OEJ A;  2BLG A;  2X8F A;  4ZFX A;  1H91 A;  5HCD C;  4EEJ A;  1KXO A;  2POA A;  1KQW A;  1KT4 A;  1DZK A;  2OVD A;  4Y0S A;  4U8U O;  1MX7 A;  5H9A A;  5LJC A;  5B29 A;  2GC9 A;  5B27 A;  1X8N A;  5FFH A;  1CBQ A;  4IAW A;  5LKF A;  3OJY C;  1CBS A;  1KT6 A;  1ZNG A;  2LBV A;  1U0X A;  3ZW2 A;  1KGL A;  5F6Z A;  2Z4I A;  4COT A;  3OD9 A;  2LKK A;  1TXL A;  4I6S A;  1R0U A;  3BU1 A;  4NW4 A;  1MUP A;  4QGW A;  4TLJ A;  1QFV A;  2K23 A;  4ZHC A;  5LJK A;  1JJX A;  5H9K A;  5HTE A;  3HWE A;  3FA9 A;  2BHV A;  4BOE A;  1HMT A;  4Y0Q A;  2FR2 A;  2JN3 A;  5EZ2 A;  1JV4 A;  1MVG A;  1SXX A;  2RN4 A;  2HYS A;  5HTD A;  2FS6 A;  5KHP A;  3F6Z B;  2WQ9 A;  2FT9 A;  3CQN A;  1YP7 A;  1BEB A;  2CZU A;  2RD7 C;  3PH6 A;  1AB0 A;  4A8Z A;  1ADL A;  5HCC C;  4L1N A;  2AH7 X;  1KZW A;  3KFH A;  5D45 A;  4O49 A;  4YKO A;  3SAO A;  4ON1 A;  3ZUO A;  4YKM A;  4O3Z A;  1A57 A;  3U03 A;  1ML7 A;  2HMB A;  3AKM A;  4QYP A;  4R0B A;  5JR8 A;  5F6B A;  5K06 A;  1T8V A;  2OVE A;  4I3B A;  4MIR A;  3KZA A;  1EPA A;  4QGX A;  4AZR A;  3B2K A;  3Q6L A;  3S60 A;  3WBG A;  4I9R A;  4HPD A;  4DQ4 A;  4GH7 A;  1GM6 A;  3ELZ A;  1IW2 A;  1LIE A;  1JYD A;  2X8T A;  4TQ2 A;  3B2I A;  4YMY A;  2AT6 X;  1EIO A;  4ZH6 A;  1DFV A;  1B56 A;  4ORS A;  1X8U A;  3JS1 A;  4FQB B;  4DQ3 A;  3H3I A;  1KT5 A;  2NNE A;  4QYN A;  4ID2 A;  4ORW A;  1T68 X;  3N91 A;  1HBQ A;  3RSW A;  2XST A;  3UEX A;  2MWH A;  2Z4H A;  4MVE A;  5CYB A;  1NGL A;  1PMP A;  5D8J A;  5FQ6 E;  1BWY A;  5AJC A;  1GX9 A;  5KID A;  1QQS A;  3NBX X;  1LID A;  1LF7 A;  3BY0 A;  2ZAI A;  2L68 A;  4NYQ A;  1X71 A;  2KT4 B;  2P8G A;  1ALB A;  3FW4 A;  3PED A;  1U18 A;  4ZH9 A;  3STK A;  2CBS A;  4GE1 A;  2AT3 X;  4BQU A;  3F9D A;  2X46 A;  1SY0 A;  3HWF A;  2KTD A;  1I04 A;  2AT8 X;  1FEL A;  1KT3 A;  4WFV A;  3BLG A;  5AQ6 A;  5IO6 A;  1IFC A;  1JJJ A;  2CM9 A;  1LKE A;  4XMH A;  5HCE C;  3UEU A;  5H9L A;  5IO5 A;  4O3X B;  4U8U N;  1PBO A;  1QY0 A;  3CR6 A;  4LQZ A;  2L9C A;  4RUN A;  4QGV A;  1CBR A;  4ZCB A;  5FAZ A;  2OFM X;  3BU9 A;  1X8Q A;  4EFG A;  3TF6 A;  3CMP A;  1N0S A;  3CQR A;  4FBV A;  4AZO A;  3RWX A;  3KFI A;  1YWC A;  2QOS C;  3D95 A;  3RBY A;  1T0V A;  2RQ0 A;  2YMS A;  4CK4 A;  2A13 A;  1DZP A;  3NX2 A;  3FYF A;  3DTQ A;  3FEN A;  3BDR A;  4PSQ A;  2WSJ A;  3WJE A;  3NAD A;  4JGL A;  2Q9S A;  3HTY A;  1AVG I;  1SXW A;  4YFR A;  3APV A;  1LFO A;  4YCH A;  5F7G A;  4O3Y A;  2W2B A;  1U17 A;  3NPO A;  1GKA A;  3WVM A;  3APU A;  4GDZ A;  3P24 A;  4TJZ A;  4CV7 A;  1DV9 A;  3B2L A;  3NR3 A;  2CBR A;  4LZU A;  1QAB E;  2KD2 A;  2LFO A;  1EXS A;  4GRJ A;  1TOU A;  2AT5 X;  3WJF A;  4QAE A;  4KC7 A;  2KW1 A;  4GK9 A;  4ES7 A;  1OEK A;  1SXU A;  1FEM A;  3FA8 A;  3MVF A;  1YUP A;  3P02 A;  3APW A;  3FR2 A;  4KII A;  5HA0 A;  4ZGU A;  1LIC A;  2GTL O;  4HPA A;  4K19 A;  2Q2M A;  1MX8 A;  3E3C A;  1BRP A;  4WBK A;  3UEW A;  1EII A;  2A3F X;  2R73 A;  3NP1 A;  1IKE A;  4GKC A;  1IKJ A;  2RA6 A;  2WQA E;  2F09 A;  2X45 A;  4RUU A;  2IFB A;  1JZU A;  2K62 A;  1Y9T A;  3AKN A;  5LKE A;  1OBP A;  4CSB A;  1Y9L A;  4ORR A;  3QKG A;  1VYG A;  2BS6 A;  2Q4N A;  4O4S A;  2ANS A;  3WJG A;  1ZND A;  1P6P A;  4N7D A;  4KH8 A;  2WEX A;  3D4R A;  4INN A;  3FLL A;  2A2U A;  4M7M A;  3P6H A;  4OMW A;  5FQ8 E;  3CBC A;  3HK1 A;  1FTP A;  4A60 A;  1IIU A;  4MVI A;  2FS7 A;  1DF3 A;  1QWD A;  1O1U A;  1QY1 A;  2MJI A;  1ERB A;  4ZGF A;  1KZX A;  1E06 A;  4ML7 B;  3EBK A;  3FMZ A;  4I9S A;  1B4M A;  2MM3 A;  3VE1 A;  2MHD A;  1DZJ A;  2JW1 A;  1EPB A;  2DM5 A;  1OBQ A;  1HBP A;  1GKA B;  1QFT A;  2BS5 A;  2OVA A;  4ZHH A;  1B0O A;  5EDB A;  2ZAG A;  3IFB A;  4IB9 A;  4U3Q A;  2A2G A;  5F1E A;  3FEP A;  1VPR A;  3ZZV A;  2FR3 A;  3B2J A;  3BX8 A;  3LV4 A;  1ACD A;  1BLR A;  4D6B A;  1SY3 A;  2ACO A;  4EXZ A;  1KOI A;  2LBA A;  3LHN A;  1BRQ A;  4M6S A;  5LJB A;  1I06 A;  2HZR A;  4NP1 A;  5L8I A;  4ALO A;  1AEL A;  4YCE A;  1X8P A;  3L4R A;  5BVS A;  4MVK A;  3PQS A;  2GJ5 A;  1G5W A;  2N93 A;  2AL0 X;  4MIS A;  4YGH A;  1QY2 A;  1BM5 A;  3WJD A;  1VYF A;  1EQD A;  2LA7 A;  4ZHD A;  1KQX A;  4O3W A;  3GE2 A;  1OPB A;  1SMP I;  3PP6 A;  3UEV A;  1OBU A;  1E02 A;  2EU7 X;  1O1V A;  4ALB A;  1LIF A;  1EUO A;  1RLB E;  2JU7 A;  5EDC A;  5LJG A;  2L5P A;  4GZV A;  2FTB A;  5AEO A;  4LKT A;  1LNM A;  5D48 A;  5IO7 A;  3ZUI A;  2E4J A;  3EM0 A;  3G7X A;  5HWZ A;  5HZ8 A;  3KQ0 A;  4UU2 A;  3P6G A;  4OS3 A;  3NQ9 A;  1GT1 A;  2JU3 A;  1BSY A;  1FE3 A;  3BX7 A;  5F58 A;  4QNI A;  1GT5 A;  1ICN A;  2HZQ A;  3ZWE A;  1EAL A;  3C76 X;  4AZP A;  1I05 A;  3CBS A;  5LJD A;  3ZW1 A;  1FEN A;  2GTL N;  1D3S A;  3O19 A;  4EDE A;  3VG7 A;  1ERX A;  4U8U M;  4A1Y A;  4XME A;  2KTS A;  3TGC A;  2LB6 A;  4O4X A;  3S26 A;  4N7C A;  3K3L A;  1GGL A;  4QQ1 A;  3VG6 A;  2ASN X;  1ZRY A;  4QZT A;  3P6F A;  2YG2 A;  4IAB A;  4YBU A;  1YWD A;  4ORY A;  4AZM A;  3STM X;  2BT9 A;  4I3C A;  5CE4 A;  2RCQ A;  1ZNH A;  5LJE A;  4XMD A;  1LPJ A;  2A0A A;  5C0N A;  4YH0 A;  3WOV A;  3JSQ A;  2OZQ A;  1TVQ A;  5HBS A;  5AJB A;  3NX1 A;  1TOW A;  3WJB A;  1A3Y A;  5HZQ A;  2NNQ A;  1G74 A;  2JU8 A;  5H9N A;  2FWV A;  2F73 A;  3RZY A;  3TGB A;  4YGG A;  4YDB A;  3VG2 A;  4UU3 A;  1HMS A;  4KCA A;  3T1D A;  1RBP A;  3VU1 A;  2AT0 X;  3P6E A;  4BVM A;  3ZW0 A;  1HQP A;  4KC8 A;  4YFP A;  2W2A A;  2G78 A;  4IB7 A;  4I3D A;  4YBP A;  4IMN A;  4IB8 A;  4Y0R A;  4AW8 A;  4D6A A;  2QMI A;  3ZQ3 A;  3I0A A;  2ALL X;  4OS8 A;  1GX8 A;  4TNN A;  3WJC A;  4ODD A;  4FBR A;  4GNY A;  2NP1 A;  3D96 A;  5D47 A;  4L3R A;  4YGZ A;  1UZ2 X;  5HA1 A;  3ZW1 B;  2WWP A;  1YWB A;  3FA6 A;  1XCA A;  3VPJ E;  4O4O A;  4ZJ0 A;  4OS0 A;  2GTF X;  3HWD A;  4YDA A;  4ORU A;  3SOT A;  3UAQ A;  4ARH A;  1EW3 A;  2FLJ A;  3PH5 A;  2O62 A;  2PY1 A;  3WXQ A;  5KIC A;  3RKG A;  2CZT A;  3D97 A;  3KFG A;  2XKL A;  1FDQ A;  1PM1 X;  2HLV A;  1GXA A;  4GNW A;  2RCT A;  4HFO A;  2Q39 A;  4MVL A;  4NLJ A;  3EBW A;  2CM4 A;  1A2D A;  3FR4 A;  2W2F A;  4IMO A;  3APX A;  4ZHF A;  2QO6 A;  5L8N A;  4EQA C;  1G85 A;  5L8O A;  1QG5 A;  5DPQ A;  1CRB A;  4XMC A;  3PPT A;  4LKP A;  3FA7 A;  3FEL A;  1OPA A;  1PEE A;  4FGI B;  4XMG A;  1ZNL A;  1BSQ A;  3OBL A;  2QO4 A;  4YFQ A;  1E5P A;  3HWG A;  1NP1 A;  1YP6 A;  1EI5 A;  4NNS A;  5HZ9 A;  4AZN A;  1XKI A;  3TGA A;  1BJ7 A;  1YIV A;  2G79 A;  2M4L A;  3ZW0 B;  4OMX A;  4A1H A;  4FBO A;  4QRL A;  4AYH A;  1Z24 A;  3P6C A;  4NNT A;  2AKQ A;  3STN A;  3DSZ A;  4PJ2 A;  1L6M A;  5EED A;  5BVT A;  3C77 X;  2MO5 A;  1MDC A;  1DC9 A;  1DZM A;  3OE3 A;  3NQK A;  3F8A A;  3VG3 A;  1BBP A;  4GU8 A;  2AMM X;  4ZHG A;  4Y0P A;  4HPC A;  4I95 A;  1D2U A;  4HWM A;  2NND A;  1ICM A;  3EYC A;  3FW5 A;  3MX7 A;  2WEW A;  3IA8 A;  1URE A;  1B8E A;  1SY2 A;  2X8S A;  1LIB A;  3CWK A;  1G7N A;  1SA8 A;  3O2Y A;  1IFB A;  2OFR X;  3HOL A;  4IAX A;  1O8V A;  3FR5 A;  2R56 A;  3P6D A;  4TKJ A;  1CBI A;  4TKH A;  3BS2 A;  3B2H A;  3KFF A;  4U9C A;  4O9S A;  1I4U A;  1E00 A;  2WR6 A;  4XMF A;  3ELX A;  4WFU A;  2QO5 A;  3MBT A;  4NYR A;  5FQ7 E;  4ZR2 A;  4IBA A;  3S5X A;  5DG4 A;  2R74 A;  3U9P C;  3V8U A;  3VG5 A;  2JMB A;  3NQ3 A;  5EEE A;  2FRS A;  5H8T A;  1S44 A;  2QM9 A;  2OVS A;  1SY1 A;  2G7B A;  1X89 A;  4HPB A;  1S2P A;  5FEN A;  3S5V A;  1GT3 A;  2L67 A;  2WUT A;  5HZ5 A;  1HMR A;  3VE2 A;  2GTL M;  3VG4 A;  1SXY A;  1TW4 A;  4KT5 A;  1ZNK A;  1A18 A;  1NP4 A;  4LZV A;  2Q2P A;  1GT4 A;  1KT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...