1EIIA

Nmr structure of holo cellular retinol-binding protein ii
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
134
structure length
134
Chain Sequence
MTKDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKIIVQDGDNFKTKTNSTFRNYDLDFTVGVEFDEHTKGLDGRNVKTLVTWEGNTLVCVQKGEKENRGWKQWVEGDKLYLELTCGDQVCRQVFKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of retinol induces changes in rat cellular retinol-binding protein II conformation and backbone dynamics.
pubmed doi rcsb
molecule keywords CELLULAR RETINOL-BINDING PROTEIN II
molecule tags Transport protein
source organism Rattus norvegicus
total genus 11
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2000-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1eiiA00
2G79A 3FEKA 4GETA 1KT7A 1KZXA 1QWDA 4YBPA 1GXAA 3FELA 2HMBA 3ELZA 4NNTA 1G7NA 4WFUA 3WJCA 3HK1A 5F1EA 5D4AA 1GX9A 2AMMX 4NNSA 5HTEA 1OPAA 4YH0A 4LKTA 3VG3A 1PM1X 4QGWA 3PPTA 2GTFX 1HMTA 3C76X 4NP1A 1VYGA 3O19A 2KT4B 1ZNDA 1PMPA 3KFIA 4BVMA 1HQPA 3FA8A 1SXUA 5B27A 4NYRA 1BLRA 1KGLA 4IAXA 4EFGA 1AVGI 3L4RA 4PSQA 5BVSA 4TQ2A 4LZUA 5EEEA 3TGBA 2Q2MA 1X89A 5F7GA 1VPRA 4ZH6A 4BOEA 4A1HA 1FENA 1BRPA 1TXLA 2XSTA 1YP6A 3FLLA 3C78X 4ZHDA 2GJ5A 4WFVA 4YGZA 3VG4A 4MVIA 2LKKA 3CBSA 1KT6A 5L8IA 4ZH9A 1FE3A 3EBWA 1CBQA 1ERBA 3CBCA 2R56A 2AT6X 2A0AA 1U18A 4RUUA 4YGGA 5LJGA 1ZNLA 4AZNA 1I05A 1ZNKA 3P6CA 3WJGA 3APUA 1Z24A 1X8QA 2YG2A 3FA9A 4GKCA 1HMSA 1SY0A 1GKAA 2FS6A 1JJJA 3HWGA 3STKA 3JS1A 1IKJA 1D2UA 4IB7A 3G7XA 4QGVA 3HWEA 2AL0X 5F6BA 1CRBA 4AW8A 4YFQA 3U9PC 5HZ5A 4TKHA 4ZFXA 5LJKA 4HPCA 3NPOA 1UREA 4N7DA 3MBTA 1DZPA 2NNQA 5H8TA 1I06A 3BY0A 3MVFA 4I9SA 3RZYA 3P6HA 1BJ7A 1BM5A 1IFBA 2ANSA 4EXZA 1KXOA 4XMHA 1LNMA 3NX2A 2N93A 1E00A 1G85A 4YKMA 1KT4A 1LIBA 1QG5A 1O8VA 1N0SA 2RCQA 5HWZA 3O2YA 1TW4A 3B2LA 1BWYA 5FAZA 1AELA 1XKIA 3FENA 1RLBE 5D45A 3TGCA 2AKQA 3Q6LA 1QFTA 4TKJA 5K06A 1YP7A 3K3LA 4CK4A 4YKOA 1JBHA 2AT0X 3F9DA 2MO5A 3KZAA 3P6DA 4LZVA 4YGHA 1JYJA 4QAEA 3VG5A 1KT5A 3UEVA 2L5PA 3EYCA 3FW5A 2MM3A 2MJIA 1KQWA 2W2BA 2NP1A 2NNDA 1KOIA 3FIQA 1EALA 2ASNX 1BSQA 4QZUA 1S2PA 1EPBA 4YCEA 1LFOA 2NNEA 5LJDA 1CBIA 4Y0RA 4AZOA 3ZUIA 3AKNA 3APWA 1EQDA 1GX8A 2WR6A 5JR8A 3NQ3A 3KFHA 4AZQA 4RUNA 2Q2PA 2QO4A 4TJZA 4GRJA 4UU3A 1LPJA 1ERXA 3STNA 3TF6A 1IIUA 4IBAA 3DSZA 4Y0SA 1LICA 3FEPA 1A3YA 4ZHCA 2ACOA 3RSWA 1EXSA 1OBPA 3BU9A 1GKAB 5LKEA 3NADA 2HYSA 1E5PA 2AT8X 4ORXA 5EZ2A 2QOSC 4YFRA 1JJXA 1O1UA 1JYDA 2F73A 4YFPA 2JN3A 4QGXA 5HTDA 4ORWA 1IKEA 2W2FA 4AZPA 1FELA 1ADLA 1X71A 1DZKA 5D48A 5IO6A 2XKLA 2HLVA 5HZ9A 4ZCBA 4D6BA 2GC9A 3IA8A 4XMGA 1AQBA 2QO6A 2X46A 1QQSA 3WBGA 3ZUOA 1SXWA 4GE1A 4IB8A 5LKFA 1OEEA 1U0XA 4D6AA 5LJHA 1SY2A 2L68A 4M6SA 3KFFA 3U0DA 1DFVA 4EDEA 5HAEA 3O22A 3I0AA 1B8EA 2DM5A 4YDAA 4HPBA 2A2GA 3IFBA 1QY2A 4GH7A 2HNXA 3CR6A 1P6PA 4I3BA 4O9SA 4HPDA 5H9AA 1MDCA 5HZ6A 4EEJA 4KIIA 2OFRX 2FR3A 1G74A 5L8NA 2LBVA 2CBSA 1MVGA 4XMFA 1HMRA 5H9KA 1PBOA 1ALBA 4IAWA 3PEDA 1LIDA 2JU7A 4BQUA 1LKEA 3T1DA 2FWVA 3PECA 3STMX 5LJEA 1FDQA 4NYQA 3UEWA 5BVQA 4ZHGA 2PY1A 1EUOA 4IMOA 4MVKA 5LJBA 2RD7C 4OS0A 3UEUA 3APVA 3NR3A 5F6ZA 2A3FX 4OMXA 3CQNA 1LIFA 2CM9A 2AT5X 2CM4A 1LIEA 2L9CA 4A60A 2LB6A 3FR2A 5FENA 5FFHA 4XMCA 4LKPA 1YWDA 4IB6A 1BEBA 1OBUA 1X8UA 4A1YA 3OJYC 1VYFA 4NLJA 3CWKA 1DZJA 2JU8A 3GAQA 4GNWA 4YCHA 4I3CA 1ZNGA 2WWPA 5D47A 4M7MA 1EPAA 1OEJA 3NQ9A 1YIVA 5EDCA 1ICNA 4N7CA 2AT3X 1YWBA 2POAA 3WJBA 4Y0PA 3F8AA 5EDBA 1E02A 4DQ3A 3BU1A 1CBSA 2O62A 3I17A 1ZNEA 5C0NA 1MX8A 4R0BA 3SAOA 3HWFA 3APXA 2RA6A 1LF7A 3BLGA 1D3SA 1EW3A 4XMEA 1T0VA 4HFOA 5DG4A 3FW4A 5HCDC 4A8ZA 1SXYA 3D95A 5EPQA 2OVEA 3EMMA 1U17A 3VG6A 2EU7X 1ZNHA 1S44A 5HCEC 1FTPA 1BBPA 2AH7X 5D8JA 1NGLA 5L8OA 4ORRA 3CMPA 2KTDA 1T8VA 3ELXA 3U03A 1YWCA 2CZTA 2FLJA 4QYPA 2R74A 4I9RA 3AKMA 4QZTA 2A2UA 3BS2A 3VG2A 5KIDA 1TOUA 3P6FA 1B4MA 3JSQA 3ZQ3A 1QY1A 1X8OA 2W2AA 5F58A 1QFVA 3PP6A 1S7DA 3B2HA 5HA0A 3FMZA 4HPAA 4ODDA 2RQ0A 3NX1A 1KT3A 5HZ8A 1DZMA 5CE4A 1GT5A 2Q4NA 1GT1A 1QABE 1R0UA 2FRSA 2JU3A 1DC9A 4DQ4A 2RCTA 4ORUA 1E06A 2X45A 1O1VA 4QYNA 4YMYA 1B0OA 1JV4A 4AZRA 1KQXA 2OFMX 1EIOA 1ML7A 4ZHHA 4ES7A 5HZQA 1T68X 2FR2A 1YUPA 3BDRA 5EEDA 1I04A 1OEKA 1XCAA 3BSZE 3DTQA 1CBRA 2WEXA 2WSJA 2G78A 3C77X 3HWDA 1QY0A 1A2DA 2LBAA 5LJCA 1GT3A 1BSYA 5HA1A 1HN2A 3KQ0A 2OVAA 3WJDA 3B2JA 2CZUA 4ORYA 5IO7A 1L6MA 2FS7A 4GNYA 4ALBA 4XMDA 3WJEA 4AYHA 2Q9SA 3EM0A 5H9NA 1OBQA 1SA8A 1DV9A 2FT9A 1MX7A 1OPBA 1IFCA 3S26A 3UEXA 1DF3A 4ZJ0A 5AQ6A 1A18A 1EIIA 1RBPA 4TLJA 3FR4A 2QM9A 1H91A 4TNNA 1X8PA 1SY3A 4ZHFA 1SY1A 1BSOA 2R73A 4YDBA 1ZRYA 4ALOA 1CJ5A 2QO5A 3VG7A 1TOWA 2HZRA 4IMNA 3TGAA 5IO5A 1TVQA 3KFGA 3FA6A 1IW2A 1AB0A 2K23A 3WXQA 2IFBA 2WUTA 2FTBA 2BLGA 3NP1A 5B29A 1NP4A 4K19A 2ALLX 2WQ9A 3EBKA 3P6EA 1GT4A 5KHPA 3WJFA 1NP1A 4OS8A 2A13A 2G7BA 2WQAE 3FA7A 4TKBA 5HBSA 1KZWA 4ARHA 2OZQA 1I4UA 1YWAA 1SXXA 4IB9A 1GM6A 4I3DA 3B2KA 3FR5A 1BRQA 3BX8A 2ACPX 3BX7A 4ZR2A 2HZQA 1GGLA 2WEWA 5KICA 1HBPA 2LFOA 4ZGUA 2JOZA 4MVLA 2K62A 4Y0QA 2CBRA 3CQRA 2Q39A 3WVMA 1X8NA 2OVDA 4AZMA 4YBUA 1FEMA 3PH6A 5HCCC 4NLIA 1JZUA 3D96A 5DPQA 1UZ2X 5H9LA 4OMWA 1B56A 1HBQA 4OS3A 1MUPA 3TZSA 2E4JA 3P6GA 3QKGA 2L67A 3PH5A 1A57A 1G5WA 4ORSA 4WBKA 1ICMA 1ACDA 3D97A 3B2IA 3BRNA 1PEEA 5BVTA 2P8GA 4UU2A
chains in the Genus database with same CATH superfamily
2G79A 3FEKA 3FDCA 1KT7A 4GETA 1QWDA 4O3ZA 1KZXA 5FQ8E 4YBPA 1GXAA 3FELA 4CDFA 2HMBA 3ELZA 2FKGA 1G7NA 1Y55X 2AF5A 2C1SA 4NNTA 3HK1A 4O3YA 1VWLB 4WFUA 2QMIA 5D4AA 1GX9A 2AMMX 1Y0GA 2Z4IA 4NNSA 5F1EA 5HTEA 1OPAA 3UAQA 1N9YA 4YH0A 4LKTA 3VG3A 2Y32A 3E3CA 4Z2OA 1PM1X 4QGWA 3LTWA 3PPTA 2G5LA 3VPJE 2GTFX 1HMTA 1LCZA 3C76X 4NP1A 1KL3A 1VYGA 2Z4HA 3O19A 4GDAA 2KT4B 1ZNDA 3S5VA 3T2WA 4GU8A 1PMPA 3KFIA 4BVMA 1HQPA 1NQMA 3FA8A 1SXUA 5B27A 4NYRA 1BLRA 1KGLA 3RBYA 2A5CA 4Z27A 4IAXA 4EFGA 1AVGI 3L4RA 4PSQA 5BVSA 2RN4A 4TQ2A 4LZUA 5EEEA 2C1QA 2OY8A 1NDJA 1JQPA 2Q2MA 2X8FA 3TGBA 2RTLA 1X89A 5F7GA 1VPRA 1PBYA 4ZH6A 4BOEA 3PDFA 4BX5A 4A1HA 1FENA 2RTCB 1BRPA 1TXLA 3SLOA 2XSTA 1W6FA 1YP6A 2JMBA 3FLLA 3HOLA 4Z28A 3C78X 4ZHDA 2GJ5A 4WFVA 2M4LA 4B55A 3HTYA 4OEMA 4YGZA 1SWAA 2X4MA 2LKKA 1SLFB 3CBSA 1KT6A 2DJGA 4MVIA 4U9CA 3T6LA 5L8IA 4ZH9A 1FE3A 1SWHA 3EBWA 4CPHA 1CBQA 3FIDA 1ERBA 2RTRB 3CBCA 2R56A 4EQAC 2AT6X 5AJBA 3WZPA 2A0AA 3RDXA 1U18A 4RUUA 4YGGA 5LJGA 3VE2A 1SWBA 1ZNLA 2PI3O 4AZNA 1I05A 1ZNKA 2IZIA 1WUBA 3NQKA 3P6CA 2JGSA 3PK2A 3WJGA 3APUA 1Z24A 1E2TA 3WZQA 1X8QA 4KH8A 2YG2A 3FA9A 4GKCA 1HMSA 1SY0A 1GKAA 2FS6A 4GGRA 5F2BA 1JJJA 3HWGA 3STKA 3JS1A 1IKJA 1D2UA 2OL8O 4IB7A 3G7XA 2F01A 4QGVA 1VWGB 3HWEA 2F09A 2AL0X 2IZCB 3OBLA 1CRBA 4O4UA 5F6BA 4AW8A 4YFQA 3U9PC 5HZ5A 4TKHA 4ZFXA 1Y52X 2GTLN 4BCSA 5LJKA 2OF8A 4HPCA 1NBXA 2BT9A 2BSZA 5IXGA 3NPOA 1UREA 1JMXA 4N7DA 1SRIA 1DZPA 3MBTA 4U8UN 2NNQA 5H8TA 1I06A 3BY0A 3MVFA 4I9SA 3RZYA 3P6HA 1LDOA 1BJ7A 2VFBA 4YVBA 4QRLA 1BM5A 1IFBA 5BYPA 2ANSA 4EXZA 4CPEA 1KXOA 4XMHA 1LNMA 2RTHB 3NX2A 2N93A 1E00A 1G85A 4YKMA 1KT4A 1LIBA 2JW1A 5B11O 1LDQA 1O8VA 1W4TA 1N0SA 1QG5A 2RCQA 3O2YA 5HWZA 1LUQA 1TW4A 3B2LA 5FAZA 1BWYA 2I5ZO 4IABA 1XKIA 3P24A 1AELA 3FENA 2A8GA 1RLBE 5D45A 4Z2VA 3TGCA 2AKQA 3Q6LA 1SWTA 1QFTA 4GDZA 4TKJA 1SWCA 5K06A 2X56A 1YP7A 3K3LA 3AEHA 4CK4A 4YKOA 3GE2A 1SWGA 1UYNX 2AT0X 3F9DA 2MO5A 3KZAA 3P6DA 4LZVA 4YGHA 4KCAA 3ZW0A 1JYJA 4QAEA 3VG5A 1KT5A 3S5XA 4O3XB 3UEVA 1VWRB 2L5PA 3EYCA 3FW5A 2MM3A 2MJIA 2HKDA 1W5RA 2RTBB 1KQWA 4KC8A 2W2BA 2NP1A 2NNDA 1KOIA 3FIQA 1EALA 2IZAA 4BX6A 2ASNX 3WZOA 1BSQA 2IZHB 4QZUA 1S2PA 3FYFA 1EPBA 4YCEA 5K68A 1PTSA 1VWOB 1LFOA 2KW1A 1STRB 2NNEA 2FGSA 5LJDA 3RDSA 5L3YA 1CBIA 4Y0RA 4AZOA 3ZUIA 3AKNA 3APWA 1EQDA 3D9WA 1GX8A 2WR6A 5JR8A 4COTA 3NQ3A 3KFHA 2YMSA 4AZQA 2QOMA 3SOTA 4Z6JA 4RUNA 1UYOX 2Q2PA 3VGWA 2QO4A 4TJZA 1N4JA 4GRJA 4UU3A 1LPJA 1IJ8A 1ERXA 2RTAA 3STNA 3TF6A 4IRWA 1VWJB 1IIUA 4IBAA 3DSZA 4Y0SA 2RTEB 1LICA 4GJVA 1RSTB 3RY1A 3KVNA 4FBVA 3FEPA 1A3YA 4ZHCA 3AUMO 2ACOA 3RSWA 1EXSA 1OBPA 3BU9A 1GKAB 5LKEA 1SWJA 3NADA 3WYQA 2HYSA 5CYBA 1HXZA 3RDUA 1E5PA 2AT8X 4JNJA 4ORXA 1VWNB 4L3RA 5EZ2A 1K3BA 2QOSC 4WHIA 4YFRA 1SRHA 1O1UA 1JJXA 1RXHA 4EKVA 2X8TA 2ZSCA 1JYDA 2F73A 2OVSA 1DF8A 4ML7B 5B3MO 3RWXA 4BX7A 4YFPA 2JN3A 4QGXA 5HTDA 4ORWA 1IKEA 2W2FA 4AZPA 1N7YA 1FELA 2OL6O 1VWCB 1ADLA 1X71A 2WPUA 1DZKA 1SLGB 2RTOB 4C5PA 3SZIA 2X8SA 5D48A 3WJCA 1SWNA 2XKLA 2HLVA 2IZDB 5IO6A 5HZ9A 1Y53X 4ZCBA 2OY1O 2RTPB 2GC9A 4D6BA 2ZAIA 3IA8A 4XMGA 5IRUA 1AQBA 5IRWA 1VWPB 2QO6A 1JJUA 2X46A 4U46A 1QQSA 3WBGA 3ZUOA 1FJ1E 1SXWA 2X34A 3N91A 1OEEA 1U0XA 4GE1A 4IB8A 5LKFA 2IZBA 3VU1A 1RAVA 2X32A 2BHVA 1SY2A 2L68A 4M6SA 4NW4A 1SWLA 3KFFA 2BC3A 3U0DA 1DFVA 2RTKA 4EDEA 1SWRA 2X55A 3O22A 3I0AA 1B8EA 5HAEA 2DM5A 2A5BA 4HPBA 4YDAA 2A2GA 3EC5A 3IFBA 1QY2A 3ZZVA 4PJ2A 4GH7A 2FHNX 2UYWA 2HNXA 3CR6A 2GTLM 1P6PA 2KTSA 4FGIB 4HPDA 4I3BA 4O9SA 4ON1A 5H9AA 3OD9A 1MDCA 1GX3A 2LA7A 5HZ6A 4EEJA 3F6ZB 3CKFA 4KIIA 2OFRX 2FR3A 4U8UM 1RXJA 4U3QA 5B5FA 2RTJA 1G74A 4HWMA 4ZGFA 1KFFA 5L8NA 3NBXX 2LBVA 2CBSA 1MVGA 4XMFA 1HMRA 1RSUB 4GGZA 2IZEB 3MX7A 5H9KA 1PBOA 3RE5A 1ALBA 4IAWA 4O3WA 2ZAGA 3PEDA 3RDQA 3T2XA 4QQ1A 2I5VO 5LJHA 1LIDA 2JU7A 3QQ2A 5K67A 4BQUA 1LKEA 4GUZA 3T1DA 2FWVA 2OF9A 3PECA 3STMX 5LJEA 1FDQA 4NYQA 3UEWA 3ZW1B 2MHDA 2IZJA 5BVQA 1VWKB 4ZHGA 4OELA 2PY1A 1EUOA 4IMOA 4MVKA 3SZHA 5LJBA 2RD7C 4OS0A 3UEUA 4CPIA 3APVA 3NR3A 5F6ZA 2A3FX 4OMXA 3CQNA 1LIFA 1N9MA 1SREA 2AT5X 2CM9A 2CM4A 2RTFB 1LIEA 2L9CA 4A60A 4GGTA 2C4IA 2LB6A 3SZJA 1VWDB 3FR2A 5JD2A 5FENA 2RTNB 5FFHA 2GTLO 1N43A 3Q34A 4XMCA 4LKPA 4BGFA 4CDDA 1YWDA 4IB6A 4QNIA 4GJSA 2GH7A 1VYOA 1BEBA 1OBUA 1X8UA 4A1YA 4U8UO 3OJYC 1VYFA 4JGLA 2VFCA 4NLJA 5FQ6E 3VHIA 1LELA 1SLEB 1STPA 3V8UA 3CWKA 1DZJA 2JU8A 3GAQA 3PQUA 1VWEB 4GNWA 4YCHA 4I3CA 1ZNGA 2WWPA 5D47A 4FBRA 1AVEA 1EPAA 4M7MA 1OEJA 3NQ9A 1YIVA 2BS5A 2IZGB 3RKGA 5EDCA 1ICNA 4N7CA 2AT3X 2Y3EA 4DCBA 1YWBA 2OL7A 2POAA 4MISA 4BX5B 3WJBA 5B10O 3MG5A 3RDOA 2RTIB 4Y0PA 3F8AA 5EDBA 1E02A 4DQ3A 3BU1A 1CBSA 2O62A 3I17A 1ZNEA 4D6AA 5C0NA 1MX8A 4R0BA 3SAOA 3HWFA 3APXA 2RA6A 1LF7A 2FKJA 3BLGA 3OE3A 2G8CO 4CPHB 1D3SA 1MK5A 1EW3A 2BS6A 1T0VA 4HFOA 4XMEA 1I78A 3FW4A 5DG4A 4BBOA 4A8ZA 5HCDC 1SXYA 1VWHB 3D95A 4I60A 4I6SA 2OVEA 5EPQA 3EMMA 1U17A 3VG6A 2EU7X 1ZNHA 1S44A 4JO6A 1FTPA 5HCEC 3VE1A 3JQOA 4NV7A 1VWMB 4CSBA 1BBPA 2AH7X 2OYBO 5D8JA 1NGLA 4KT5A 2UZ2A 4ORRA 5L8OA 3CMPA 2KTDA 1T8VA 3RY2A 3ELXA 3U03A 1YWCA 1JIWI 2CZTA 2FLJA 2Y3FA 4QYPA 2R74A 4I9RA 3AKMA 4MEEA 4QZTA 1OSPO 2A2UA 3BS2A 3VG2A 2AVIA 3VHHA 1LCWA 3H3IA 5AJCA 1TOUA 3P6FA 5KIDA 1SWKA 4I95A 3JSQA 3ZQ3A 1B4MA 5B2AO 1QY1A 1SWQA 1X8OA 2OFBA 2W2AA 4GD9A 5F58A 1QFVA 3PP6A 2OY7A 1S7DA 3B2HA 5CSEA 5HA0A 3FMZA 2RTQB 4HPAA 4ODDA 4CDEA 2RQ0A 3NX1A 3ZI8A 4CV7A 4ID2A 1KT3A 5HZ8A 4DNEA 1DZMA 2QCBA 5CE4A 1GT5A 2Q4NA 1MEPA 1GT1A 1QABE 1R0UA 2FRSA 2JU3A 1DC9A 1JMZA 3VHMA 1LCVA 1SRJA 4DQ4A 2RCTA 1SWPA 4ORUA 1E06A 2X45A 1O1VA 4QYNA 4YMYA 1B0OA 1JV4A 1RXKA 4O4XA 1SWUA 4AZRA 1KQXA 2OFMX 1EIOA 1ML7A 4ZHHA 5B5GA 4ES7A 1HXLA 2IZLB 5HZQA 1T68X 2FR2A 1YUPA 3BDRA 1VWFB 1I04A 5EEDA 4L1NA 1OEKA 4FBOA 3WYPA 1XCAA 2DJFA 3BSZE 3DTQA 4MVEA 4LQZA 1CBRA 2OFAA 2WEXA 1VWAB 2G78A 2WSJA 1EI5A 3C77X 2CAMA 3HWDA 1QY0A 3D4RA 1I9HA 4NV8A 1A2DA 2LBAA 5LJCA 1GT3A 3ZW0B 1BSYA 5HA1A 1HN2A 3KQ0A 5AEOA 2OVAA 3WJDA 3B2JA 1KL5A 3VG4A 2CZUA 4ORYA 2RTGB 1L6MA 2FS7A 5IO7A 1VWBB 4GNYA 5FQ7E 4ALBA 4XMDA 1SLDB 3WJEA 4BX6B 4AYHA 2Q9SA 3EM0A 3SLJA 5H9NA 1OBQA 1SA8A 1DV9A 2FT9A 1MX7A 1OPBA 4GZVA 1IFCA 3S26A 3UEXA 1DF3A 4ZJ0A 4CPFA 5AQ6A 1A18A 1STSB 1SWSA 1RBPA 4KC7A 4TLJA 1EIIA 3FR4A 2QM9A 1H91A 4TNNA 1X8PA 1SWFA 1SY3A 1Y9TA 4O4OA 4ZHFA 1SY1A 1BSOA 4Z2PA 2R73A 4YDBA 1ZRYA 4ALOA 1CJ5A 2QO5A 3VG7A 1TOWA 2IZKA 3P02A 3LV4A 2HZRA 1SMPI 4IMNA 1SRGA 3TGAA 1TVQA 3KFGA 5IO5A 3FA6A 1IW2A 2MF6A 1AB0A 1K24A 2K23A 3WXQA 2IFBA 3RDMA 2WUTA 2FTBA 2BLGA 2FHLA 3NP1A 4INNA 3SLTA 5B29A 3ZW2A 1NP4A 4K19A 2ALLX 2WQ9A 3EBKA 3P6EA 1GT4A 5KHPA 1MM9A 1NP1A 3WJFA 3X00A 4OS8A 2A13A 2G7BA 1VWQB 2RTMA 2WQAE 3FA7A 3EW1A 5CHKA 4FQBB 3WZNA 4TKBA 3CKGA 5HBSA 3HOEA 1KZWA 4ARHA 2OZQA 1I4UA 1YWAA 1SXXA 4IB9A 1GM6A 2RTDB 2KD2A 4I3DA 4CDCA 3B2KA 3FR5A 1BRQA 3BX8A 3HPEA 2ACPX 4BX7B 4OKAA 3BX7A 4ZR2A 2IZFB 1SWOA 1MOYA 4BJ8A 1KL4A 2HZQA 1GGLA 2WEWA 3LHNA 1JBHA 4GK9A 5KICA 1HBPA 2LFOA 4ZGUA 2JOZA 3ZWEA 1AVDA 1SRFA 4MVLA 2K62A 4Y0QA 3WOVA 2CBRA 3RE6A 3CQRA 2Q39A 3WVMA 1VWIB 4MIRA 2OY5O 2MWHA 3T6FA 1X8NA 4Y59A 4Y5DA 2OVDA 4AZMA 4YBUA 1FEMA 1Y9LA 3PH6A 3EW2A 5HCCC 4JHQA 2VDFA 4NLIA 1JZUA 3D96A 5DPQA 1HQQA 1UZ2X 4O4SA 5H9LA 4OMWA 3S60A 1B56A 1HY2A 4O49A 1WBIA 1NQNA 3MM0A 1HBQA 4OS3A 1MUPA 5IRAA 3TZSA 2E4JA 3P6GA 1SWDA 3QKGA 2L67A 3PH5A 1A57A 1G5WA 4ORSA 4WBKA 1ICMA 3ZW1A 1ACDA 3D97A 3B2IA 3PQSA 1NC9A 3BRNA 1PEEA 5BVTA 2P8GA 4UU2A 1SWEA
chains in the Genus database with same CATH topology
2G79A 3FEKA 4GETA 1KT7A 4O3ZA 1QWDA 1KZXA 5FQ8E 4YBPA 1GXAA 3FELA 2HMBA 3ELZA 4NNTA 1G7NA 4O3YA 4WFUA 3WJCA 3HK1A 5F1EA 2QMIA 5D4AA 1GX9A 2AMMX 2Z4IA 4NNSA 5HTEA 3UAQA 1OPAA 4YH0A 4LKTA 3VG3A 3E3CA 1PM1X 4QGWA 3PPTA 3VPJE 2GTFX 1HMTA 3C76X 4NP1A 1VYGA 2Z4HA 3O19A 2KT4B 1ZNDA 3S5VA 4GU8A 1PMPA 3KFIA 4BVMA 1HQPA 3FA8A 1SXUA 5B27A 4NYRA 1BLRA 1KGLA 3RBYA 4IAXA 4EFGA 1AVGI 3L4RA 4PSQA 5BVSA 2RN4A 4TQ2A 4LZUA 5EEEA 3TGBA 2Q2MA 2X8FA 1X89A 5F7GA 1VPRA 4ZH6A 4BOEA 4A1HA 1FENA 1BRPA 1TXLA 2XSTA 1YP6A 2JMBA 3FLLA 3HOLA 3C78X 4ZHDA 2GJ5A 4WFVA 2M4LA 3HTYA 4YGZA 3VG4A 4MVIA 2LKKA 3CBSA 1KT6A 4U9CA 5L8IA 4ZH9A 1FE3A 3EBWA 1CBQA 1ERBA 3CBCA 2R56A 4EQAC 2AT6X 5AJBA 2A0AA 1U18A 4RUUA 4YGGA 5LJGA 3VE2A 1ZNLA 4AZNA 1I05A 1ZNKA 3NQKA 3P6CA 3WJGA 3APUA 1Z24A 1X8QA 4KH8A 2YG2A 3FA9A 4GKCA 1HMSA 1SY0A 1GKAA 2FS6A 1JJJA 3HWGA 3STKA 3JS1A 1IKJA 1D2UA 4IB7A 3G7XA 4QGVA 3HWEA 2F09A 2AL0X 3OBLA 4O4UA 1CRBA 5F6BA 4AW8A 4YFQA 3U9PC 5HZ5A 4TKHA 4ZFXA 2GTLN 5LJKA 4HPCA 2BT9A 3NPOA 1UREA 4N7DA 3MBTA 1DZPA 4U8UN 2NNQA 5H8TA 1I06A 3BY0A 3MVFA 4I9SA 3RZYA 3P6HA 1BJ7A 4QRLA 1BM5A 1IFBA 2ANSA 4EXZA 1KXOA 4XMHA 1LNMA 3NX2A 2N93A 1E00A 1G85A 4YKMA 1KT4A 1LIBA 2JW1A 1QG5A 1O8VA 1N0SA 2RCQA 5HWZA 3O2YA 1TW4A 3B2LA 1BWYA 5FAZA 4IABA 1XKIA 3P24A 1AELA 3FENA 1RLBE 5D45A 3TGCA 2AKQA 3Q6LA 1QFTA 4GDZA 4TKJA 5K06A 1YP7A 3K3LA 4CK4A 4YKOA 3GE2A 1JBHA 2AT0X 3F9DA 2MO5A 3KZAA 3P6DA 4LZVA 4YGHA 4KCAA 3ZW0A 1JYJA 4QAEA 3VG5A 1KT5A 3S5XA 4O3XB 3UEVA 2L5PA 4KC8A 3EYCA 3FW5A 2MM3A 2MJIA 1KQWA 2W2BA 2NP1A 2NNDA 1KOIA 3FIQA 1EALA 2ASNX 1BSQA 4QZUA 1S2PA 3FYFA 1EPBA 4YCEA 5BYPA 1LFOA 2KW1A 2NNEA 5LJDA 1CBIA 4Y0RA 4AZOA 3ZUIA 3AKNA 3APWA 1EQDA 1GX8A 2WR6A 5JR8A 4COTA 3NQ3A 3KFHA 2YMSA 4AZQA 3SOTA 4RUNA 2Q2PA 2QO4A 4TJZA 4GRJA 4UU3A 1LPJA 1ERXA 3STNA 3TF6A 1IIUA 4IBAA 3DSZA 4Y0SA 1LICA 4FBVA 3FEPA 1A3YA 4ZHCA 2ACOA 3RSWA 1EXSA 1OBPA 3BU9A 1GKAB 5LKEA 3NADA 2HYSA 5CYBA 1E5PA 2AT8X 4ORXA 4L3RA 5EZ2A 2QOSC 4WHIA 4YFRA 1JJXA 1O1UA 2X8TA 4ML7B 1JYDA 2F73A 2OVSA 3RWXA 4YFPA 2JN3A 4QGXA 5HTDA 4ORWA 1IKEA 2W2FA 4AZPA 1FELA 1ADLA 1X71A 1DZKA 2X8SA 5D48A 5IO6A 2XKLA 2HLVA 5HZ9A 4ZCBA 4D6BA 2GC9A 2ZAIA 3IA8A 4XMGA 1AQBA 2QO6A 2X46A 1QQSA 3WBGA 3ZUOA 1SXWA 3N91A 4GE1A 4IB8A 1OEEA 1U0XA 5LKFA 4D6AA 3VU1A 5LJHA 2BHVA 1SY2A 2L68A 4M6SA 4NW4A 3KFFA 3U0DA 1DFVA 4EDEA 5HAEA 3O22A 3I0AA 1B8EA 2DM5A 4YDAA 4HPBA 2A2GA 3IFBA 3ZZVA 1QY2A 4PJ2A 4GH7A 2HNXA 3CR6A 2GTLM 1P6PA 2KTSA 4FGIB 4HPDA 4I3BA 4O9SA 4ON1A 5H9AA 3OD9A 1MDCA 5HZ6A 2LA7A 4EEJA 3F6ZB 4KIIA 2OFRX 2FR3A 4U8UM 4U3QA 4HWMA 1G74A 4ZGFA 5L8NA 3NBXX 2LBVA 2CBSA 1MVGA 4XMFA 1HMRA 5H9KA 3MX7A 1PBOA 1ALBA 4IAWA 4O3WA 2ZAGA 3PEDA 4QQ1A 1LIDA 2JU7A 4BQUA 1LKEA 3T1DA 2FWVA 3PECA 3STMX 5LJEA 1FDQA 4NYQA 3UEWA 3ZW1B 2MHDA 5BVQA 4ZHGA 2PY1A 1EUOA 4IMOA 4MVKA 5LJBA 2RD7C 4OS0A 3UEUA 3APVA 3NR3A 5F6ZA 2A3FX 4OMXA 3CQNA 1LIFA 2CM9A 2AT5X 2CM4A 1LIEA 2L9CA 4A60A 2LB6A 3FR2A 5FENA 5FFHA 2GTLO 4XMCA 4LKPA 1YWDA 4IB6A 4QNIA 1BEBA 1OBUA 1X8UA 4A1YA 4U8UO 3OJYC 1VYFA 4JGLA 4NLJA 5FQ6E 3V8UA 3CWKA 1DZJA 2JU8A 3GAQA 3PQUA 4GNWA 4YCHA 4I3CA 1ZNGA 2WWPA 5D47A 4FBRA 4M7MA 1EPAA 1OEJA 3NQ9A 1YIVA 2BS5A 3RKGA 5EDCA 1ICNA 4N7CA 2AT3X 1YWBA 2POAA 4MISA 3WJBA 4Y0PA 3F8AA 5EDBA 1E02A 4DQ3A 3BU1A 1CBSA 2O62A 3I17A 1ZNEA 5C0NA 1MX8A 4R0BA 3SAOA 3HWFA 3APXA 2RA6A 1LF7A 3BLGA 3OE3A 1D3SA 1EW3A 2BS6A 1T0VA 4HFOA 4XMEA 3FW4A 5DG4A 5HCDC 4A8ZA 1SXYA 3D95A 4I6SA 5EPQA 2OVEA 3EMMA 1U17A 3VG6A 2EU7X 1ZNHA 1S44A 5HCEC 1FTPA 3VE1A 3JQOA 4CSBA 1BBPA 2AH7X 5D8JA 1NGLA 4KT5A 4ORRA 5L8OA 3CMPA 2KTDA 1T8VA 3ELXA 3U03A 1YWCA 1JIWI 2CZTA 2FLJA 4QYPA 2R74A 4I9RA 3AKMA 4QZTA 2A2UA 3BS2A 3VG2A 5AJCA 3H3IA 5KIDA 1TOUA 3P6FA 1B4MA 4I95A 3JSQA 3ZQ3A 1QY1A 1X8OA 2W2AA 5F58A 1QFVA 3PP6A 1S7DA 3B2HA 5HA0A 3FMZA 4HPAA 4ODDA 4CV7A 2RQ0A 3NX1A 3ZI8A 4ID2A 1KT3A 5HZ8A 1DZMA 5CE4A 1GT5A 2Q4NA 1GT1A 1QABE 1R0UA 2FRSA 2JU3A 1DC9A 4DQ4A 2RCTA 4ORUA 1E06A 2X45A 1O1VA 4QYNA 4YMYA 1B0OA 1JV4A 4O4XA 4AZRA 1KQXA 2OFMX 1EIOA 1ML7A 4ZHHA 4ES7A 5HZQA 1T68X 2FR2A 1YUPA 3BDRA 5EEDA 1I04A 4L1NA 1OEKA 4FBOA 1XCAA 3BSZE 3DTQA 4MVEA 4LQZA 1CBRA 2WEXA 2WSJA 2G78A 1EI5A 3C77X 3HWDA 1QY0A 3D4RA 1A2DA 2LBAA 5LJCA 1GT3A 3ZW0B 1BSYA 5HA1A 1HN2A 3KQ0A 5AEOA 2OVAA 3WJDA 3B2JA 2CZUA 4ORYA 5IO7A 1L6MA 2FS7A 4GNYA 5FQ7E 4ALBA 4XMDA 3WJEA 4AYHA 2Q9SA 3EM0A 5H9NA 1OBQA 1SA8A 1DV9A 2FT9A 1MX7A 1OPBA 4GZVA 1IFCA 3S26A 3UEXA 1DF3A 4ZJ0A 5AQ6A 1A18A 4KC7A 1RBPA 1EIIA 4TLJA 3FR4A 2QM9A 1H91A 4TNNA 1X8PA 1SY3A 1Y9TA 4O4OA 4ZHFA 1SY1A 1BSOA 2R73A 4YDBA 1ZRYA 4ALOA 1CJ5A 2QO5A 3VG7A 1TOWA 3P02A 3LV4A 2HZRA 1SMPI 4IMNA 3TGAA 5IO5A 1TVQA 3KFGA 3FA6A 1IW2A 1AB0A 2K23A 3WXQA 2IFBA 2WUTA 2FTBA 2BLGA 3NP1A 4INNA 5B29A 3ZW2A 1NP4A 4K19A 2ALLX 2WQ9A 3EBKA 3P6EA 1GT4A 5KHPA 3WJFA 1NP1A 4OS8A 2A13A 2G7BA 2WQAE 3FA7A 4TKBA 4FQBB 5HBSA 3HOEA 1KZWA 4ARHA 2OZQA 1I4UA 1YWAA 1SXXA 4IB9A 1GM6A 2KD2A 4I3DA 3B2KA 3FR5A 1BRQA 3BX8A 2ACPX 3BX7A 4ZR2A 2HZQA 1GGLA 2WEWA 3LHNA 4GK9A 5KICA 1HBPA 2LFOA 4ZGUA 2JOZA 3ZWEA 4MVLA 2K62A 4Y0QA 3WOVA 2CBRA 3CQRA 2Q39A 3WVMA 4MIRA 2MWHA 1X8NA 2OVDA 4AZMA 4YBUA 1FEMA 1Y9LA 3PH6A 5HCCC 4NLIA 1JZUA 3D96A 5DPQA 4O4SA 1UZ2X 5H9LA 4OMWA 3S60A 1B56A 4O49A 1HBQA 4OS3A 1MUPA 3TZSA 2E4JA 3P6GA 3QKGA 2L67A 3PH5A 1A57A 1G5WA 4ORSA 4WBKA 1ICMA 3ZW1A 1ACDA 3D97A 3B2IA 3PQSA 3BRNA 1PEEA 5BVTA 2P8GA 4UU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G79 A;  3FEK A;  4GET A;  1KT7 A;  1KZX A;  1QWD A;  4YBP A;  1GXA A;  3FEL A;  2HMB A;  3ELZ A;  4NNT A;  1G7N A;  4WFU A;  3WJC A;  3HK1 A;  5F1E A;  5D4A A;  1GX9 A;  2AMM X;  4NNS A;  5HTE A;  1OPA A;  4YH0 A;  4LKT A;  3VG3 A;  1PM1 X;  4QGW A;  3PPT A;  2GTF X;  1HMT A;  3C76 X;  4NP1 A;  1VYG A;  3O19 A;  2KT4 B;  1ZND A;  1PMP A;  3KFI A;  4BVM A;  1HQP A;  3FA8 A;  1SXU A;  5B27 A;  4NYR A;  1BLR A;  1KGL A;  4IAX A;  4EFG A;  1AVG I;  3L4R A;  4PSQ A;  5BVS A;  4TQ2 A;  4LZU A;  5EEE A;  3TGB A;  2Q2M A;  1X89 A;  5F7G A;  1VPR A;  4ZH6 A;  4BOE A;  4A1H A;  1FEN A;  1BRP A;  1TXL A;  2XST A;  1YP6 A;  3FLL A;  3C78 X;  4ZHD A;  2GJ5 A;  4WFV A;  4YGZ A;  3VG4 A;  4MVI A;  2LKK A;  3CBS A;  1KT6 A;  5L8I A;  4ZH9 A;  1FE3 A;  3EBW A;  1CBQ A;  1ERB A;  3CBC A;  2R56 A;  2AT6 X;  2A0A A;  1U18 A;  4RUU A;  4YGG A;  5LJG A;  1ZNL A;  4AZN A;  1I05 A;  1ZNK A;  3P6C A;  3WJG A;  3APU A;  1Z24 A;  1X8Q A;  2YG2 A;  3FA9 A;  4GKC A;  1HMS A;  1SY0 A;  1GKA A;  2FS6 A;  1JJJ A;  3HWG A;  3STK A;  3JS1 A;  1IKJ A;  1D2U A;  4IB7 A;  3G7X A;  4QGV A;  3HWE A;  2AL0 X;  5F6B A;  1CRB A;  4AW8 A;  4YFQ A;  3U9P C;  5HZ5 A;  4TKH A;  4ZFX A;  5LJK A;  4HPC A;  3NPO A;  1URE A;  4N7D A;  3MBT A;  1DZP A;  2NNQ A;  5H8T A;  1I06 A;  3BY0 A;  3MVF A;  4I9S A;  3RZY A;  3P6H A;  1BJ7 A;  1BM5 A;  1IFB A;  2ANS A;  4EXZ A;  1KXO A;  4XMH A;  1LNM A;  3NX2 A;  2N93 A;  1E00 A;  1G85 A;  4YKM A;  1KT4 A;  1LIB A;  1QG5 A;  1O8V A;  1N0S A;  2RCQ A;  5HWZ A;  3O2Y A;  1TW4 A;  3B2L A;  1BWY A;  5FAZ A;  1AEL A;  1XKI A;  3FEN A;  1RLB E;  5D45 A;  3TGC A;  2AKQ A;  3Q6L A;  1QFT A;  4TKJ A;  5K06 A;  1YP7 A;  3K3L A;  4CK4 A;  4YKO A;  1JBH A;  2AT0 X;  3F9D A;  2MO5 A;  3KZA A;  3P6D A;  4LZV A;  4YGH A;  1JYJ A;  4QAE A;  3VG5 A;  1KT5 A;  3UEV A;  2L5P A;  3EYC A;  3FW5 A;  2MM3 A;  2MJI A;  1KQW A;  2W2B A;  2NP1 A;  2NND A;  1KOI A;  3FIQ A;  1EAL A;  2ASN X;  1BSQ A;  4QZU A;  1S2P A;  1EPB A;  4YCE A;  1LFO A;  2NNE A;  5LJD A;  1CBI A;  4Y0R A;  4AZO A;  3ZUI A;  3AKN A;  3APW A;  1EQD A;  1GX8 A;  2WR6 A;  5JR8 A;  3NQ3 A;  3KFH A;  4AZQ A;  4RUN A;  2Q2P A;  2QO4 A;  4TJZ A;  4GRJ A;  4UU3 A;  1LPJ A;  1ERX A;  3STN A;  3TF6 A;  1IIU A;  4IBA A;  3DSZ A;  4Y0S A;  1LIC A;  3FEP A;  1A3Y A;  4ZHC A;  2ACO A;  3RSW A;  1EXS A;  1OBP A;  3BU9 A;  1GKA B;  5LKE A;  3NAD A;  2HYS A;  1E5P A;  2AT8 X;  4ORX A;  5EZ2 A;  2QOS C;  4YFR A;  1JJX A;  1O1U A;  1JYD A;  2F73 A;  4YFP A;  2JN3 A;  4QGX A;  5HTD A;  4ORW A;  1IKE A;  2W2F A;  4AZP A;  1FEL A;  1ADL A;  1X71 A;  1DZK A;  5D48 A;  5IO6 A;  2XKL A;  2HLV A;  5HZ9 A;  4ZCB A;  4D6B A;  2GC9 A;  3IA8 A;  4XMG A;  1AQB A;  2QO6 A;  2X46 A;  1QQS A;  3WBG A;  3ZUO A;  1SXW A;  4GE1 A;  4IB8 A;  5LKF A;  1OEE A;  1U0X A;  4D6A A;  5LJH A;  1SY2 A;  2L68 A;  4M6S A;  3KFF A;  3U0D A;  1DFV A;  4EDE A;  5HAE A;  3O22 A;  3I0A A;  1B8E A;  2DM5 A;  4YDA A;  4HPB A;  2A2G A;  3IFB A;  1QY2 A;  4GH7 A;  2HNX A;  3CR6 A;  1P6P A;  4I3B A;  4O9S A;  4HPD A;  5H9A A;  1MDC A;  5HZ6 A;  4EEJ A;  4KII A;  2OFR X;  2FR3 A;  1G74 A;  5L8N A;  2LBV A;  2CBS A;  1MVG A;  4XMF A;  1HMR A;  5H9K A;  1PBO A;  1ALB A;  4IAW A;  3PED A;  1LID A;  2JU7 A;  4BQU A;  1LKE A;  3T1D A;  2FWV A;  3PEC A;  3STM X;  5LJE A;  1FDQ A;  4NYQ A;  3UEW A;  5BVQ A;  4ZHG A;  2PY1 A;  1EUO A;  4IMO A;  4MVK A;  5LJB A;  2RD7 C;  4OS0 A;  3UEU A;  3APV A;  3NR3 A;  5F6Z A;  2A3F X;  4OMX A;  3CQN A;  1LIF A;  2CM9 A;  2AT5 X;  2CM4 A;  1LIE A;  2L9C A;  4A60 A;  2LB6 A;  3FR2 A;  5FEN A;  5FFH A;  4XMC A;  4LKP A;  1YWD A;  4IB6 A;  1BEB A;  1OBU A;  1X8U A;  4A1Y A;  3OJY C;  1VYF A;  4NLJ A;  3CWK A;  1DZJ A;  2JU8 A;  3GAQ A;  4GNW A;  4YCH A;  4I3C A;  1ZNG A;  2WWP A;  5D47 A;  4M7M A;  1EPA A;  1OEJ A;  3NQ9 A;  1YIV A;  5EDC A;  1ICN A;  4N7C A;  2AT3 X;  1YWB A;  2POA A;  3WJB A;  4Y0P A;  3F8A A;  5EDB A;  1E02 A;  4DQ3 A;  3BU1 A;  1CBS A;  2O62 A;  3I17 A;  1ZNE A;  5C0N A;  1MX8 A;  4R0B A;  3SAO A;  3HWF A;  3APX A;  2RA6 A;  1LF7 A;  3BLG A;  1D3S A;  1EW3 A;  4XME A;  1T0V A;  4HFO A;  5DG4 A;  3FW4 A;  5HCD C;  4A8Z A;  1SXY A;  3D95 A;  5EPQ A;  2OVE A;  3EMM A;  1U17 A;  3VG6 A;  2EU7 X;  1ZNH A;  1S44 A;  5HCE C;  1FTP A;  1BBP A;  2AH7 X;  5D8J A;  1NGL A;  5L8O A;  4ORR A;  3CMP A;  2KTD A;  1T8V A;  3ELX A;  3U03 A;  1YWC A;  2CZT A;  2FLJ A;  4QYP A;  2R74 A;  4I9R A;  3AKM A;  4QZT A;  2A2U A;  3BS2 A;  3VG2 A;  5KID A;  1TOU A;  3P6F A;  1B4M A;  3JSQ A;  3ZQ3 A;  1QY1 A;  1X8O A;  2W2A A;  5F58 A;  1QFV A;  3PP6 A;  1S7D A;  3B2H A;  5HA0 A;  3FMZ A;  4HPA A;  4ODD A;  2RQ0 A;  3NX1 A;  1KT3 A;  5HZ8 A;  1DZM A;  5CE4 A;  1GT5 A;  2Q4N A;  1GT1 A;  1QAB E;  1R0U A;  2FRS A;  2JU3 A;  1DC9 A;  4DQ4 A;  2RCT A;  4ORU A;  1E06 A;  2X45 A;  1O1V A;  4QYN A;  4YMY A;  1B0O A;  1JV4 A;  4AZR A;  1KQX A;  2OFM X;  1EIO A;  1ML7 A;  4ZHH A;  4ES7 A;  5HZQ A;  1T68 X;  2FR2 A;  1YUP A;  3BDR A;  5EED A;  1I04 A;  1OEK A;  1XCA A;  3BSZ E;  3DTQ A;  1CBR A;  2WEX A;  2WSJ A;  2G78 A;  3C77 X;  3HWD A;  1QY0 A;  1A2D A;  2LBA A;  5LJC A;  1GT3 A;  1BSY A;  5HA1 A;  1HN2 A;  3KQ0 A;  2OVA A;  3WJD A;  3B2J A;  2CZU A;  4ORY A;  5IO7 A;  1L6M A;  2FS7 A;  4GNY A;  4ALB A;  4XMD A;  3WJE A;  4AYH A;  2Q9S A;  3EM0 A;  5H9N A;  1OBQ A;  1SA8 A;  1DV9 A;  2FT9 A;  1MX7 A;  1OPB A;  1IFC A;  3S26 A;  3UEX A;  1DF3 A;  4ZJ0 A;  5AQ6 A;  1A18 A;  1EII A;  1RBP A;  4TLJ A;  3FR4 A;  2QM9 A;  1H91 A;  4TNN A;  1X8P A;  1SY3 A;  4ZHF A;  1SY1 A;  1BSO A;  2R73 A;  4YDB A;  1ZRY A;  4ALO A;  1CJ5 A;  2QO5 A;  3VG7 A;  1TOW A;  2HZR A;  4IMN A;  3TGA A;  5IO5 A;  1TVQ A;  3KFG A;  3FA6 A;  1IW2 A;  1AB0 A;  2K23 A;  3WXQ A;  2IFB A;  2WUT A;  2FTB A;  2BLG A;  3NP1 A;  5B29 A;  1NP4 A;  4K19 A;  2ALL X;  2WQ9 A;  3EBK A;  3P6E A;  1GT4 A;  5KHP A;  3WJF A;  1NP1 A;  4OS8 A;  2A13 A;  2G7B A;  2WQA E;  3FA7 A;  4TKB A;  5HBS A;  1KZW A;  4ARH A;  2OZQ A;  1I4U A;  1YWA A;  1SXX A;  4IB9 A;  1GM6 A;  4I3D A;  3B2K A;  3FR5 A;  1BRQ A;  3BX8 A;  2ACP X;  3BX7 A;  4ZR2 A;  2HZQ A;  1GGL A;  2WEW A;  5KIC A;  1HBP A;  2LFO A;  4ZGU A;  2JOZ A;  4MVL A;  2K62 A;  4Y0Q A;  2CBR A;  3CQR A;  2Q39 A;  3WVM A;  1X8N A;  2OVD A;  4AZM A;  4YBU A;  1FEM A;  3PH6 A;  5HCC C;  4NLI A;  1JZU A;  3D96 A;  5DPQ A;  1UZ2 X;  5H9L A;  4OMW A;  1B56 A;  1HBQ A;  4OS3 A;  1MUP A;  3TZS A;  2E4J A;  3P6G A;  3QKG A;  2L67 A;  3PH5 A;  1A57 A;  1G5W A;  4ORS A;  4WBK A;  1ICM A;  1ACD A;  3D97 A;  3B2I A;  3BRN A;  1PEE A;  5BVT A;  2P8G A;  4UU2 A; 
#chains in the Genus database with same CATH topology
 2G79 A;  3FEK A;  3FDC A;  1KT7 A;  4GET A;  1QWD A;  4O3Z A;  1KZX A;  5FQ8 E;  4YBP A;  1GXA A;  3FEL A;  4CDF A;  2HMB A;  3ELZ A;  2FKG A;  1G7N A;  1Y55 X;  2AF5 A;  2C1S A;  4NNT A;  3HK1 A;  4O3Y A;  1VWL B;  4WFU A;  2QMI A;  5D4A A;  1GX9 A;  2AMM X;  1Y0G A;  2Z4I A;  4NNS A;  5F1E A;  5HTE A;  1OPA A;  3UAQ A;  1N9Y A;  4YH0 A;  4LKT A;  3VG3 A;  2Y32 A;  3E3C A;  4Z2O A;  1PM1 X;  4QGW A;  3LTW A;  3PPT A;  2G5L A;  3VPJ E;  2GTF X;  1HMT A;  1LCZ A;  3C76 X;  4NP1 A;  1KL3 A;  1VYG A;  2Z4H A;  3O19 A;  4GDA A;  2KT4 B;  1ZND A;  3S5V A;  3T2W A;  4GU8 A;  1PMP A;  3KFI A;  4BVM A;  1HQP A;  1NQM A;  3FA8 A;  1SXU A;  5B27 A;  4NYR A;  1BLR A;  1KGL A;  3RBY A;  2A5C A;  4Z27 A;  4IAX A;  4EFG A;  1AVG I;  3L4R A;  4PSQ A;  5BVS A;  2RN4 A;  4TQ2 A;  4LZU A;  5EEE A;  2C1Q A;  2OY8 A;  1NDJ A;  1JQP A;  2Q2M A;  2X8F A;  3TGB A;  2RTL A;  1X89 A;  5F7G A;  1VPR A;  1PBY A;  4ZH6 A;  4BOE A;  3PDF A;  4BX5 A;  4A1H A;  1FEN A;  2RTC B;  1BRP A;  1TXL A;  3SLO A;  2XST A;  1W6F A;  1YP6 A;  2JMB A;  3FLL A;  3HOL A;  4Z28 A;  3C78 X;  4ZHD A;  2GJ5 A;  4WFV A;  2M4L A;  4B55 A;  3HTY A;  4OEM A;  4YGZ A;  1SWA A;  2X4M A;  2LKK A;  1SLF B;  3CBS A;  1KT6 A;  2DJG A;  4MVI A;  4U9C A;  3T6L A;  5L8I A;  4ZH9 A;  1FE3 A;  1SWH A;  3EBW A;  4CPH A;  1CBQ A;  3FID A;  1ERB A;  2RTR B;  3CBC A;  2R56 A;  4EQA C;  2AT6 X;  5AJB A;  3WZP A;  2A0A A;  3RDX A;  1U18 A;  4RUU A;  4YGG A;  5LJG A;  3VE2 A;  1SWB A;  1ZNL A;  2PI3 O;  4AZN A;  1I05 A;  1ZNK A;  2IZI A;  1WUB A;  3NQK A;  3P6C A;  2JGS A;  3PK2 A;  3WJG A;  3APU A;  1Z24 A;  1E2T A;  3WZQ A;  1X8Q A;  4KH8 A;  2YG2 A;  3FA9 A;  4GKC A;  1HMS A;  1SY0 A;  1GKA A;  2FS6 A;  4GGR A;  5F2B A;  1JJJ A;  3HWG A;  3STK A;  3JS1 A;  1IKJ A;  1D2U A;  2OL8 O;  4IB7 A;  3G7X A;  2F01 A;  4QGV A;  1VWG B;  3HWE A;  2F09 A;  2AL0 X;  2IZC B;  3OBL A;  1CRB A;  4O4U A;  5F6B A;  4AW8 A;  4YFQ A;  3U9P C;  5HZ5 A;  4TKH A;  4ZFX A;  1Y52 X;  2GTL N;  4BCS A;  5LJK A;  2OF8 A;  4HPC A;  1NBX A;  2BT9 A;  2BSZ A;  5IXG A;  3NPO A;  1URE A;  1JMX A;  4N7D A;  1SRI A;  1DZP A;  3MBT A;  4U8U N;  2NNQ A;  5H8T A;  1I06 A;  3BY0 A;  3MVF A;  4I9S A;  3RZY A;  3P6H A;  1LDO A;  1BJ7 A;  2VFB A;  4YVB A;  4QRL A;  1BM5 A;  1IFB A;  5BYP A;  2ANS A;  4EXZ A;  4CPE A;  1KXO A;  4XMH A;  1LNM A;  2RTH B;  3NX2 A;  2N93 A;  1E00 A;  1G85 A;  4YKM A;  1KT4 A;  1LIB A;  2JW1 A;  5B11 O;  1LDQ A;  1O8V A;  1W4T A;  1N0S A;  1QG5 A;  2RCQ A;  3O2Y A;  5HWZ A;  1LUQ A;  1TW4 A;  3B2L A;  5FAZ A;  1BWY A;  2I5Z O;  4IAB A;  1XKI A;  3P24 A;  1AEL A;  3FEN A;  2A8G A;  1RLB E;  5D45 A;  4Z2V A;  3TGC A;  2AKQ A;  3Q6L A;  1SWT A;  1QFT A;  4GDZ A;  4TKJ A;  1SWC A;  5K06 A;  2X56 A;  1YP7 A;  3K3L A;  3AEH A;  4CK4 A;  4YKO A;  3GE2 A;  1SWG A;  1UYN X;  2AT0 X;  3F9D A;  2MO5 A;  3KZA A;  3P6D A;  4LZV A;  4YGH A;  4KCA A;  3ZW0 A;  1JYJ A;  4QAE A;  3VG5 A;  1KT5 A;  3S5X A;  4O3X B;  3UEV A;  1VWR B;  2L5P A;  3EYC A;  3FW5 A;  2MM3 A;  2MJI A;  2HKD A;  1W5R A;  2RTB B;  1KQW A;  4KC8 A;  2W2B A;  2NP1 A;  2NND A;  1KOI A;  3FIQ A;  1EAL A;  2IZA A;  4BX6 A;  2ASN X;  3WZO A;  1BSQ A;  2IZH B;  4QZU A;  1S2P A;  3FYF A;  1EPB A;  4YCE A;  5K68 A;  1PTS A;  1VWO B;  1LFO A;  2KW1 A;  1STR B;  2NNE A;  2FGS A;  5LJD A;  3RDS A;  5L3Y A;  1CBI A;  4Y0R A;  4AZO A;  3ZUI A;  3AKN A;  3APW A;  1EQD A;  3D9W A;  1GX8 A;  2WR6 A;  5JR8 A;  4COT A;  3NQ3 A;  3KFH A;  2YMS A;  4AZQ A;  2QOM A;  3SOT A;  4Z6J A;  4RUN A;  1UYO X;  2Q2P A;  3VGW A;  2QO4 A;  4TJZ A;  1N4J A;  4GRJ A;  4UU3 A;  1LPJ A;  1IJ8 A;  1ERX A;  2RTA A;  3STN A;  3TF6 A;  4IRW A;  1VWJ B;  1IIU A;  4IBA A;  3DSZ A;  4Y0S A;  2RTE B;  1LIC A;  4GJV A;  1RST B;  3RY1 A;  3KVN A;  4FBV A;  3FEP A;  1A3Y A;  4ZHC A;  3AUM O;  2ACO A;  3RSW A;  1EXS A;  1OBP A;  3BU9 A;  1GKA B;  5LKE A;  1SWJ A;  3NAD A;  3WYQ A;  2HYS A;  5CYB A;  1HXZ A;  3RDU A;  1E5P A;  2AT8 X;  4JNJ A;  4ORX A;  1VWN B;  4L3R A;  5EZ2 A;  1K3B A;  2QOS C;  4WHI A;  4YFR A;  1SRH A;  1O1U A;  1JJX A;  1RXH A;  4EKV A;  2X8T A;  2ZSC A;  1JYD A;  2F73 A;  2OVS A;  1DF8 A;  4ML7 B;  5B3M O;  3RWX A;  4BX7 A;  4YFP A;  2JN3 A;  4QGX A;  5HTD A;  4ORW A;  1IKE A;  2W2F A;  4AZP A;  1N7Y A;  1FEL A;  2OL6 O;  1VWC B;  1ADL A;  1X71 A;  2WPU A;  1DZK A;  1SLG B;  2RTO B;  4C5P A;  3SZI A;  2X8S A;  5D48 A;  3WJC A;  1SWN A;  2XKL A;  2HLV A;  2IZD B;  5IO6 A;  5HZ9 A;  1Y53 X;  4ZCB A;  2OY1 O;  2RTP B;  2GC9 A;  4D6B A;  2ZAI A;  3IA8 A;  4XMG A;  5IRU A;  1AQB A;  5IRW A;  1VWP B;  2QO6 A;  1JJU A;  2X46 A;  4U46 A;  1QQS A;  3WBG A;  3ZUO A;  1FJ1 E;  1SXW A;  2X34 A;  3N91 A;  1OEE A;  1U0X A;  4GE1 A;  4IB8 A;  5LKF A;  2IZB A;  3VU1 A;  1RAV A;  2X32 A;  2BHV A;  1SY2 A;  2L68 A;  4M6S A;  4NW4 A;  1SWL A;  3KFF A;  2BC3 A;  3U0D A;  1DFV A;  2RTK A;  4EDE A;  1SWR A;  2X55 A;  3O22 A;  3I0A A;  1B8E A;  5HAE A;  2DM5 A;  2A5B A;  4HPB A;  4YDA A;  2A2G A;  3EC5 A;  3IFB A;  1QY2 A;  3ZZV A;  4PJ2 A;  4GH7 A;  2FHN X;  2UYW A;  2HNX A;  3CR6 A;  2GTL M;  1P6P A;  2KTS A;  4FGI B;  4HPD A;  4I3B A;  4O9S A;  4ON1 A;  5H9A A;  3OD9 A;  1MDC A;  1GX3 A;  2LA7 A;  5HZ6 A;  4EEJ A;  3F6Z B;  3CKF A;  4KII A;  2OFR X;  2FR3 A;  4U8U M;  1RXJ A;  4U3Q A;  5B5F A;  2RTJ A;  1G74 A;  4HWM A;  4ZGF A;  1KFF A;  5L8N A;  3NBX X;  2LBV A;  2CBS A;  1MVG A;  4XMF A;  1HMR A;  1RSU B;  4GGZ A;  2IZE B;  3MX7 A;  5H9K A;  1PBO A;  3RE5 A;  1ALB A;  4IAW A;  4O3W A;  2ZAG A;  3PED A;  3RDQ A;  3T2X A;  4QQ1 A;  2I5V O;  5LJH A;  1LID A;  2JU7 A;  3QQ2 A;  5K67 A;  4BQU A;  1LKE A;  4GUZ A;  3T1D A;  2FWV A;  2OF9 A;  3PEC A;  3STM X;  5LJE A;  1FDQ A;  4NYQ A;  3UEW A;  3ZW1 B;  2MHD A;  2IZJ A;  5BVQ A;  1VWK B;  4ZHG A;  4OEL A;  2PY1 A;  1EUO A;  4IMO A;  4MVK A;  3SZH A;  5LJB A;  2RD7 C;  4OS0 A;  3UEU A;  4CPI A;  3APV A;  3NR3 A;  5F6Z A;  2A3F X;  4OMX A;  3CQN A;  1LIF A;  1N9M A;  1SRE A;  2AT5 X;  2CM9 A;  2CM4 A;  2RTF B;  1LIE A;  2L9C A;  4A60 A;  4GGT A;  2C4I A;  2LB6 A;  3SZJ A;  1VWD B;  3FR2 A;  5JD2 A;  5FEN A;  2RTN B;  5FFH A;  2GTL O;  1N43 A;  3Q34 A;  4XMC A;  4LKP A;  4BGF A;  4CDD A;  1YWD A;  4IB6 A;  4QNI A;  4GJS A;  2GH7 A;  1VYO A;  1BEB A;  1OBU A;  1X8U A;  4A1Y A;  4U8U O;  3OJY C;  1VYF A;  4JGL A;  2VFC A;  4NLJ A;  5FQ6 E;  3VHI A;  1LEL A;  1SLE B;  1STP A;  3V8U A;  3CWK A;  1DZJ A;  2JU8 A;  3GAQ A;  3PQU A;  1VWE B;  4GNW A;  4YCH A;  4I3C A;  1ZNG A;  2WWP A;  5D47 A;  4FBR A;  1AVE A;  1EPA A;  4M7M A;  1OEJ A;  3NQ9 A;  1YIV A;  2BS5 A;  2IZG B;  3RKG A;  5EDC A;  1ICN A;  4N7C A;  2AT3 X;  2Y3E A;  4DCB A;  1YWB A;  2OL7 A;  2POA A;  4MIS A;  4BX5 B;  3WJB A;  5B10 O;  3MG5 A;  3RDO A;  2RTI B;  4Y0P A;  3F8A A;  5EDB A;  1E02 A;  4DQ3 A;  3BU1 A;  1CBS A;  2O62 A;  3I17 A;  1ZNE A;  4D6A A;  5C0N A;  1MX8 A;  4R0B A;  3SAO A;  3HWF A;  3APX A;  2RA6 A;  1LF7 A;  2FKJ A;  3BLG A;  3OE3 A;  2G8C O;  4CPH B;  1D3S A;  1MK5 A;  1EW3 A;  2BS6 A;  1T0V A;  4HFO A;  4XME A;  1I78 A;  3FW4 A;  5DG4 A;  4BBO A;  4A8Z A;  5HCD C;  1SXY A;  1VWH B;  3D95 A;  4I60 A;  4I6S A;  2OVE A;  5EPQ A;  3EMM A;  1U17 A;  3VG6 A;  2EU7 X;  1ZNH A;  1S44 A;  4JO6 A;  1FTP A;  5HCE C;  3VE1 A;  3JQO A;  4NV7 A;  1VWM B;  4CSB A;  1BBP A;  2AH7 X;  2OYB O;  5D8J A;  1NGL A;  4KT5 A;  2UZ2 A;  4ORR A;  5L8O A;  3CMP A;  2KTD A;  1T8V A;  3RY2 A;  3ELX A;  3U03 A;  1YWC A;  1JIW I;  2CZT A;  2FLJ A;  2Y3F A;  4QYP A;  2R74 A;  4I9R A;  3AKM A;  4MEE A;  4QZT A;  1OSP O;  2A2U A;  3BS2 A;  3VG2 A;  2AVI A;  3VHH A;  1LCW A;  3H3I A;  5AJC A;  1TOU A;  3P6F A;  5KID A;  1SWK A;  4I95 A;  3JSQ A;  3ZQ3 A;  1B4M A;  5B2A O;  1QY1 A;  1SWQ A;  1X8O A;  2OFB A;  2W2A A;  4GD9 A;  5F58 A;  1QFV A;  3PP6 A;  2OY7 A;  1S7D A;  3B2H A;  5CSE A;  5HA0 A;  3FMZ A;  2RTQ B;  4HPA A;  4ODD A;  4CDE A;  2RQ0 A;  3NX1 A;  3ZI8 A;  4CV7 A;  4ID2 A;  1KT3 A;  5HZ8 A;  4DNE A;  1DZM A;  2QCB A;  5CE4 A;  1GT5 A;  2Q4N A;  1MEP A;  1GT1 A;  1QAB E;  1R0U A;  2FRS A;  2JU3 A;  1DC9 A;  1JMZ A;  3VHM A;  1LCV A;  1SRJ A;  4DQ4 A;  2RCT A;  1SWP A;  4ORU A;  1E06 A;  2X45 A;  1O1V A;  4QYN A;  4YMY A;  1B0O A;  1JV4 A;  1RXK A;  4O4X A;  1SWU A;  4AZR A;  1KQX A;  2OFM X;  1EIO A;  1ML7 A;  4ZHH A;  5B5G A;  4ES7 A;  1HXL A;  2IZL B;  5HZQ A;  1T68 X;  2FR2 A;  1YUP A;  3BDR A;  1VWF B;  1I04 A;  5EED A;  4L1N A;  1OEK A;  4FBO A;  3WYP A;  1XCA A;  2DJF A;  3BSZ E;  3DTQ A;  4MVE A;  4LQZ A;  1CBR A;  2OFA A;  2WEX A;  1VWA B;  2G78 A;  2WSJ A;  1EI5 A;  3C77 X;  2CAM A;  3HWD A;  1QY0 A;  3D4R A;  1I9H A;  4NV8 A;  1A2D A;  2LBA A;  5LJC A;  1GT3 A;  3ZW0 B;  1BSY A;  5HA1 A;  1HN2 A;  3KQ0 A;  5AEO A;  2OVA A;  3WJD A;  3B2J A;  1KL5 A;  3VG4 A;  2CZU A;  4ORY A;  2RTG B;  1L6M A;  2FS7 A;  5IO7 A;  1VWB B;  4GNY A;  5FQ7 E;  4ALB A;  4XMD A;  1SLD B;  3WJE A;  4BX6 B;  4AYH A;  2Q9S A;  3EM0 A;  3SLJ A;  5H9N A;  1OBQ A;  1SA8 A;  1DV9 A;  2FT9 A;  1MX7 A;  1OPB A;  4GZV A;  1IFC A;  3S26 A;  3UEX A;  1DF3 A;  4ZJ0 A;  4CPF A;  5AQ6 A;  1A18 A;  1STS B;  1SWS A;  1RBP A;  4KC7 A;  4TLJ A;  1EII A;  3FR4 A;  2QM9 A;  1H91 A;  4TNN A;  1X8P A;  1SWF A;  1SY3 A;  1Y9T A;  4O4O A;  4ZHF A;  1SY1 A;  1BSO A;  4Z2P A;  2R73 A;  4YDB A;  1ZRY A;  4ALO A;  1CJ5 A;  2QO5 A;  3VG7 A;  1TOW A;  2IZK A;  3P02 A;  3LV4 A;  2HZR A;  1SMP I;  4IMN A;  1SRG A;  3TGA A;  1TVQ A;  3KFG A;  5IO5 A;  3FA6 A;  1IW2 A;  2MF6 A;  1AB0 A;  1K24 A;  2K23 A;  3WXQ A;  2IFB A;  3RDM A;  2WUT A;  2FTB A;  2BLG A;  2FHL A;  3NP1 A;  4INN A;  3SLT A;  5B29 A;  3ZW2 A;  1NP4 A;  4K19 A;  2ALL X;  2WQ9 A;  3EBK A;  3P6E A;  1GT4 A;  5KHP A;  1MM9 A;  1NP1 A;  3WJF A;  3X00 A;  4OS8 A;  2A13 A;  2G7B A;  1VWQ B;  2RTM A;  2WQA E;  3FA7 A;  3EW1 A;  5CHK A;  4FQB B;  3WZN A;  4TKB A;  3CKG A;  5HBS A;  3HOE A;  1KZW A;  4ARH A;  2OZQ A;  1I4U A;  1YWA A;  1SXX A;  4IB9 A;  1GM6 A;  2RTD B;  2KD2 A;  4I3D A;  4CDC A;  3B2K A;  3FR5 A;  1BRQ A;  3BX8 A;  3HPE A;  2ACP X;  4BX7 B;  4OKA A;  3BX7 A;  4ZR2 A;  2IZF B;  1SWO A;  1MOY A;  4BJ8 A;  1KL4 A;  2HZQ A;  1GGL A;  2WEW A;  3LHN A;  1JBH A;  4GK9 A;  5KIC A;  1HBP A;  2LFO A;  4ZGU A;  2JOZ A;  3ZWE A;  1AVD A;  1SRF A;  4MVL A;  2K62 A;  4Y0Q A;  3WOV A;  2CBR A;  3RE6 A;  3CQR A;  2Q39 A;  3WVM A;  1VWI B;  4MIR A;  2OY5 O;  2MWH A;  3T6F A;  1X8N A;  4Y59 A;  4Y5D A;  2OVD A;  4AZM A;  4YBU A;  1FEM A;  1Y9L A;  3PH6 A;  3EW2 A;  5HCC C;  4JHQ A;  2VDF A;  4NLI A;  1JZU A;  3D96 A;  5DPQ A;  1HQQ A;  1UZ2 X;  4O4S A;  5H9L A;  4OMW A;  3S60 A;  1B56 A;  1HY2 A;  4O49 A;  1WBI A;  1NQN A;  3MM0 A;  1HBQ A;  4OS3 A;  1MUP A;  5IRA A;  3TZS A;  2E4J A;  3P6G A;  1SWD A;  3QKG A;  2L67 A;  3PH5 A;  1A57 A;  1G5W A;  4ORS A;  4WBK A;  1ICM A;  3ZW1 A;  1ACD A;  3D97 A;  3B2I A;  3PQS A;  1NC9 A;  3BRN A;  1PEE A;  5BVT A;  2P8G A;  4UU2 A;  1SWE A; 
#chains in the Genus database with same CATH homology
 2G79 A;  3FEK A;  4GET A;  1KT7 A;  4O3Z A;  1QWD A;  1KZX A;  5FQ8 E;  4YBP A;  1GXA A;  3FEL A;  2HMB A;  3ELZ A;  4NNT A;  1G7N A;  4O3Y A;  4WFU A;  3WJC A;  3HK1 A;  5F1E A;  2QMI A;  5D4A A;  1GX9 A;  2AMM X;  2Z4I A;  4NNS A;  5HTE A;  3UAQ A;  1OPA A;  4YH0 A;  4LKT A;  3VG3 A;  3E3C A;  1PM1 X;  4QGW A;  3PPT A;  3VPJ E;  2GTF X;  1HMT A;  3C76 X;  4NP1 A;  1VYG A;  2Z4H A;  3O19 A;  2KT4 B;  1ZND A;  3S5V A;  4GU8 A;  1PMP A;  3KFI A;  4BVM A;  1HQP A;  3FA8 A;  1SXU A;  5B27 A;  4NYR A;  1BLR A;  1KGL A;  3RBY A;  4IAX A;  4EFG A;  1AVG I;  3L4R A;  4PSQ A;  5BVS A;  2RN4 A;  4TQ2 A;  4LZU A;  5EEE A;  3TGB A;  2Q2M A;  2X8F A;  1X89 A;  5F7G A;  1VPR A;  4ZH6 A;  4BOE A;  4A1H A;  1FEN A;  1BRP A;  1TXL A;  2XST A;  1YP6 A;  2JMB A;  3FLL A;  3HOL A;  3C78 X;  4ZHD A;  2GJ5 A;  4WFV A;  2M4L A;  3HTY A;  4YGZ A;  3VG4 A;  4MVI A;  2LKK A;  3CBS A;  1KT6 A;  4U9C A;  5L8I A;  4ZH9 A;  1FE3 A;  3EBW A;  1CBQ A;  1ERB A;  3CBC A;  2R56 A;  4EQA C;  2AT6 X;  5AJB A;  2A0A A;  1U18 A;  4RUU A;  4YGG A;  5LJG A;  3VE2 A;  1ZNL A;  4AZN A;  1I05 A;  1ZNK A;  3NQK A;  3P6C A;  3WJG A;  3APU A;  1Z24 A;  1X8Q A;  4KH8 A;  2YG2 A;  3FA9 A;  4GKC A;  1HMS A;  1SY0 A;  1GKA A;  2FS6 A;  1JJJ A;  3HWG A;  3STK A;  3JS1 A;  1IKJ A;  1D2U A;  4IB7 A;  3G7X A;  4QGV A;  3HWE A;  2F09 A;  2AL0 X;  3OBL A;  4O4U A;  1CRB A;  5F6B A;  4AW8 A;  4YFQ A;  3U9P C;  5HZ5 A;  4TKH A;  4ZFX A;  2GTL N;  5LJK A;  4HPC A;  2BT9 A;  3NPO A;  1URE A;  4N7D A;  3MBT A;  1DZP A;  4U8U N;  2NNQ A;  5H8T A;  1I06 A;  3BY0 A;  3MVF A;  4I9S A;  3RZY A;  3P6H A;  1BJ7 A;  4QRL A;  1BM5 A;  1IFB A;  2ANS A;  4EXZ A;  1KXO A;  4XMH A;  1LNM A;  3NX2 A;  2N93 A;  1E00 A;  1G85 A;  4YKM A;  1KT4 A;  1LIB A;  2JW1 A;  1QG5 A;  1O8V A;  1N0S A;  2RCQ A;  5HWZ A;  3O2Y A;  1TW4 A;  3B2L A;  1BWY A;  5FAZ A;  4IAB A;  1XKI A;  3P24 A;  1AEL A;  3FEN A;  1RLB E;  5D45 A;  3TGC A;  2AKQ A;  3Q6L A;  1QFT A;  4GDZ A;  4TKJ A;  5K06 A;  1YP7 A;  3K3L A;  4CK4 A;  4YKO A;  3GE2 A;  1JBH A;  2AT0 X;  3F9D A;  2MO5 A;  3KZA A;  3P6D A;  4LZV A;  4YGH A;  4KCA A;  3ZW0 A;  1JYJ A;  4QAE A;  3VG5 A;  1KT5 A;  3S5X A;  4O3X B;  3UEV A;  2L5P A;  4KC8 A;  3EYC A;  3FW5 A;  2MM3 A;  2MJI A;  1KQW A;  2W2B A;  2NP1 A;  2NND A;  1KOI A;  3FIQ A;  1EAL A;  2ASN X;  1BSQ A;  4QZU A;  1S2P A;  3FYF A;  1EPB A;  4YCE A;  5BYP A;  1LFO A;  2KW1 A;  2NNE A;  5LJD A;  1CBI A;  4Y0R A;  4AZO A;  3ZUI A;  3AKN A;  3APW A;  1EQD A;  1GX8 A;  2WR6 A;  5JR8 A;  4COT A;  3NQ3 A;  3KFH A;  2YMS A;  4AZQ A;  3SOT A;  4RUN A;  2Q2P A;  2QO4 A;  4TJZ A;  4GRJ A;  4UU3 A;  1LPJ A;  1ERX A;  3STN A;  3TF6 A;  1IIU A;  4IBA A;  3DSZ A;  4Y0S A;  1LIC A;  4FBV A;  3FEP A;  1A3Y A;  4ZHC A;  2ACO A;  3RSW A;  1EXS A;  1OBP A;  3BU9 A;  1GKA B;  5LKE A;  3NAD A;  2HYS A;  5CYB A;  1E5P A;  2AT8 X;  4ORX A;  4L3R A;  5EZ2 A;  2QOS C;  4WHI A;  4YFR A;  1JJX A;  1O1U A;  2X8T A;  4ML7 B;  1JYD A;  2F73 A;  2OVS A;  3RWX A;  4YFP A;  2JN3 A;  4QGX A;  5HTD A;  4ORW A;  1IKE A;  2W2F A;  4AZP A;  1FEL A;  1ADL A;  1X71 A;  1DZK A;  2X8S A;  5D48 A;  5IO6 A;  2XKL A;  2HLV A;  5HZ9 A;  4ZCB A;  4D6B A;  2GC9 A;  2ZAI A;  3IA8 A;  4XMG A;  1AQB A;  2QO6 A;  2X46 A;  1QQS A;  3WBG A;  3ZUO A;  1SXW A;  3N91 A;  4GE1 A;  4IB8 A;  1OEE A;  1U0X A;  5LKF A;  4D6A A;  3VU1 A;  5LJH A;  2BHV A;  1SY2 A;  2L68 A;  4M6S A;  4NW4 A;  3KFF A;  3U0D A;  1DFV A;  4EDE A;  5HAE A;  3O22 A;  3I0A A;  1B8E A;  2DM5 A;  4YDA A;  4HPB A;  2A2G A;  3IFB A;  3ZZV A;  1QY2 A;  4PJ2 A;  4GH7 A;  2HNX A;  3CR6 A;  2GTL M;  1P6P A;  2KTS A;  4FGI B;  4HPD A;  4I3B A;  4O9S A;  4ON1 A;  5H9A A;  3OD9 A;  1MDC A;  5HZ6 A;  2LA7 A;  4EEJ A;  3F6Z B;  4KII A;  2OFR X;  2FR3 A;  4U8U M;  4U3Q A;  4HWM A;  1G74 A;  4ZGF A;  5L8N A;  3NBX X;  2LBV A;  2CBS A;  1MVG A;  4XMF A;  1HMR A;  5H9K A;  3MX7 A;  1PBO A;  1ALB A;  4IAW A;  4O3W A;  2ZAG A;  3PED A;  4QQ1 A;  1LID A;  2JU7 A;  4BQU A;  1LKE A;  3T1D A;  2FWV A;  3PEC A;  3STM X;  5LJE A;  1FDQ A;  4NYQ A;  3UEW A;  3ZW1 B;  2MHD A;  5BVQ A;  4ZHG A;  2PY1 A;  1EUO A;  4IMO A;  4MVK A;  5LJB A;  2RD7 C;  4OS0 A;  3UEU A;  3APV A;  3NR3 A;  5F6Z A;  2A3F X;  4OMX A;  3CQN A;  1LIF A;  2CM9 A;  2AT5 X;  2CM4 A;  1LIE A;  2L9C A;  4A60 A;  2LB6 A;  3FR2 A;  5FEN A;  5FFH A;  2GTL O;  4XMC A;  4LKP A;  1YWD A;  4IB6 A;  4QNI A;  1BEB A;  1OBU A;  1X8U A;  4A1Y A;  4U8U O;  3OJY C;  1VYF A;  4JGL A;  4NLJ A;  5FQ6 E;  3V8U A;  3CWK A;  1DZJ A;  2JU8 A;  3GAQ A;  3PQU A;  4GNW A;  4YCH A;  4I3C A;  1ZNG A;  2WWP A;  5D47 A;  4FBR A;  4M7M A;  1EPA A;  1OEJ A;  3NQ9 A;  1YIV A;  2BS5 A;  3RKG A;  5EDC A;  1ICN A;  4N7C A;  2AT3 X;  1YWB A;  2POA A;  4MIS A;  3WJB A;  4Y0P A;  3F8A A;  5EDB A;  1E02 A;  4DQ3 A;  3BU1 A;  1CBS A;  2O62 A;  3I17 A;  1ZNE A;  5C0N A;  1MX8 A;  4R0B A;  3SAO A;  3HWF A;  3APX A;  2RA6 A;  1LF7 A;  3BLG A;  3OE3 A;  1D3S A;  1EW3 A;  2BS6 A;  1T0V A;  4HFO A;  4XME A;  3FW4 A;  5DG4 A;  5HCD C;  4A8Z A;  1SXY A;  3D95 A;  4I6S A;  5EPQ A;  2OVE A;  3EMM A;  1U17 A;  3VG6 A;  2EU7 X;  1ZNH A;  1S44 A;  5HCE C;  1FTP A;  3VE1 A;  3JQO A;  4CSB A;  1BBP A;  2AH7 X;  5D8J A;  1NGL A;  4KT5 A;  4ORR A;  5L8O A;  3CMP A;  2KTD A;  1T8V A;  3ELX A;  3U03 A;  1YWC A;  1JIW I;  2CZT A;  2FLJ A;  4QYP A;  2R74 A;  4I9R A;  3AKM A;  4QZT A;  2A2U A;  3BS2 A;  3VG2 A;  5AJC A;  3H3I A;  5KID A;  1TOU A;  3P6F A;  1B4M A;  4I95 A;  3JSQ A;  3ZQ3 A;  1QY1 A;  1X8O A;  2W2A A;  5F58 A;  1QFV A;  3PP6 A;  1S7D A;  3B2H A;  5HA0 A;  3FMZ A;  4HPA A;  4ODD A;  4CV7 A;  2RQ0 A;  3NX1 A;  3ZI8 A;  4ID2 A;  1KT3 A;  5HZ8 A;  1DZM A;  5CE4 A;  1GT5 A;  2Q4N A;  1GT1 A;  1QAB E;  1R0U A;  2FRS A;  2JU3 A;  1DC9 A;  4DQ4 A;  2RCT A;  4ORU A;  1E06 A;  2X45 A;  1O1V A;  4QYN A;  4YMY A;  1B0O A;  1JV4 A;  4O4X A;  4AZR A;  1KQX A;  2OFM X;  1EIO A;  1ML7 A;  4ZHH A;  4ES7 A;  5HZQ A;  1T68 X;  2FR2 A;  1YUP A;  3BDR A;  5EED A;  1I04 A;  4L1N A;  1OEK A;  4FBO A;  1XCA A;  3BSZ E;  3DTQ A;  4MVE A;  4LQZ A;  1CBR A;  2WEX A;  2WSJ A;  2G78 A;  1EI5 A;  3C77 X;  3HWD A;  1QY0 A;  3D4R A;  1A2D A;  2LBA A;  5LJC A;  1GT3 A;  3ZW0 B;  1BSY A;  5HA1 A;  1HN2 A;  3KQ0 A;  5AEO A;  2OVA A;  3WJD A;  3B2J A;  2CZU A;  4ORY A;  5IO7 A;  1L6M A;  2FS7 A;  4GNY A;  5FQ7 E;  4ALB A;  4XMD A;  3WJE A;  4AYH A;  2Q9S A;  3EM0 A;  5H9N A;  1OBQ A;  1SA8 A;  1DV9 A;  2FT9 A;  1MX7 A;  1OPB A;  4GZV A;  1IFC A;  3S26 A;  3UEX A;  1DF3 A;  4ZJ0 A;  5AQ6 A;  1A18 A;  4KC7 A;  1RBP A;  1EII A;  4TLJ A;  3FR4 A;  2QM9 A;  1H91 A;  4TNN A;  1X8P A;  1SY3 A;  1Y9T A;  4O4O A;  4ZHF A;  1SY1 A;  1BSO A;  2R73 A;  4YDB A;  1ZRY A;  4ALO A;  1CJ5 A;  2QO5 A;  3VG7 A;  1TOW A;  3P02 A;  3LV4 A;  2HZR A;  1SMP I;  4IMN A;  3TGA A;  5IO5 A;  1TVQ A;  3KFG A;  3FA6 A;  1IW2 A;  1AB0 A;  2K23 A;  3WXQ A;  2IFB A;  2WUT A;  2FTB A;  2BLG A;  3NP1 A;  4INN A;  5B29 A;  3ZW2 A;  1NP4 A;  4K19 A;  2ALL X;  2WQ9 A;  3EBK A;  3P6E A;  1GT4 A;  5KHP A;  3WJF A;  1NP1 A;  4OS8 A;  2A13 A;  2G7B A;  2WQA E;  3FA7 A;  4TKB A;  4FQB B;  5HBS A;  3HOE A;  1KZW A;  4ARH A;  2OZQ A;  1I4U A;  1YWA A;  1SXX A;  4IB9 A;  1GM6 A;  2KD2 A;  4I3D A;  3B2K A;  3FR5 A;  1BRQ A;  3BX8 A;  2ACP X;  3BX7 A;  4ZR2 A;  2HZQ A;  1GGL A;  2WEW A;  3LHN A;  4GK9 A;  5KIC A;  1HBP A;  2LFO A;  4ZGU A;  2JOZ A;  3ZWE A;  4MVL A;  2K62 A;  4Y0Q A;  3WOV A;  2CBR A;  3CQR A;  2Q39 A;  3WVM A;  4MIR A;  2MWH A;  1X8N A;  2OVD A;  4AZM A;  4YBU A;  1FEM A;  1Y9L A;  3PH6 A;  5HCC C;  4NLI A;  1JZU A;  3D96 A;  5DPQ A;  4O4S A;  1UZ2 X;  5H9L A;  4OMW A;  3S60 A;  1B56 A;  4O49 A;  1HBQ A;  4OS3 A;  1MUP A;  3TZS A;  2E4J A;  3P6G A;  3QKG A;  2L67 A;  3PH5 A;  1A57 A;  1G5W A;  4ORS A;  4WBK A;  1ICM A;  3ZW1 A;  1ACD A;  3D97 A;  3B2I A;  3PQS A;  3BRN A;  1PEE A;  5BVT A;  2P8G A;  4UU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...