1G5WA

Solution structure of human heart-type fatty acid binding protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
132
structure length
132
Chain Sequence
VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spin-system heterogeneities indicate a selected-fit mechanism in fatty acid binding to heart-type fatty acid-binding protein (H-FABP).
pubmed doi rcsb
molecule keywords FATTY ACID-BINDING PROTEIN
molecule tags Lipid binding protein
source organism Homo sapiens
total genus 21
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1g5wA00
1ML7A 1PMPA 5LJKA 2R56A 1GT4A 2FRSA 3CR6A 4ORYA 1IW2A 4YFPA 2NNDA 2MO5A 2FS6A 1HMSA 3ELXA 1OBUA 2OVAA 1XKIA 4HPBA 3C78X 1ERBA 4IAWA 1O8VA 4NYRA 5HWZA 1SXYA 1KQWA 2XSTA 3C76X 3NX1A 2X46A 3PH5A 4Y0PA 1UZ2X 2CBSA 1B8EA 1X8QA 4IB9A 3PEDA 4N7CA 5HCDC 1ERXA 1GGLA 4RUUA 4K19A 1HQPA 5EDCA 3KFIA 1LFOA 1GT1A 5HBSA 1EALA 4YGHA 3QKGA 2CM4A 3VG5A 1SXUA 5HTEA 4EFGA 5LJCA 3PH6A 4BOEA 1A18A 3BSZE 2WWPA 1YUPA 5HAEA 2JN3A 4KIIA 4MVLA 4D6BA 5KIDA 1BSOA 3RZYA 2K62A 1EIOA 4GKCA 5KHPA 3FW4A 3MBTA 2WEXA 1FELA 1MUPA 4GNYA 4AZOA 4ZHDA 3VG3A 4ZJ0A 3D96A 4UU3A 3BU9A 3U9PC 3K3LA 2BLGA 2XKLA 4GH7A 3WJCA 3WJBA 1GM6A 1DZMA 4ZCBA 4ORRA 1KQXA 4A1HA 5F6BA 4YGZA 1OPAA 2JOZA 3BRNA 2RCQA 3NR3A 4IBAA 4ZGUA 2WUTA 5DG4A 4YDAA 4IB6A 4XMHA 4BVMA 2G7BA 1P6PA 3I0AA 4LKTA 1OEJA 4XMEA 3TF6A 1QY0A 2AT3X 4OMWA 1ADLA 1GT5A 3STNA 3P6CA 4M6SA 3WXQA 3F8AA 5HZ8A 3F9DA 5HA1A 2OFMX 2AT0X 3VG7A 4AYHA 2FR2A 1LPJA 2Q4NA 3U03A 1D2UA 5D4AA 3FLLA 4D6AA 1EPAA 4OMXA 1KZWA 2WEWA 3APXA 2GTFX 2E4JA 3B2IA 3C77X 4ES7A 1ZNKA 2N93A 4HPCA 5HZ9A 1DF3A 4IB7A 2ACOA 2G78A 4LZVA 4I3DA 3TGBA 4GNWA 3KFHA 2FR3A 4QZTA 3DTQA 1FDQA 4QYPA 1D3SA 2OVDA 1HMRA 1PEEA 3ZUIA 1QG5A 3FA7A 1U0XA 2P8GA 4PSQA 1GXAA 1GX9A 4AZNA 4A1YA 5D8JA 3RSWA 4TLJA 4MVIA 2AMMX 4XMGA 5H9KA 2L5PA 2FTBA 5H8TA 5F1EA 5BVTA 1KT5A 1QWDA 4I9RA 3IFBA 1AELA 4DQ4A 5BVQA 1T68X 3KZAA 2L68A 3NQ9A 5HZ5A 2FS7A 4ZHFA 4NYQA 4ZHGA 1EXSA 1GX8A 4YKMA 1GKAB 5L8OA 3BU1A 1RBPA 1RLBE 2KTDA 5LJHA 3U0DA 1BEBA 3WJFA 2X45A 5HA0A 1QY1A 1OEEA 1YIVA 1IFBA 1S2PA 5LJGA 1BRPA 3L4RA 5IO6A 2RD7C 3CQNA 3PPTA 2FLJA 4QGXA 5DPQA 2W2AA 1CBQA 5H9LA 1LIFA 1AQBA 3FA6A 3WJDA 3APUA 4GETA 1JBHA 5D48A 1EIIA 3HK1A 2A2GA 3T1DA 2YG2A 3NQ3A 1EQDA 2FT9A 1TOUA 4I3BA 4GRJA 5F7GA 3B2KA 4TKJA 1CBSA 4A8ZA 1AVGI 4ORXA 1S44A 4Y0QA 4QGVA 3P6EA 3HWFA 1FEMA 5D45A 1I4UA 3EM0A 2K23A 4YCHA 4I9SA 1FE3A 2W2FA 5IO5A 1X8PA 2L9CA 5F6ZA 4YCEA 5EPQA 1CJ5A 4R0BA 2RQ0A 2W2BA 3EBWA 4QZUA 4CK4A 5CE4A 1SY2A 1H91A 4A60A 1ZRYA 1G7NA 1G85A 1EUOA 3PECA 3VG4A 2OZQA 3STMX 2G79A 4ALBA 2QO5A 1BRQA 1KGLA 3O22A 1LIDA 3IA8A 5FFHA 1YWCA 1MDCA 1ALBA 1LF7A 4NLIA 4AZQA 2NP1A 1SA8A 5L8NA 4OS0A 1A57A 1QABE 5LKFA 1DZPA 2QO4A 1MX8A 3P6DA 2CZUA 3BS2A 3FENA 3P6HA 1BSQA 4WFVA 1ZNEA 1HBQA 3STKA 3OJYC 3EYCA 4YH0A 4ZH9A 4N7DA 3HWDA 2LBAA 1CRBA 1DC9A 1SXXA 3HWEA 3KFFA 4AW8A 2ACPX 1SXWA 3AKNA 3EMMA 4OS8A 1A3YA 3FIQA 3SAOA 1LIEA 3NADA 2ANSA 1ACDA 4LZUA 1OEKA 5KICA 4NNSA 3TZSA 1YWAA 2Q2MA 4DQ3A 1YWBA 4HPAA 4NNTA 3FA9A 2O62A 2WSJA 1QFTA 4AZPA 1AB0A 3BY0A 1YP6A 4UU2A 2MJIA 1KT7A 2OFRX 1E00A 1TXLA 5LKEA 2LKKA 4ORUA 1JYJA 5LJDA 3CWKA 3FEKA 1G5WA 2CM9A 4YFQA 1FTPA 3FELA 4HPDA 1ICNA 2HZRA 1FENA 3EBKA 3BDRA 1OBQA 3S26A 2JU3A 1I06A 1QY2A 1T0VA 2CBRA 1NGLA 2RCTA 1CBRA 2JU7A 4ZHCA 1OPBA 5F58A 3D97A 5HCCC 5H9AA 1KT3A 1IKEA 3UEVA 1UREA 1JJJA 3NPOA 1N0SA 2AT8X 2MM3A 3CMPA 2HMBA 3CBSA 3JS1A 5BVSA 4AZMA 5FENA 3CBCA 2AL0X 1PM1X 1DZJA 2QO6A 1JJXA 3D95A 3BLGA 2Q9SA 3B2JA 4LKPA 1DZKA 2GJ5A 2HLVA 5H9NA 2Q2PA 1U17A 2ALLX 2F73A 2HYSA 3P6FA 3Q6LA 2RA6A 1VYGA 4XMDA 1YWDA 2AH7X 1ZNGA 4O9SA 4Y0SA 2LBVA 3JSQA 1JV4A 3FR2A 1GT3A 4QAEA 3ZQ3A 4EXZA 4HFOA 2WQ9A 3O19A 5HZ6A 3TGAA 1KZXA 1XCAA 2GC9A 3HWGA 4I3CA 3VG6A 1DFVA 4RUNA 4ZHHA 2HNXA 2EU7X 5IO7A 1TOWA 2A2UA 3FW5A 4XMFA 4IMNA 4IAXA 1KOIA 5AQ6A 2FWVA 3B2LA 5LJBA 3O2YA 4QYNA 2R74A 1E06A 5EDBA 4TQ2A 1NP1A 1MX7A 4TKHA 4WFUA 1E5PA 4TKBA 1ZNDA 2JU8A 3DSZA 1G74A 1KXOA 3WBGA 1L6MA 1LNMA 4M7MA 3WJGA 1I05A 2AT5X 1B0OA 2L67A 1ICMA 1A2DA 3APWA 4NLJA 5K06A 4TJZA 4ORWA 1SY0A 1B4MA 3FMZA 4YBUA 1LIBA 4IMOA 4ZR2A 1GKAA 3KFGA 4ARHA 1IFCA 3G7XA 3GAQA 1DV9A 1BBPA 1OBPA 4BQUA 1JYDA 1QFVA 4IB8A 2POAA 3P6GA 5LJEA 2HZQA 1U18A 3UEUA 5JR8A 5EEEA 3B2HA 4Y0RA 3MVFA 1HBPA 4TNNA 2NNQA 2DM5A 4YFRA 1Z24A 5HZQA 2CZTA 3WJEA 2WQAE 5D47A 4YKOA 1BLRA 2IFBA 4QGWA 4ORSA 4AZRA 4NP1A 1VPRA 5FAZA 1T8VA 1X71A 1HN2A 1YP7A 3BX7A 2ASNX 5EZ2A 3ZUOA 1TW4A 1BM5A 1R0UA 1O1VA 3KQ0A 3I17A 3PP6A 1B56A 2KT4B 3FA8A 5B29A 4EDEA 1O1UA 1BWYA 2PY1A 2AKQA 1X89A 3FEPA 1X8UA 2NNEA 1S7DA 4EEJA 1BJ7A 3BX8A 1E02A 5HCEC 4ZH6A 1SY1A 1IIUA 4ZFXA 1IKJA 5HTDA 4GE1A 1LICA 2AT6X 1X8NA 1ZNHA 3FR4A 5B27A 2R73A 1I04A 5L8IA 1PBOA 1LKEA 3AKMA 3WVMA 3APVA 2LFOA 3UEXA 3VG2A 1QQSA 2LB6A 4OS3A 4YDBA 4YGGA 5EEDA 1SY3A 4ODDA 1TVQA 5C0NA 1HMTA 2A3FX 3FR5A 1MVGA 2A0AA 2QOSC 3NX2A 3NP1A 2Q39A 2OVEA 1VYFA 1JZUA 3CQRA 1KT4A 1NP4A 3ELZA 4ALOA 1KT6A 1CBIA 4MVKA 1EW3A 4YBPA 2A13A 4YMYA 3TGCA 1X8OA 1BSYA 3UEWA 2QM9A 4WBKA 2WR6A 4XMCA 1ZNLA 1EPBA
chains in the Genus database with same CATH superfamily
1ML7A 4JO6A 2RTGB 1PMPA 2IZGB 5LJKA 2R56A 4O3ZA 1GT4A 3HOEA 1LDOA 2FRSA 3CR6A 4FGIB 1IW2A 4ORYA 4YFPA 2NNDA 2MO5A 2FS6A 1HMSA 3ELXA 1I78A 1PBYA 4GZVA 4COTA 1OBUA 2OVAA 1XKIA 4I60A 1I9HA 4HPBA 1VWBB 2BS6A 3C78X 1ERBA 2RTDB 1O8VA 2BHVA 4IAWA 4NYRA 4U8UM 5HWZA 1SXYA 1KQWA 2LA7A 2XSTA 1W5RA 3C76X 3OD9A 5B10O 3NX1A 2X46A 1VWFB 3PH5A 4Y0PA 2X8TA 1UZ2X 2CBSA 1B8EA 1X8QA 4IB9A 3PEDA 4PJ2A 4N7CA 1Y9LA 1ERXA 4CDEA 5HCDC 4LQZA 4ID2A 4EQAC 4GGRA 1GGLA 4RUUA 2G5LA 1HQPA 4K19A 1Y9TA 5EDCA 3WYQA 3RDOA 3VPJE 3KFIA 1MOYA 1LFOA 1N9YA 5FQ8E 1GT1A 1OSPO 5HBSA 1EALA 1HQQA 4YGHA 3QKGA 2CM4A 3VG5A 1SXUA 5HTEA 4EFGA 5LJCA 3AEHA 3PH6A 4AW8A 4BOEA 1A18A 3D9WA 3P02A 4GK9A 1SWGA 3BSZE 3GE2A 2WWPA 2X8SA 1YUPA 2KTSA 3CKGA 5HAEA 3H3IA 2JN3A 4KIIA 4MVLA 1SRIA 4GD9A 3ZW2A 2BT9A 4D6BA 2IZEB 5KIDA 4I6SA 1BSOA 3RZYA 2K62A 1EIOA 4GKCA 5KHPA 2Y3FA 3FW4A 3MBTA 2WEXA 1FELA 2RTOB 1MUPA 4Z2OA 4GNYA 4O49A 3T2XA 4AZOA 5K67A 4ZHDA 4U8UO 3VG3A 2FKJA 4ZJ0A 3D96A 4UU3A 3SLJA 4BCSA 3BU9A 2VDFA 3U9PC 3K3LA 2BLGA 1SRFA 4CPHB 2XKLA 4GH7A 3WJCA 4BBOA 3WJBA 3SLTA 1GM6A 1DZMA 1LCWA 4ZCBA 1NBXA 4ORRA 5IXGA 1KQXA 4A1HA 2YMSA 5F6BA 1SRGA 1UYNX 3CKFA 4O3YA 5CYBA 4YGZA 1OPAA 2JOZA 3VHMA 3AUMO 4ON1A 1FJ1E 3VHIA 3BRNA 2RCQA 3NR3A 4IBAA 4ZGUA 3WZPA 1VWGB 2WUTA 5DG4A 4YDAA 4IB6A 4QQ1A 4XMHA 2G7BA 4BVMA 1P6PA 1W4TA 2IZIA 2UYWA 3I0AA 4LKTA 1OEJA 4XMEA 3TF6A 1QY0A 2AT3X 1JJUA 4OMWA 1ADLA 4JGLA 1GT5A 3STNA 2IZHB 3P6CA 4M6SA 3WXQA 3F8AA 3OBLA 5HZ8A 1KL4A 3F9DA 5HA1A 2OFMX 4DCBA 2AT0X 3VG7A 4AYHA 2FR2A 2DJGA 2AVIA 4O4UA 4BX5A 5B2AO 1LPJA 1SWSA 2Q4NA 4GDZA 4O3WA 3RKGA 3U03A 1KL5A 1D2UA 5D4AA 3FLLA 4D6AA 1EPAA 4OMXA 1KZWA 2WEWA 3APXA 2GTFX 2E4JA 3B2IA 3C77X 4ES7A 1ZNKA 2N93A 1JMZA 4HPCA 4BX7A 5HZ9A 1DF3A 4IB7A 2ACOA 2G78A 4LZVA 4I3DA 3TGBA 4GNWA 1SWTA 3KFHA 2OL6O 3T6LA 2OVSA 2FR3A 4QZTA 3DTQA 1FDQA 4L3RA 4QYPA 3LV4A 1D3SA 1SWLA 2OVDA 1HMRA 1SWHA 2JW1A 1PEEA 3ZUIA 1QG5A 1SWQA 3RE6A 3FA7A 1U0XA 2KD2A 2P8GA 4PSQA 2F01A 2RTEB 5FQ7E 1GXAA 1GX9A 1RXJA 2M4LA 5F2BA 3S60A 4A1YA 5D8JA 1SWNA 4AZNA 1N4JA 3RSWA 2FHLA 4TLJA 4MVIA 2AMMX 4L1NA 4XMGA 5H9KA 2L5PA 2FTBA 5H8TA 3N91A 2WPUA 1WBIA 5F1EA 1KT5A 5BVTA 1QWDA 2IZAA 2OL8O 4I9RA 3IFBA 2X34A 2IZFB 4DQ4A 5BVQA 1AELA 1T68X 2A5CA 1UYOX 2L68A 3KZAA 3NQ9A 4GGZA 5HZ5A 2FS7A 1VWJB 4ZHFA 4IRWA 4NYQA 4ZHGA 1EXSA 4KC8A 2FHNX 1GX8A 3NBXX 4U46A 4YKMA 1GKAB 1AVEA 5L8OA 3BU1A 1RBPA 1RLBE 2KTDA 5LJHA 3RY1A 1BEBA 3U0DA 3PQUA 3WJFA 1N43A 2X45A 5HA0A 1QY1A 1OEEA 1YIVA 1IFBA 1S2PA 2PI3O 4MIRA 5LJGA 1BRPA 3L4RA 5IO6A 4KCAA 4DNEA 2RD7C 3CQNA 3PPTA 2FLJA 1VWIB 4QGXA 4U3QA 5DPQA 3SLOA 2W2AA 3RWXA 1CBQA 1VWLB 1RAVA 5H9LA 1VWNB 5BYPA 4HWMA 1LIFA 2OF9A 4MEEA 1AQBA 4CDDA 3RDMA 3FA6A 1HXLA 3WJDA 3APUA 4GETA 3NQKA 5D48A 1JBHA 1EIIA 1MM9A 2A2GA 3HK1A 1SLDB 2YG2A 3NQ3A 4I95A 1EQDA 3T1DA 2FT9A 1TOUA 4I3BA 1K3BA 2GH7A 3PQSA 4GRJA 5F7GA 3B2KA 2X4MA 4TKJA 2RTJA 5B3MO 1CBSA 4A8ZA 1AVGI 4ORXA 1S44A 4Y0QA 4QGVA 3P6EA 3T2WA 3MG5A 1PTSA 4C5PA 3HWFA 1FEMA 2I5VO 1I4UA 1VWQB 3EM0A 2K23A 3LTWA 5D45A 4YCHA 3EW1A 1FE3A 2W2FA 1KFFA 4I9SA 5IO5A 3WZNA 1MK5A 1X8PA 2L9CA 5F6ZA 4YCEA 5EPQA 2OY5O 1CJ5A 4R0BA 2RQ0A 2W2BA 3EBWA 2RTQB 4QZUA 4CK4A 5CE4A 4JHQA 1SY2A 1H91A 4A60A 5CSEA 1ZRYA 1G7NA 3HOLA 1G85A 1EUOA 3PECA 3VG4A 2OZQA 3FYFA 3STMX 3ZW0B 2G79A 4ALBA 2QO5A 3EW2A 4U9CA 1BRQA 1SWRA 1KGLA 4BX6B 3O22A 1LIDA 3IA8A 3Q34A 4NW4A 1YWCA 1MDCA 1ALBA 1LF7A 4NLIA 5FFHA 3SZIA 4AZQA 4CSBA 4ML7B 2NP1A 3PK2A 1SA8A 3KVNA 5L8NA 4OS0A 4CV7A 4OELA 1A57A 1QABE 1SWJA 2DJFA 5LKFA 1DZPA 3HTYA 3ZW1B 2F09A 2GTLM 4O3XB 2QO4A 5B11O 1MX8A 3P6DA 2CZUA 3BS2A 3FENA 3P6HA 1BSQA 1SWUA 4WFVA 5AJBA 1ZNEA 1HBQA 2A5BA 3STKA 3OJYC 3ZWEA 4NV7A 2HKDA 3EYCA 2OY7A 4YH0A 1SWCA 4N7DA 4ZH9A 3HWDA 2LBAA 2RTFB 2Y32A 1SWAA 1CRBA 1DC9A 1VWHB 1SXXA 3HWEA 1RXHA 1MEPA 1DF8A 2RTRB 2ACPX 3KFFA 1SXWA 3AKNA 3VU1A 3EMMA 1VWRB 2X55A 4OS8A 1A3YA 3FIQA 3SAOA 1LIEA 4IMNA 3NADA 2ANSA 1ACDA 4LZUA 1OEKA 5KICA 4O4OA 4NNSA 1Y53X 4KH8A 1SWEA 1SWBA 1YWAA 3QQ2A 4O4SA 3TZSA 2Q2MA 4DQ3A 1YWBA 2MHDA 2KW1A 4HPAA 2G8CO 2RTIB 3FA9A 2O62A 2WSJA 1QFTA 4NNTA 4U8UN 3SOTA 4AZPA 1AB0A 3BY0A 1SLEB 1YP6A 4UU2A 3EC5A 3WZQA 2VFBA 2MJIA 1KT7A 2OFRX 1E00A 5B5GA 1TXLA 5LKEA 2ZAGA 2LKKA 4ORUA 4QNIA 1JYJA 5LJDA 3CWKA 3FEKA 1G5WA 2CM9A 5AJCA 5IRWA 1JIWI 4YFQA 2GTLO 5JD2A 2RTNB 1FTPA 3FELA 3E3CA 4HPDA 1Y0GA 1ICNA 4KT5A 2HZRA 1Y55X 2BC3A 3SZJA 1FENA 3EBKA 3BDRA 1OBQA 3S26A 3T6FA 2JU3A 1I06A 1QY2A 1T0VA 2CBRA 2OL7A 1NGLA 2RCTA 4MVEA 4CPHA 1CBRA 2JU7A 2C1SA 2RN4A 2RTHB 4ZHCA 1OPBA 1SRHA 5F58A 1SWDA 3D97A 5HCCC 3FIDA 4BJ8A 1VWMB 1KT3A 5H9AA 3MM0A 1IKEA 1NQMA 1UREA 3UEVA 3WBGA 3NPOA 1JJJA 2QCBA 1N0SA 2AT8X 2MM3A 4OEMA 3RDUA 3ZW1A 3CMPA 2HMBA 3CBSA 3JS1A 5BVSA 4AZMA 5FENA 2C1QA 3CBCA 1JMXA 2AL0X 2I5ZO 1PM1X 1SLFB 1AVDA 1DZJA 2QO6A 4Y5DA 3D95A 3LHNA 4KC7A 2OF8A 1JJXA 1VWKB 3BLGA 2Q9SA 3B2JA 4LKPA 1DZKA 2GJ5A 2HLVA 2IZCB 2RTCB 5H9NA 3RBYA 2OY8A 2Q2PA 1U17A 2ALLX 2F73A 2HYSA 3P6FA 3Q6LA 2RA6A 1VYGA 2BSZA 4ZGFA 4XMDA 1YWDA 3JQOA 2AH7X 1ZNGA 4YVBA 1WUBA 4O9SA 4Y0SA 2RTMA 2LBVA 4FBVA 3JSQA 1JV4A 3FR2A 1EI5A 1GT3A 4JNJA 4QAEA 3ZQ3A 4CDCA 4EXZA 1NQNA 4HFOA 2WQ9A 3O19A 4CPEA 5K68A 5HZ6A 3TGAA 3VE2A 1KZXA 1XCAA 1HXZA 2GTLN 1SLGB 2GC9A 3HWGA 4I3CA 3VG6A 1DFVA 1SREA 4RUNA 1SRJA 2HNXA 3X00A 4ZHHA 2AF5A 1STSB 2EU7X 5IO7A 1LCVA 1TOWA 2A2UA 3FW5A 4XMFA 4Y59A 1RSTB 2JGSA 1VWOB 2RTKA 1KOIA 3D4RA 2ZAIA 1GX3A 2FWVA 3B2LA 1SWFA 4IAXA 5AQ6A 4GDAA 4CPIA 3PDFA 5LJBA 1Y52X 3O2YA 4QYNA 4BX5B 1SWOA 1E2TA 2R74A 3SZHA 1E06A 5EDBA 4TQ2A 1NP1A 1LDQA 1SWPA 1MX7A 4Z2VA 2RTPB 1W6FA 4TKHA 4WFUA 1E5PA 4TKBA 1ZNDA 2JU8A 3DSZA 4IABA 1G74A 4BX7B 1KL3A 1KXOA 2MWHA 1L6MA 1LNMA 1SWKA 4GGTA 1I05A 2AT5X 1B0OA 4M7MA 5CHKA 5FQ6E 3WJGA 2L67A 1ICMA 2OY1O 1A2DA 3APWA 4NLJA 2Y3EA 5K06A 2X56A 3P24A 1JQPA 1VWAB 4ORWA 4TJZA 1SY0A 1B4MA 3FMZA 4YBUA 3RDXA 2OFAA 2OYBO 1LIBA 3HPEA 4IMOA 4ZR2A 1GKAA 1VWEB 2IZBA 3KFGA 3VGWA 4ARHA 1RSUB 1IFCA 3G7XA 1VWDB 3GAQA 1BBPA 1DV9A 1RXKA 2X8FA 1OBPA 2IZLB 1NC9A 4BQUA 1JYDA 1QFVA 4IB8A 2POAA 3F6ZB 3P6GA 5LJEA 2IZKA 2UZ2A 4GJSA 3RE5A 5AEOA 2IZJA 2HZQA 1U18A 3UEUA 5JR8A 5EEEA 3VHHA 3B2HA 4Y0RA 1HY2A 3MVFA 4GJVA 2OFBA 4GUZA 1HBPA 4TNNA 2RTBB 2NNQA 2DM5A 2ZSCA 3V8UA 4YFRA 1N7YA 1Z24A 1N9MA 2X32A 4Z2PA 5HZQA 4WHIA 2CZTA 3WJEA 2WQAE 4NV8A 5D47A 4YKOA 4Z28A 3WZOA 5IRAA 1BLRA 2IFBA 3ZI8A 4QGWA 4ORSA 4AZRA 4BGFA 4NP1A 4FBRA 1VPRA 1VYOA 5FAZA 1T8VA 1X71A 1HN2A 1YP7A 3BX7A 3RY2A 3OE3A 2ASNX 5EZ2A 3ZUOA 1LCZA 4Z27A 2CAMA 1TW4A 3WYPA 1BM5A 1R0UA 1O1VA 2BS5A 2C4IA 3MX7A 3KQ0A 5IRUA 2Z4IA 3I17A 3PP6A 1STRB 1B56A 2KT4B 3FA8A 4MISA 3VE1A 5B29A 2Z4HA 4EDEA 1VWPB 1O1UA 2A8GA 1BWYA 2PY1A 2AKQA 1X89A 3FDCA 2VFCA 3FEPA 3ZW0A 2FKGA 4B55A 1NDJA 1X8UA 1S7DA 1VWCB 1BJ7A 2NNEA 3BX8A 4EEJA 1E02A 1IJ8A 2QMIA 5HCEC 4BX6A 4QRLA 2IZDB 4ZH6A 5L3YA 1SY1A 3UAQA 1IIUA 4ZFXA 2RTAA 1IKJA 2RTLA 3ZZVA 5HTDA 4GE1A 4OKAA 4CDFA 1X8NA 1LICA 1ZNHA 2AT6X 3FR4A 5B27A 1LUQA 2R73A 1I04A 5L8IA 3S5VA 4EKVA 1PBOA 1STPA 3S5XA 4O4XA 2JMBA 1LKEA 4Z6JA 3AKMA 3WVMA 3APVA 2LFOA 3UEXA 4FBOA 2MF6A 1QQSA 2LB6A 4OS3A 4YDBA 3VG2A 2FGSA 3WOVA 4YGGA 5EEDA 1SY3A 5B5FA 4ODDA 1TVQA 4GU8A 5C0NA 1HMTA 2A3FX 3FR5A 1MVGA 2A0AA 2QOSC 3NX2A 3NP1A 2Q39A 2OVEA 1VYFA 3RDQA 3CQRA 1KT4A 1NP4A 3ELZA 4CPFA 1JZUA 1SMPI 4ALOA 1K24A 1KT6A 1CBIA 1LELA 1EW3A 4INNA 2A13A 4MVKA 3RDSA 4YBPA 1X8OA 1BSYA 4YMYA 2QOMA 3TGCA 3UEWA 2QM9A 4FQBB 4WBKA 2WR6A 4XMCA 1ZNLA 1EPBA
chains in the Genus database with same CATH topology
1ML7A 1PMPA 5LJKA 2R56A 4O3ZA 1GT4A 3HOEA 2FRSA 3CR6A 4FGIB 4ORYA 1IW2A 4YFPA 2NNDA 2MO5A 2FS6A 1HMSA 3ELXA 4GZVA 4COTA 1OBUA 2OVAA 1XKIA 4HPBA 2BS6A 3C78X 1ERBA 4IAWA 1O8VA 2BHVA 4NYRA 4U8UM 5HWZA 1SXYA 1KQWA 2LA7A 2XSTA 3OD9A 3C76X 3NX1A 2X46A 3PH5A 4Y0PA 2X8TA 1UZ2X 2CBSA 1B8EA 1X8QA 4IB9A 3PEDA 4PJ2A 4N7CA 1Y9LA 1ERXA 5HCDC 4LQZA 4ID2A 4EQAC 1GGLA 4RUUA 4K19A 1HQPA 1Y9TA 5EDCA 3VPJE 3KFIA 1LFOA 5FQ8E 1GT1A 5HBSA 1EALA 4YGHA 3QKGA 2CM4A 3VG5A 1SXUA 5HTEA 4EFGA 5LJCA 3PH6A 4BOEA 1A18A 3P02A 4GK9A 3BSZE 3GE2A 2WWPA 2X8SA 1YUPA 2KTSA 5HAEA 3H3IA 2JN3A 4KIIA 4MVLA 3ZW2A 2BT9A 4D6BA 5KIDA 4I6SA 1BSOA 3RZYA 2K62A 1EIOA 4GKCA 5KHPA 3FW4A 3MBTA 2WEXA 1FELA 1MUPA 4GNYA 4O49A 4AZOA 4ZHDA 4U8UO 3VG3A 4ZJ0A 3D96A 4UU3A 3BU9A 3U9PC 3K3LA 2BLGA 2XKLA 4GH7A 3WJCA 3WJBA 1GM6A 1DZMA 4ZCBA 4ORRA 1KQXA 4A1HA 2YMSA 5F6BA 4O3YA 5CYBA 4YGZA 1OPAA 2JOZA 4ON1A 3BRNA 2RCQA 3NR3A 4IBAA 4ZGUA 2WUTA 5DG4A 4YDAA 4IB6A 4QQ1A 4XMHA 2G7BA 4BVMA 1P6PA 3I0AA 4LKTA 1OEJA 4XMEA 3TF6A 1QY0A 2AT3X 4OMWA 1ADLA 4JGLA 1GT5A 3STNA 3P6CA 4M6SA 3WXQA 3F8AA 3OBLA 5HZ8A 3F9DA 5HA1A 2OFMX 2AT0X 3VG7A 4AYHA 2FR2A 4O4UA 1LPJA 2Q4NA 4O3WA 4GDZA 3U03A 1D2UA 5D4AA 3FLLA 4D6AA 1EPAA 4OMXA 1KZWA 2WEWA 3APXA 2GTFX 2E4JA 3B2IA 3C77X 4ES7A 1ZNKA 2N93A 4HPCA 5HZ9A 1DF3A 4IB7A 2ACOA 2G78A 4LZVA 4I3DA 3TGBA 4GNWA 3KFHA 2OVSA 2FR3A 4QZTA 3DTQA 1FDQA 4L3RA 4QYPA 3LV4A 1D3SA 2OVDA 1HMRA 1PEEA 2JW1A 3ZUIA 1QG5A 3FA7A 1U0XA 2KD2A 2P8GA 4PSQA 5FQ7E 1GXAA 1GX9A 2M4LA 3S60A 4A1YA 4AZNA 5D8JA 3RSWA 4TLJA 4MVIA 2AMMX 4L1NA 4XMGA 5H9KA 2L5PA 2FTBA 5H8TA 3N91A 5F1EA 5BVTA 1KT5A 1QWDA 4I9RA 3IFBA 1AELA 4DQ4A 5BVQA 1T68X 3KZAA 2L68A 3NQ9A 5HZ5A 2FS7A 4ZHFA 4NYQA 4ZHGA 1EXSA 4KC8A 1GX8A 3NBXX 4YKMA 1GKAB 5L8OA 3BU1A 1RBPA 1RLBE 2KTDA 5LJHA 3U0DA 1BEBA 3PQUA 3WJFA 2X45A 5HA0A 1QY1A 1OEEA 1YIVA 1IFBA 1S2PA 4MIRA 5LJGA 1BRPA 3L4RA 5IO6A 4KCAA 2RD7C 3CQNA 3PPTA 2FLJA 4QGXA 4U3QA 5DPQA 2W2AA 3RWXA 1CBQA 5H9LA 5BYPA 4HWMA 1LIFA 1AQBA 3FA6A 3WJDA 3APUA 4GETA 3NQKA 5D48A 1JBHA 1EIIA 3HK1A 2A2GA 4I95A 2YG2A 3NQ3A 3T1DA 1EQDA 2FT9A 1TOUA 4I3BA 3PQSA 4GRJA 5F7GA 3B2KA 4TKJA 1CBSA 4A8ZA 1AVGI 4ORXA 1S44A 4Y0QA 4QGVA 3P6EA 3HWFA 1FEMA 5D45A 1I4UA 3EM0A 2K23A 4YCHA 4I9SA 1FE3A 2W2FA 5IO5A 1X8PA 2L9CA 5F6ZA 4YCEA 5EPQA 1CJ5A 4R0BA 2RQ0A 2W2BA 3EBWA 4QZUA 4CK4A 5CE4A 1SY2A 1H91A 4A60A 1ZRYA 1G7NA 3HOLA 1G85A 1EUOA 3PECA 3VG4A 2OZQA 3FYFA 3STMX 3ZW0B 2G79A 4ALBA 2QO5A 4U9CA 1BRQA 1KGLA 3O22A 1LIDA 3IA8A 4NW4A 5FFHA 1YWCA 1MDCA 1ALBA 1LF7A 4NLIA 4AZQA 4CSBA 4ML7B 2NP1A 1SA8A 5L8NA 4OS0A 4CV7A 1A57A 1QABE 5LKFA 1DZPA 3HTYA 3ZW1B 2F09A 2GTLM 4O3XB 2QO4A 1MX8A 3P6DA 2CZUA 3BS2A 3FENA 3P6HA 1BSQA 4WFVA 5AJBA 1ZNEA 1HBQA 3STKA 3OJYC 3ZWEA 3EYCA 4YH0A 4ZH9A 4N7DA 3HWDA 2LBAA 1CRBA 1DC9A 1SXXA 3HWEA 3KFFA 4AW8A 2ACPX 1SXWA 3AKNA 3VU1A 3EMMA 4OS8A 1A3YA 3FIQA 3SAOA 1LIEA 3NADA 2ANSA 1ACDA 4LZUA 1OEKA 5KICA 4O4OA 4NNSA 4KH8A 3TZSA 1YWAA 4O4SA 2Q2MA 4DQ3A 1YWBA 2MHDA 2KW1A 4HPAA 3FA9A 4NNTA 3SOTA 2O62A 2WSJA 1QFTA 4U8UN 4AZPA 1AB0A 3BY0A 1YP6A 4UU2A 2MJIA 1KT7A 2OFRX 1E00A 1TXLA 5LKEA 2ZAGA 2LKKA 4ORUA 4QNIA 1JYJA 5LJDA 3CWKA 3FEKA 1G5WA 2CM9A 5AJCA 1JIWI 4YFQA 2GTLO 1FTPA 3FELA 3E3CA 4HPDA 1ICNA 4KT5A 2HZRA 1FENA 3EBKA 3BDRA 1OBQA 3S26A 2JU3A 1I06A 1QY2A 1T0VA 2CBRA 1NGLA 2RCTA 4MVEA 1CBRA 2JU7A 2RN4A 4ZHCA 1OPBA 5F58A 3D97A 5HCCC 5H9AA 1KT3A 1IKEA 3UEVA 1UREA 1JJJA 3NPOA 1N0SA 2AT8X 2MM3A 3ZW1A 3CMPA 2HMBA 3CBSA 3JS1A 5BVSA 4AZMA 5FENA 3CBCA 2AL0X 1PM1X 1DZJA 2QO6A 1JJXA 3D95A 3LHNA 4KC7A 3BLGA 2Q9SA 3B2JA 4LKPA 1DZKA 2GJ5A 2HLVA 5H9NA 3RBYA 2Q2PA 1U17A 2ALLX 2F73A 2HYSA 3P6FA 3Q6LA 2RA6A 1VYGA 4ZGFA 4XMDA 1YWDA 3JQOA 2AH7X 1ZNGA 4O9SA 4Y0SA 2LBVA 4FBVA 3JSQA 1JV4A 3FR2A 1EI5A 1GT3A 4QAEA 3ZQ3A 4EXZA 4HFOA 2WQ9A 3O19A 5HZ6A 3TGAA 3VE2A 1KZXA 1XCAA 2GTLN 2GC9A 3HWGA 4I3CA 3VG6A 1DFVA 4RUNA 4ZHHA 2HNXA 2EU7X 5IO7A 1TOWA 2A2UA 3FW5A 4XMFA 4IMNA 3D4RA 4IAXA 1KOIA 5AQ6A 2ZAIA 2FWVA 3B2LA 5LJBA 3O2YA 4QYNA 2R74A 1E06A 5EDBA 4TQ2A 1NP1A 1MX7A 4TKHA 4WFUA 1E5PA 4TKBA 1ZNDA 2JU8A 3DSZA 4IABA 1G74A 1KXOA 2MWHA 1L6MA 1LNMA 4M7MA 5FQ6E 1I05A 2AT5X 1B0OA 3WBGA 3WJGA 2L67A 1ICMA 1A2DA 3APWA 4NLJA 5K06A 3P24A 4TJZA 4ORWA 1SY0A 1B4MA 3FMZA 4YBUA 1LIBA 4IMOA 4ZR2A 1GKAA 3KFGA 4ARHA 1IFCA 3G7XA 3GAQA 1DV9A 1BBPA 2X8FA 1OBPA 4BQUA 1JYDA 1QFVA 4IB8A 2POAA 3F6ZB 3P6GA 5LJEA 5AEOA 2HZQA 1U18A 3UEUA 5JR8A 5EEEA 3B2HA 4Y0RA 3MVFA 1HBPA 4TNNA 2NNQA 2DM5A 3V8UA 4YFRA 1Z24A 5HZQA 4WHIA 2CZTA 3WJEA 2WQAE 5D47A 4YKOA 1BLRA 2IFBA 3ZI8A 4QGWA 4ORSA 4AZRA 4NP1A 4FBRA 1VPRA 5FAZA 1T8VA 1X71A 1HN2A 1YP7A 3BX7A 3OE3A 2ASNX 5EZ2A 3ZUOA 1TW4A 1BM5A 1R0UA 1O1VA 2BS5A 3MX7A 3KQ0A 2Z4IA 3I17A 3PP6A 3VE1A 1B56A 2KT4B 3FA8A 4MISA 5B29A 2Z4HA 4EDEA 1O1UA 1BWYA 2PY1A 2AKQA 1X89A 3FEPA 3ZW0A 1X8UA 2NNEA 1S7DA 4EEJA 1BJ7A 3BX8A 1E02A 2QMIA 5HCEC 4QRLA 4ZH6A 1SY1A 3UAQA 1IIUA 4ZFXA 1IKJA 3ZZVA 5HTDA 4GE1A 1LICA 2AT6X 1X8NA 1ZNHA 3FR4A 5B27A 2R73A 1I04A 5L8IA 3S5VA 1PBOA 3S5XA 4O4XA 2JMBA 1LKEA 3AKMA 3WVMA 3APVA 2LFOA 3UEXA 4FBOA 3VG2A 1QQSA 2LB6A 4OS3A 4YDBA 3WOVA 4YGGA 5EEDA 1SY3A 4ODDA 1TVQA 4GU8A 5C0NA 1HMTA 2A3FX 3FR5A 1MVGA 2A0AA 2QOSC 3NX2A 3NP1A 2Q39A 2OVEA 1VYFA 3RKGA 3CQRA 1KT4A 1NP4A 3ELZA 1JZUA 1SMPI 4ALOA 1KT6A 4INNA 1CBIA 4MVKA 1EW3A 4YBPA 2A13A 4YMYA 3TGCA 1X8OA 1BSYA 3UEWA 2QM9A 4FQBB 4WBKA 2WR6A 4XMCA 1ZNLA 1EPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML7 A;  1PMP A;  5LJK A;  2R56 A;  1GT4 A;  2FRS A;  3CR6 A;  4ORY A;  1IW2 A;  4YFP A;  2NND A;  2MO5 A;  2FS6 A;  1HMS A;  3ELX A;  1OBU A;  2OVA A;  1XKI A;  4HPB A;  3C78 X;  1ERB A;  4IAW A;  1O8V A;  4NYR A;  5HWZ A;  1SXY A;  1KQW A;  2XST A;  3C76 X;  3NX1 A;  2X46 A;  3PH5 A;  4Y0P A;  1UZ2 X;  2CBS A;  1B8E A;  1X8Q A;  4IB9 A;  3PED A;  4N7C A;  5HCD C;  1ERX A;  1GGL A;  4RUU A;  4K19 A;  1HQP A;  5EDC A;  3KFI A;  1LFO A;  1GT1 A;  5HBS A;  1EAL A;  4YGH A;  3QKG A;  2CM4 A;  3VG5 A;  1SXU A;  5HTE A;  4EFG A;  5LJC A;  3PH6 A;  4BOE A;  1A18 A;  3BSZ E;  2WWP A;  1YUP A;  5HAE A;  2JN3 A;  4KII A;  4MVL A;  4D6B A;  5KID A;  1BSO A;  3RZY A;  2K62 A;  1EIO A;  4GKC A;  5KHP A;  3FW4 A;  3MBT A;  2WEX A;  1FEL A;  1MUP A;  4GNY A;  4AZO A;  4ZHD A;  3VG3 A;  4ZJ0 A;  3D96 A;  4UU3 A;  3BU9 A;  3U9P C;  3K3L A;  2BLG A;  2XKL A;  4GH7 A;  3WJC A;  3WJB A;  1GM6 A;  1DZM A;  4ZCB A;  4ORR A;  1KQX A;  4A1H A;  5F6B A;  4YGZ A;  1OPA A;  2JOZ A;  3BRN A;  2RCQ A;  3NR3 A;  4IBA A;  4ZGU A;  2WUT A;  5DG4 A;  4YDA A;  4IB6 A;  4XMH A;  4BVM A;  2G7B A;  1P6P A;  3I0A A;  4LKT A;  1OEJ A;  4XME A;  3TF6 A;  1QY0 A;  2AT3 X;  4OMW A;  1ADL A;  1GT5 A;  3STN A;  3P6C A;  4M6S A;  3WXQ A;  3F8A A;  5HZ8 A;  3F9D A;  5HA1 A;  2OFM X;  2AT0 X;  3VG7 A;  4AYH A;  2FR2 A;  1LPJ A;  2Q4N A;  3U03 A;  1D2U A;  5D4A A;  3FLL A;  4D6A A;  1EPA A;  4OMX A;  1KZW A;  2WEW A;  3APX A;  2GTF X;  2E4J A;  3B2I A;  3C77 X;  4ES7 A;  1ZNK A;  2N93 A;  4HPC A;  5HZ9 A;  1DF3 A;  4IB7 A;  2ACO A;  2G78 A;  4LZV A;  4I3D A;  3TGB A;  4GNW A;  3KFH A;  2FR3 A;  4QZT A;  3DTQ A;  1FDQ A;  4QYP A;  1D3S A;  2OVD A;  1HMR A;  1PEE A;  3ZUI A;  1QG5 A;  3FA7 A;  1U0X A;  2P8G A;  4PSQ A;  1GXA A;  1GX9 A;  4AZN A;  4A1Y A;  5D8J A;  3RSW A;  4TLJ A;  4MVI A;  2AMM X;  4XMG A;  5H9K A;  2L5P A;  2FTB A;  5H8T A;  5F1E A;  5BVT A;  1KT5 A;  1QWD A;  4I9R A;  3IFB A;  1AEL A;  4DQ4 A;  5BVQ A;  1T68 X;  3KZA A;  2L68 A;  3NQ9 A;  5HZ5 A;  2FS7 A;  4ZHF A;  4NYQ A;  4ZHG A;  1EXS A;  1GX8 A;  4YKM A;  1GKA B;  5L8O A;  3BU1 A;  1RBP A;  1RLB E;  2KTD A;  5LJH A;  3U0D A;  1BEB A;  3WJF A;  2X45 A;  5HA0 A;  1QY1 A;  1OEE A;  1YIV A;  1IFB A;  1S2P A;  5LJG A;  1BRP A;  3L4R A;  5IO6 A;  2RD7 C;  3CQN A;  3PPT A;  2FLJ A;  4QGX A;  5DPQ A;  2W2A A;  1CBQ A;  5H9L A;  1LIF A;  1AQB A;  3FA6 A;  3WJD A;  3APU A;  4GET A;  1JBH A;  5D48 A;  1EII A;  3HK1 A;  2A2G A;  3T1D A;  2YG2 A;  3NQ3 A;  1EQD A;  2FT9 A;  1TOU A;  4I3B A;  4GRJ A;  5F7G A;  3B2K A;  4TKJ A;  1CBS A;  4A8Z A;  1AVG I;  4ORX A;  1S44 A;  4Y0Q A;  4QGV A;  3P6E A;  3HWF A;  1FEM A;  5D45 A;  1I4U A;  3EM0 A;  2K23 A;  4YCH A;  4I9S A;  1FE3 A;  2W2F A;  5IO5 A;  1X8P A;  2L9C A;  5F6Z A;  4YCE A;  5EPQ A;  1CJ5 A;  4R0B A;  2RQ0 A;  2W2B A;  3EBW A;  4QZU A;  4CK4 A;  5CE4 A;  1SY2 A;  1H91 A;  4A60 A;  1ZRY A;  1G7N A;  1G85 A;  1EUO A;  3PEC A;  3VG4 A;  2OZQ A;  3STM X;  2G79 A;  4ALB A;  2QO5 A;  1BRQ A;  1KGL A;  3O22 A;  1LID A;  3IA8 A;  5FFH A;  1YWC A;  1MDC A;  1ALB A;  1LF7 A;  4NLI A;  4AZQ A;  2NP1 A;  1SA8 A;  5L8N A;  4OS0 A;  1A57 A;  1QAB E;  5LKF A;  1DZP A;  2QO4 A;  1MX8 A;  3P6D A;  2CZU A;  3BS2 A;  3FEN A;  3P6H A;  1BSQ A;  4WFV A;  1ZNE A;  1HBQ A;  3STK A;  3OJY C;  3EYC A;  4YH0 A;  4ZH9 A;  4N7D A;  3HWD A;  2LBA A;  1CRB A;  1DC9 A;  1SXX A;  3HWE A;  3KFF A;  4AW8 A;  2ACP X;  1SXW A;  3AKN A;  3EMM A;  4OS8 A;  1A3Y A;  3FIQ A;  3SAO A;  1LIE A;  3NAD A;  2ANS A;  1ACD A;  4LZU A;  1OEK A;  5KIC A;  4NNS A;  3TZS A;  1YWA A;  2Q2M A;  4DQ3 A;  1YWB A;  4HPA A;  4NNT A;  3FA9 A;  2O62 A;  2WSJ A;  1QFT A;  4AZP A;  1AB0 A;  3BY0 A;  1YP6 A;  4UU2 A;  2MJI A;  1KT7 A;  2OFR X;  1E00 A;  1TXL A;  5LKE A;  2LKK A;  4ORU A;  1JYJ A;  5LJD A;  3CWK A;  3FEK A;  1G5W A;  2CM9 A;  4YFQ A;  1FTP A;  3FEL A;  4HPD A;  1ICN A;  2HZR A;  1FEN A;  3EBK A;  3BDR A;  1OBQ A;  3S26 A;  2JU3 A;  1I06 A;  1QY2 A;  1T0V A;  2CBR A;  1NGL A;  2RCT A;  1CBR A;  2JU7 A;  4ZHC A;  1OPB A;  5F58 A;  3D97 A;  5HCC C;  5H9A A;  1KT3 A;  1IKE A;  3UEV A;  1URE A;  1JJJ A;  3NPO A;  1N0S A;  2AT8 X;  2MM3 A;  3CMP A;  2HMB A;  3CBS A;  3JS1 A;  5BVS A;  4AZM A;  5FEN A;  3CBC A;  2AL0 X;  1PM1 X;  1DZJ A;  2QO6 A;  1JJX A;  3D95 A;  3BLG A;  2Q9S A;  3B2J A;  4LKP A;  1DZK A;  2GJ5 A;  2HLV A;  5H9N A;  2Q2P A;  1U17 A;  2ALL X;  2F73 A;  2HYS A;  3P6F A;  3Q6L A;  2RA6 A;  1VYG A;  4XMD A;  1YWD A;  2AH7 X;  1ZNG A;  4O9S A;  4Y0S A;  2LBV A;  3JSQ A;  1JV4 A;  3FR2 A;  1GT3 A;  4QAE A;  3ZQ3 A;  4EXZ A;  4HFO A;  2WQ9 A;  3O19 A;  5HZ6 A;  3TGA A;  1KZX A;  1XCA A;  2GC9 A;  3HWG A;  4I3C A;  3VG6 A;  1DFV A;  4RUN A;  4ZHH A;  2HNX A;  2EU7 X;  5IO7 A;  1TOW A;  2A2U A;  3FW5 A;  4XMF A;  4IMN A;  4IAX A;  1KOI A;  5AQ6 A;  2FWV A;  3B2L A;  5LJB A;  3O2Y A;  4QYN A;  2R74 A;  1E06 A;  5EDB A;  4TQ2 A;  1NP1 A;  1MX7 A;  4TKH A;  4WFU A;  1E5P A;  4TKB A;  1ZND A;  2JU8 A;  3DSZ A;  1G74 A;  1KXO A;  3WBG A;  1L6M A;  1LNM A;  4M7M A;  3WJG A;  1I05 A;  2AT5 X;  1B0O A;  2L67 A;  1ICM A;  1A2D A;  3APW A;  4NLJ A;  5K06 A;  4TJZ A;  4ORW A;  1SY0 A;  1B4M A;  3FMZ A;  4YBU A;  1LIB A;  4IMO A;  4ZR2 A;  1GKA A;  3KFG A;  4ARH A;  1IFC A;  3G7X A;  3GAQ A;  1DV9 A;  1BBP A;  1OBP A;  4BQU A;  1JYD A;  1QFV A;  4IB8 A;  2POA A;  3P6G A;  5LJE A;  2HZQ A;  1U18 A;  3UEU A;  5JR8 A;  5EEE A;  3B2H A;  4Y0R A;  3MVF A;  1HBP A;  4TNN A;  2NNQ A;  2DM5 A;  4YFR A;  1Z24 A;  5HZQ A;  2CZT A;  3WJE A;  2WQA E;  5D47 A;  4YKO A;  1BLR A;  2IFB A;  4QGW A;  4ORS A;  4AZR A;  4NP1 A;  1VPR A;  5FAZ A;  1T8V A;  1X71 A;  1HN2 A;  1YP7 A;  3BX7 A;  2ASN X;  5EZ2 A;  3ZUO A;  1TW4 A;  1BM5 A;  1R0U A;  1O1V A;  3KQ0 A;  3I17 A;  3PP6 A;  1B56 A;  2KT4 B;  3FA8 A;  5B29 A;  4EDE A;  1O1U A;  1BWY A;  2PY1 A;  2AKQ A;  1X89 A;  3FEP A;  1X8U A;  2NNE A;  1S7D A;  4EEJ A;  1BJ7 A;  3BX8 A;  1E02 A;  5HCE C;  4ZH6 A;  1SY1 A;  1IIU A;  4ZFX A;  1IKJ A;  5HTD A;  4GE1 A;  1LIC A;  2AT6 X;  1X8N A;  1ZNH A;  3FR4 A;  5B27 A;  2R73 A;  1I04 A;  5L8I A;  1PBO A;  1LKE A;  3AKM A;  3WVM A;  3APV A;  2LFO A;  3UEX A;  3VG2 A;  1QQS A;  2LB6 A;  4OS3 A;  4YDB A;  4YGG A;  5EED A;  1SY3 A;  4ODD A;  1TVQ A;  5C0N A;  1HMT A;  2A3F X;  3FR5 A;  1MVG A;  2A0A A;  2QOS C;  3NX2 A;  3NP1 A;  2Q39 A;  2OVE A;  1VYF A;  1JZU A;  3CQR A;  1KT4 A;  1NP4 A;  3ELZ A;  4ALO A;  1KT6 A;  1CBI A;  4MVK A;  1EW3 A;  4YBP A;  2A13 A;  4YMY A;  3TGC A;  1X8O A;  1BSY A;  3UEW A;  2QM9 A;  4WBK A;  2WR6 A;  4XMC A;  1ZNL A;  1EPB A; 
#chains in the Genus database with same CATH topology
 1ML7 A;  4JO6 A;  2RTG B;  1PMP A;  2IZG B;  5LJK A;  2R56 A;  4O3Z A;  1GT4 A;  3HOE A;  1LDO A;  2FRS A;  3CR6 A;  4FGI B;  1IW2 A;  4ORY A;  4YFP A;  2NND A;  2MO5 A;  2FS6 A;  1HMS A;  3ELX A;  1I78 A;  1PBY A;  4GZV A;  4COT A;  1OBU A;  2OVA A;  1XKI A;  4I60 A;  1I9H A;  4HPB A;  1VWB B;  2BS6 A;  3C78 X;  1ERB A;  2RTD B;  1O8V A;  2BHV A;  4IAW A;  4NYR A;  4U8U M;  5HWZ A;  1SXY A;  1KQW A;  2LA7 A;  2XST A;  1W5R A;  3C76 X;  3OD9 A;  5B10 O;  3NX1 A;  2X46 A;  1VWF B;  3PH5 A;  4Y0P A;  2X8T A;  1UZ2 X;  2CBS A;  1B8E A;  1X8Q A;  4IB9 A;  3PED A;  4PJ2 A;  4N7C A;  1Y9L A;  1ERX A;  4CDE A;  5HCD C;  4LQZ A;  4ID2 A;  4EQA C;  4GGR A;  1GGL A;  4RUU A;  2G5L A;  1HQP A;  4K19 A;  1Y9T A;  5EDC A;  3WYQ A;  3RDO A;  3VPJ E;  3KFI A;  1MOY A;  1LFO A;  1N9Y A;  5FQ8 E;  1GT1 A;  1OSP O;  5HBS A;  1EAL A;  1HQQ A;  4YGH A;  3QKG A;  2CM4 A;  3VG5 A;  1SXU A;  5HTE A;  4EFG A;  5LJC A;  3AEH A;  3PH6 A;  4AW8 A;  4BOE A;  1A18 A;  3D9W A;  3P02 A;  4GK9 A;  1SWG A;  3BSZ E;  3GE2 A;  2WWP A;  2X8S A;  1YUP A;  2KTS A;  3CKG A;  5HAE A;  3H3I A;  2JN3 A;  4KII A;  4MVL A;  1SRI A;  4GD9 A;  3ZW2 A;  2BT9 A;  4D6B A;  2IZE B;  5KID A;  4I6S A;  1BSO A;  3RZY A;  2K62 A;  1EIO A;  4GKC A;  5KHP A;  2Y3F A;  3FW4 A;  3MBT A;  2WEX A;  1FEL A;  2RTO B;  1MUP A;  4Z2O A;  4GNY A;  4O49 A;  3T2X A;  4AZO A;  5K67 A;  4ZHD A;  4U8U O;  3VG3 A;  2FKJ A;  4ZJ0 A;  3D96 A;  4UU3 A;  3SLJ A;  4BCS A;  3BU9 A;  2VDF A;  3U9P C;  3K3L A;  2BLG A;  1SRF A;  4CPH B;  2XKL A;  4GH7 A;  3WJC A;  4BBO A;  3WJB A;  3SLT A;  1GM6 A;  1DZM A;  1LCW A;  4ZCB A;  1NBX A;  4ORR A;  5IXG A;  1KQX A;  4A1H A;  2YMS A;  5F6B A;  1SRG A;  1UYN X;  3CKF A;  4O3Y A;  5CYB A;  4YGZ A;  1OPA A;  2JOZ A;  3VHM A;  3AUM O;  4ON1 A;  1FJ1 E;  3VHI A;  3BRN A;  2RCQ A;  3NR3 A;  4IBA A;  4ZGU A;  3WZP A;  1VWG B;  2WUT A;  5DG4 A;  4YDA A;  4IB6 A;  4QQ1 A;  4XMH A;  2G7B A;  4BVM A;  1P6P A;  1W4T A;  2IZI A;  2UYW A;  3I0A A;  4LKT A;  1OEJ A;  4XME A;  3TF6 A;  1QY0 A;  2AT3 X;  1JJU A;  4OMW A;  1ADL A;  4JGL A;  1GT5 A;  3STN A;  2IZH B;  3P6C A;  4M6S A;  3WXQ A;  3F8A A;  3OBL A;  5HZ8 A;  1KL4 A;  3F9D A;  5HA1 A;  2OFM X;  4DCB A;  2AT0 X;  3VG7 A;  4AYH A;  2FR2 A;  2DJG A;  2AVI A;  4O4U A;  4BX5 A;  5B2A O;  1LPJ A;  1SWS A;  2Q4N A;  4GDZ A;  4O3W A;  3RKG A;  3U03 A;  1KL5 A;  1D2U A;  5D4A A;  3FLL A;  4D6A A;  1EPA A;  4OMX A;  1KZW A;  2WEW A;  3APX A;  2GTF X;  2E4J A;  3B2I A;  3C77 X;  4ES7 A;  1ZNK A;  2N93 A;  1JMZ A;  4HPC A;  4BX7 A;  5HZ9 A;  1DF3 A;  4IB7 A;  2ACO A;  2G78 A;  4LZV A;  4I3D A;  3TGB A;  4GNW A;  1SWT A;  3KFH A;  2OL6 O;  3T6L A;  2OVS A;  2FR3 A;  4QZT A;  3DTQ A;  1FDQ A;  4L3R A;  4QYP A;  3LV4 A;  1D3S A;  1SWL A;  2OVD A;  1HMR A;  1SWH A;  2JW1 A;  1PEE A;  3ZUI A;  1QG5 A;  1SWQ A;  3RE6 A;  3FA7 A;  1U0X A;  2KD2 A;  2P8G A;  4PSQ A;  2F01 A;  2RTE B;  5FQ7 E;  1GXA A;  1GX9 A;  1RXJ A;  2M4L A;  5F2B A;  3S60 A;  4A1Y A;  5D8J A;  1SWN A;  4AZN A;  1N4J A;  3RSW A;  2FHL A;  4TLJ A;  4MVI A;  2AMM X;  4L1N A;  4XMG A;  5H9K A;  2L5P A;  2FTB A;  5H8T A;  3N91 A;  2WPU A;  1WBI A;  5F1E A;  1KT5 A;  5BVT A;  1QWD A;  2IZA A;  2OL8 O;  4I9R A;  3IFB A;  2X34 A;  2IZF B;  4DQ4 A;  5BVQ A;  1AEL A;  1T68 X;  2A5C A;  1UYO X;  2L68 A;  3KZA A;  3NQ9 A;  4GGZ A;  5HZ5 A;  2FS7 A;  1VWJ B;  4ZHF A;  4IRW A;  4NYQ A;  4ZHG A;  1EXS A;  4KC8 A;  2FHN X;  1GX8 A;  3NBX X;  4U46 A;  4YKM A;  1GKA B;  1AVE A;  5L8O A;  3BU1 A;  1RBP A;  1RLB E;  2KTD A;  5LJH A;  3RY1 A;  1BEB A;  3U0D A;  3PQU A;  3WJF A;  1N43 A;  2X45 A;  5HA0 A;  1QY1 A;  1OEE A;  1YIV A;  1IFB A;  1S2P A;  2PI3 O;  4MIR A;  5LJG A;  1BRP A;  3L4R A;  5IO6 A;  4KCA A;  4DNE A;  2RD7 C;  3CQN A;  3PPT A;  2FLJ A;  1VWI B;  4QGX A;  4U3Q A;  5DPQ A;  3SLO A;  2W2A A;  3RWX A;  1CBQ A;  1VWL B;  1RAV A;  5H9L A;  1VWN B;  5BYP A;  4HWM A;  1LIF A;  2OF9 A;  4MEE A;  1AQB A;  4CDD A;  3RDM A;  3FA6 A;  1HXL A;  3WJD A;  3APU A;  4GET A;  3NQK A;  5D48 A;  1JBH A;  1EII A;  1MM9 A;  2A2G A;  3HK1 A;  1SLD B;  2YG2 A;  3NQ3 A;  4I95 A;  1EQD A;  3T1D A;  2FT9 A;  1TOU A;  4I3B A;  1K3B A;  2GH7 A;  3PQS A;  4GRJ A;  5F7G A;  3B2K A;  2X4M A;  4TKJ A;  2RTJ A;  5B3M O;  1CBS A;  4A8Z A;  1AVG I;  4ORX A;  1S44 A;  4Y0Q A;  4QGV A;  3P6E A;  3T2W A;  3MG5 A;  1PTS A;  4C5P A;  3HWF A;  1FEM A;  2I5V O;  1I4U A;  1VWQ B;  3EM0 A;  2K23 A;  3LTW A;  5D45 A;  4YCH A;  3EW1 A;  1FE3 A;  2W2F A;  1KFF A;  4I9S A;  5IO5 A;  3WZN A;  1MK5 A;  1X8P A;  2L9C A;  5F6Z A;  4YCE A;  5EPQ A;  2OY5 O;  1CJ5 A;  4R0B A;  2RQ0 A;  2W2B A;  3EBW A;  2RTQ B;  4QZU A;  4CK4 A;  5CE4 A;  4JHQ A;  1SY2 A;  1H91 A;  4A60 A;  5CSE A;  1ZRY A;  1G7N A;  3HOL A;  1G85 A;  1EUO A;  3PEC A;  3VG4 A;  2OZQ A;  3FYF A;  3STM X;  3ZW0 B;  2G79 A;  4ALB A;  2QO5 A;  3EW2 A;  4U9C A;  1BRQ A;  1SWR A;  1KGL A;  4BX6 B;  3O22 A;  1LID A;  3IA8 A;  3Q34 A;  4NW4 A;  1YWC A;  1MDC A;  1ALB A;  1LF7 A;  4NLI A;  5FFH A;  3SZI A;  4AZQ A;  4CSB A;  4ML7 B;  2NP1 A;  3PK2 A;  1SA8 A;  3KVN A;  5L8N A;  4OS0 A;  4CV7 A;  4OEL A;  1A57 A;  1QAB E;  1SWJ A;  2DJF A;  5LKF A;  1DZP A;  3HTY A;  3ZW1 B;  2F09 A;  2GTL M;  4O3X B;  2QO4 A;  5B11 O;  1MX8 A;  3P6D A;  2CZU A;  3BS2 A;  3FEN A;  3P6H A;  1BSQ A;  1SWU A;  4WFV A;  5AJB A;  1ZNE A;  1HBQ A;  2A5B A;  3STK A;  3OJY C;  3ZWE A;  4NV7 A;  2HKD A;  3EYC A;  2OY7 A;  4YH0 A;  1SWC A;  4N7D A;  4ZH9 A;  3HWD A;  2LBA A;  2RTF B;  2Y32 A;  1SWA A;  1CRB A;  1DC9 A;  1VWH B;  1SXX A;  3HWE A;  1RXH A;  1MEP A;  1DF8 A;  2RTR B;  2ACP X;  3KFF A;  1SXW A;  3AKN A;  3VU1 A;  3EMM A;  1VWR B;  2X55 A;  4OS8 A;  1A3Y A;  3FIQ A;  3SAO A;  1LIE A;  4IMN A;  3NAD A;  2ANS A;  1ACD A;  4LZU A;  1OEK A;  5KIC A;  4O4O A;  4NNS A;  1Y53 X;  4KH8 A;  1SWE A;  1SWB A;  1YWA A;  3QQ2 A;  4O4S A;  3TZS A;  2Q2M A;  4DQ3 A;  1YWB A;  2MHD A;  2KW1 A;  4HPA A;  2G8C O;  2RTI B;  3FA9 A;  2O62 A;  2WSJ A;  1QFT A;  4NNT A;  4U8U N;  3SOT A;  4AZP A;  1AB0 A;  3BY0 A;  1SLE B;  1YP6 A;  4UU2 A;  3EC5 A;  3WZQ A;  2VFB A;  2MJI A;  1KT7 A;  2OFR X;  1E00 A;  5B5G A;  1TXL A;  5LKE A;  2ZAG A;  2LKK A;  4ORU A;  4QNI A;  1JYJ A;  5LJD A;  3CWK A;  3FEK A;  1G5W A;  2CM9 A;  5AJC A;  5IRW A;  1JIW I;  4YFQ A;  2GTL O;  5JD2 A;  2RTN B;  1FTP A;  3FEL A;  3E3C A;  4HPD A;  1Y0G A;  1ICN A;  4KT5 A;  2HZR A;  1Y55 X;  2BC3 A;  3SZJ A;  1FEN A;  3EBK A;  3BDR A;  1OBQ A;  3S26 A;  3T6F A;  2JU3 A;  1I06 A;  1QY2 A;  1T0V A;  2CBR A;  2OL7 A;  1NGL A;  2RCT A;  4MVE A;  4CPH A;  1CBR A;  2JU7 A;  2C1S A;  2RN4 A;  2RTH B;  4ZHC A;  1OPB A;  1SRH A;  5F58 A;  1SWD A;  3D97 A;  5HCC C;  3FID A;  4BJ8 A;  1VWM B;  1KT3 A;  5H9A A;  3MM0 A;  1IKE A;  1NQM A;  1URE A;  3UEV A;  3WBG A;  3NPO A;  1JJJ A;  2QCB A;  1N0S A;  2AT8 X;  2MM3 A;  4OEM A;  3RDU A;  3ZW1 A;  3CMP A;  2HMB A;  3CBS A;  3JS1 A;  5BVS A;  4AZM A;  5FEN A;  2C1Q A;  3CBC A;  1JMX A;  2AL0 X;  2I5Z O;  1PM1 X;  1SLF B;  1AVD A;  1DZJ A;  2QO6 A;  4Y5D A;  3D95 A;  3LHN A;  4KC7 A;  2OF8 A;  1JJX A;  1VWK B;  3BLG A;  2Q9S A;  3B2J A;  4LKP A;  1DZK A;  2GJ5 A;  2HLV A;  2IZC B;  2RTC B;  5H9N A;  3RBY A;  2OY8 A;  2Q2P A;  1U17 A;  2ALL X;  2F73 A;  2HYS A;  3P6F A;  3Q6L A;  2RA6 A;  1VYG A;  2BSZ A;  4ZGF A;  4XMD A;  1YWD A;  3JQO A;  2AH7 X;  1ZNG A;  4YVB A;  1WUB A;  4O9S A;  4Y0S A;  2RTM A;  2LBV A;  4FBV A;  3JSQ A;  1JV4 A;  3FR2 A;  1EI5 A;  1GT3 A;  4JNJ A;  4QAE A;  3ZQ3 A;  4CDC A;  4EXZ A;  1NQN A;  4HFO A;  2WQ9 A;  3O19 A;  4CPE A;  5K68 A;  5HZ6 A;  3TGA A;  3VE2 A;  1KZX A;  1XCA A;  1HXZ A;  2GTL N;  1SLG B;  2GC9 A;  3HWG A;  4I3C A;  3VG6 A;  1DFV A;  1SRE A;  4RUN A;  1SRJ A;  2HNX A;  3X00 A;  4ZHH A;  2AF5 A;  1STS B;  2EU7 X;  5IO7 A;  1LCV A;  1TOW A;  2A2U A;  3FW5 A;  4XMF A;  4Y59 A;  1RST B;  2JGS A;  1VWO B;  2RTK A;  1KOI A;  3D4R A;  2ZAI A;  1GX3 A;  2FWV A;  3B2L A;  1SWF A;  4IAX A;  5AQ6 A;  4GDA A;  4CPI A;  3PDF A;  5LJB A;  1Y52 X;  3O2Y A;  4QYN A;  4BX5 B;  1SWO A;  1E2T A;  2R74 A;  3SZH A;  1E06 A;  5EDB A;  4TQ2 A;  1NP1 A;  1LDQ A;  1SWP A;  1MX7 A;  4Z2V A;  2RTP B;  1W6F A;  4TKH A;  4WFU A;  1E5P A;  4TKB A;  1ZND A;  2JU8 A;  3DSZ A;  4IAB A;  1G74 A;  4BX7 B;  1KL3 A;  1KXO A;  2MWH A;  1L6M A;  1LNM A;  1SWK A;  4GGT A;  1I05 A;  2AT5 X;  1B0O A;  4M7M A;  5CHK A;  5FQ6 E;  3WJG A;  2L67 A;  1ICM A;  2OY1 O;  1A2D A;  3APW A;  4NLJ A;  2Y3E A;  5K06 A;  2X56 A;  3P24 A;  1JQP A;  1VWA B;  4ORW A;  4TJZ A;  1SY0 A;  1B4M A;  3FMZ A;  4YBU A;  3RDX A;  2OFA A;  2OYB O;  1LIB A;  3HPE A;  4IMO A;  4ZR2 A;  1GKA A;  1VWE B;  2IZB A;  3KFG A;  3VGW A;  4ARH A;  1RSU B;  1IFC A;  3G7X A;  1VWD B;  3GAQ A;  1BBP A;  1DV9 A;  1RXK A;  2X8F A;  1OBP A;  2IZL B;  1NC9 A;  4BQU A;  1JYD A;  1QFV A;  4IB8 A;  2POA A;  3F6Z B;  3P6G A;  5LJE A;  2IZK A;  2UZ2 A;  4GJS A;  3RE5 A;  5AEO A;  2IZJ A;  2HZQ A;  1U18 A;  3UEU A;  5JR8 A;  5EEE A;  3VHH A;  3B2H A;  4Y0R A;  1HY2 A;  3MVF A;  4GJV A;  2OFB A;  4GUZ A;  1HBP A;  4TNN A;  2RTB B;  2NNQ A;  2DM5 A;  2ZSC A;  3V8U A;  4YFR A;  1N7Y A;  1Z24 A;  1N9M A;  2X32 A;  4Z2P A;  5HZQ A;  4WHI A;  2CZT A;  3WJE A;  2WQA E;  4NV8 A;  5D47 A;  4YKO A;  4Z28 A;  3WZO A;  5IRA A;  1BLR A;  2IFB A;  3ZI8 A;  4QGW A;  4ORS A;  4AZR A;  4BGF A;  4NP1 A;  4FBR A;  1VPR A;  1VYO A;  5FAZ A;  1T8V A;  1X71 A;  1HN2 A;  1YP7 A;  3BX7 A;  3RY2 A;  3OE3 A;  2ASN X;  5EZ2 A;  3ZUO A;  1LCZ A;  4Z27 A;  2CAM A;  1TW4 A;  3WYP A;  1BM5 A;  1R0U A;  1O1V A;  2BS5 A;  2C4I A;  3MX7 A;  3KQ0 A;  5IRU A;  2Z4I A;  3I17 A;  3PP6 A;  1STR B;  1B56 A;  2KT4 B;  3FA8 A;  4MIS A;  3VE1 A;  5B29 A;  2Z4H A;  4EDE A;  1VWP B;  1O1U A;  2A8G A;  1BWY A;  2PY1 A;  2AKQ A;  1X89 A;  3FDC A;  2VFC A;  3FEP A;  3ZW0 A;  2FKG A;  4B55 A;  1NDJ A;  1X8U A;  1S7D A;  1VWC B;  1BJ7 A;  2NNE A;  3BX8 A;  4EEJ A;  1E02 A;  1IJ8 A;  2QMI A;  5HCE C;  4BX6 A;  4QRL A;  2IZD B;  4ZH6 A;  5L3Y A;  1SY1 A;  3UAQ A;  1IIU A;  4ZFX A;  2RTA A;  1IKJ A;  2RTL A;  3ZZV A;  5HTD A;  4GE1 A;  4OKA A;  4CDF A;  1X8N A;  1LIC A;  1ZNH A;  2AT6 X;  3FR4 A;  5B27 A;  1LUQ A;  2R73 A;  1I04 A;  5L8I A;  3S5V A;  4EKV A;  1PBO A;  1STP A;  3S5X A;  4O4X A;  2JMB A;  1LKE A;  4Z6J A;  3AKM A;  3WVM A;  3APV A;  2LFO A;  3UEX A;  4FBO A;  2MF6 A;  1QQS A;  2LB6 A;  4OS3 A;  4YDB A;  3VG2 A;  2FGS A;  3WOV A;  4YGG A;  5EED A;  1SY3 A;  5B5F A;  4ODD A;  1TVQ A;  4GU8 A;  5C0N A;  1HMT A;  2A3F X;  3FR5 A;  1MVG A;  2A0A A;  2QOS C;  3NX2 A;  3NP1 A;  2Q39 A;  2OVE A;  1VYF A;  3RDQ A;  3CQR A;  1KT4 A;  1NP4 A;  3ELZ A;  4CPF A;  1JZU A;  1SMP I;  4ALO A;  1K24 A;  1KT6 A;  1CBI A;  1LEL A;  1EW3 A;  4INN A;  2A13 A;  4MVK A;  3RDS A;  4YBP A;  1X8O A;  1BSY A;  4YMY A;  2QOM A;  3TGC A;  3UEW A;  2QM9 A;  4FQB B;  4WBK A;  2WR6 A;  4XMC A;  1ZNL A;  1EPB A; 
#chains in the Genus database with same CATH homology
 1ML7 A;  1PMP A;  5LJK A;  2R56 A;  4O3Z A;  1GT4 A;  3HOE A;  2FRS A;  3CR6 A;  4FGI B;  4ORY A;  1IW2 A;  4YFP A;  2NND A;  2MO5 A;  2FS6 A;  1HMS A;  3ELX A;  4GZV A;  4COT A;  1OBU A;  2OVA A;  1XKI A;  4HPB A;  2BS6 A;  3C78 X;  1ERB A;  4IAW A;  1O8V A;  2BHV A;  4NYR A;  4U8U M;  5HWZ A;  1SXY A;  1KQW A;  2LA7 A;  2XST A;  3OD9 A;  3C76 X;  3NX1 A;  2X46 A;  3PH5 A;  4Y0P A;  2X8T A;  1UZ2 X;  2CBS A;  1B8E A;  1X8Q A;  4IB9 A;  3PED A;  4PJ2 A;  4N7C A;  1Y9L A;  1ERX A;  5HCD C;  4LQZ A;  4ID2 A;  4EQA C;  1GGL A;  4RUU A;  4K19 A;  1HQP A;  1Y9T A;  5EDC A;  3VPJ E;  3KFI A;  1LFO A;  5FQ8 E;  1GT1 A;  5HBS A;  1EAL A;  4YGH A;  3QKG A;  2CM4 A;  3VG5 A;  1SXU A;  5HTE A;  4EFG A;  5LJC A;  3PH6 A;  4BOE A;  1A18 A;  3P02 A;  4GK9 A;  3BSZ E;  3GE2 A;  2WWP A;  2X8S A;  1YUP A;  2KTS A;  5HAE A;  3H3I A;  2JN3 A;  4KII A;  4MVL A;  3ZW2 A;  2BT9 A;  4D6B A;  5KID A;  4I6S A;  1BSO A;  3RZY A;  2K62 A;  1EIO A;  4GKC A;  5KHP A;  3FW4 A;  3MBT A;  2WEX A;  1FEL A;  1MUP A;  4GNY A;  4O49 A;  4AZO A;  4ZHD A;  4U8U O;  3VG3 A;  4ZJ0 A;  3D96 A;  4UU3 A;  3BU9 A;  3U9P C;  3K3L A;  2BLG A;  2XKL A;  4GH7 A;  3WJC A;  3WJB A;  1GM6 A;  1DZM A;  4ZCB A;  4ORR A;  1KQX A;  4A1H A;  2YMS A;  5F6B A;  4O3Y A;  5CYB A;  4YGZ A;  1OPA A;  2JOZ A;  4ON1 A;  3BRN A;  2RCQ A;  3NR3 A;  4IBA A;  4ZGU A;  2WUT A;  5DG4 A;  4YDA A;  4IB6 A;  4QQ1 A;  4XMH A;  2G7B A;  4BVM A;  1P6P A;  3I0A A;  4LKT A;  1OEJ A;  4XME A;  3TF6 A;  1QY0 A;  2AT3 X;  4OMW A;  1ADL A;  4JGL A;  1GT5 A;  3STN A;  3P6C A;  4M6S A;  3WXQ A;  3F8A A;  3OBL A;  5HZ8 A;  3F9D A;  5HA1 A;  2OFM X;  2AT0 X;  3VG7 A;  4AYH A;  2FR2 A;  4O4U A;  1LPJ A;  2Q4N A;  4O3W A;  4GDZ A;  3U03 A;  1D2U A;  5D4A A;  3FLL A;  4D6A A;  1EPA A;  4OMX A;  1KZW A;  2WEW A;  3APX A;  2GTF X;  2E4J A;  3B2I A;  3C77 X;  4ES7 A;  1ZNK A;  2N93 A;  4HPC A;  5HZ9 A;  1DF3 A;  4IB7 A;  2ACO A;  2G78 A;  4LZV A;  4I3D A;  3TGB A;  4GNW A;  3KFH A;  2OVS A;  2FR3 A;  4QZT A;  3DTQ A;  1FDQ A;  4L3R A;  4QYP A;  3LV4 A;  1D3S A;  2OVD A;  1HMR A;  1PEE A;  2JW1 A;  3ZUI A;  1QG5 A;  3FA7 A;  1U0X A;  2KD2 A;  2P8G A;  4PSQ A;  5FQ7 E;  1GXA A;  1GX9 A;  2M4L A;  3S60 A;  4A1Y A;  4AZN A;  5D8J A;  3RSW A;  4TLJ A;  4MVI A;  2AMM X;  4L1N A;  4XMG A;  5H9K A;  2L5P A;  2FTB A;  5H8T A;  3N91 A;  5F1E A;  5BVT A;  1KT5 A;  1QWD A;  4I9R A;  3IFB A;  1AEL A;  4DQ4 A;  5BVQ A;  1T68 X;  3KZA A;  2L68 A;  3NQ9 A;  5HZ5 A;  2FS7 A;  4ZHF A;  4NYQ A;  4ZHG A;  1EXS A;  4KC8 A;  1GX8 A;  3NBX X;  4YKM A;  1GKA B;  5L8O A;  3BU1 A;  1RBP A;  1RLB E;  2KTD A;  5LJH A;  3U0D A;  1BEB A;  3PQU A;  3WJF A;  2X45 A;  5HA0 A;  1QY1 A;  1OEE A;  1YIV A;  1IFB A;  1S2P A;  4MIR A;  5LJG A;  1BRP A;  3L4R A;  5IO6 A;  4KCA A;  2RD7 C;  3CQN A;  3PPT A;  2FLJ A;  4QGX A;  4U3Q A;  5DPQ A;  2W2A A;  3RWX A;  1CBQ A;  5H9L A;  5BYP A;  4HWM A;  1LIF A;  1AQB A;  3FA6 A;  3WJD A;  3APU A;  4GET A;  3NQK A;  5D48 A;  1JBH A;  1EII A;  3HK1 A;  2A2G A;  4I95 A;  2YG2 A;  3NQ3 A;  3T1D A;  1EQD A;  2FT9 A;  1TOU A;  4I3B A;  3PQS A;  4GRJ A;  5F7G A;  3B2K A;  4TKJ A;  1CBS A;  4A8Z A;  1AVG I;  4ORX A;  1S44 A;  4Y0Q A;  4QGV A;  3P6E A;  3HWF A;  1FEM A;  5D45 A;  1I4U A;  3EM0 A;  2K23 A;  4YCH A;  4I9S A;  1FE3 A;  2W2F A;  5IO5 A;  1X8P A;  2L9C A;  5F6Z A;  4YCE A;  5EPQ A;  1CJ5 A;  4R0B A;  2RQ0 A;  2W2B A;  3EBW A;  4QZU A;  4CK4 A;  5CE4 A;  1SY2 A;  1H91 A;  4A60 A;  1ZRY A;  1G7N A;  3HOL A;  1G85 A;  1EUO A;  3PEC A;  3VG4 A;  2OZQ A;  3FYF A;  3STM X;  3ZW0 B;  2G79 A;  4ALB A;  2QO5 A;  4U9C A;  1BRQ A;  1KGL A;  3O22 A;  1LID A;  3IA8 A;  4NW4 A;  5FFH A;  1YWC A;  1MDC A;  1ALB A;  1LF7 A;  4NLI A;  4AZQ A;  4CSB A;  4ML7 B;  2NP1 A;  1SA8 A;  5L8N A;  4OS0 A;  4CV7 A;  1A57 A;  1QAB E;  5LKF A;  1DZP A;  3HTY A;  3ZW1 B;  2F09 A;  2GTL M;  4O3X B;  2QO4 A;  1MX8 A;  3P6D A;  2CZU A;  3BS2 A;  3FEN A;  3P6H A;  1BSQ A;  4WFV A;  5AJB A;  1ZNE A;  1HBQ A;  3STK A;  3OJY C;  3ZWE A;  3EYC A;  4YH0 A;  4ZH9 A;  4N7D A;  3HWD A;  2LBA A;  1CRB A;  1DC9 A;  1SXX A;  3HWE A;  3KFF A;  4AW8 A;  2ACP X;  1SXW A;  3AKN A;  3VU1 A;  3EMM A;  4OS8 A;  1A3Y A;  3FIQ A;  3SAO A;  1LIE A;  3NAD A;  2ANS A;  1ACD A;  4LZU A;  1OEK A;  5KIC A;  4O4O A;  4NNS A;  4KH8 A;  3TZS A;  1YWA A;  4O4S A;  2Q2M A;  4DQ3 A;  1YWB A;  2MHD A;  2KW1 A;  4HPA A;  3FA9 A;  4NNT A;  3SOT A;  2O62 A;  2WSJ A;  1QFT A;  4U8U N;  4AZP A;  1AB0 A;  3BY0 A;  1YP6 A;  4UU2 A;  2MJI A;  1KT7 A;  2OFR X;  1E00 A;  1TXL A;  5LKE A;  2ZAG A;  2LKK A;  4ORU A;  4QNI A;  1JYJ A;  5LJD A;  3CWK A;  3FEK A;  1G5W A;  2CM9 A;  5AJC A;  1JIW I;  4YFQ A;  2GTL O;  1FTP A;  3FEL A;  3E3C A;  4HPD A;  1ICN A;  4KT5 A;  2HZR A;  1FEN A;  3EBK A;  3BDR A;  1OBQ A;  3S26 A;  2JU3 A;  1I06 A;  1QY2 A;  1T0V A;  2CBR A;  1NGL A;  2RCT A;  4MVE A;  1CBR A;  2JU7 A;  2RN4 A;  4ZHC A;  1OPB A;  5F58 A;  3D97 A;  5HCC C;  5H9A A;  1KT3 A;  1IKE A;  3UEV A;  1URE A;  1JJJ A;  3NPO A;  1N0S A;  2AT8 X;  2MM3 A;  3ZW1 A;  3CMP A;  2HMB A;  3CBS A;  3JS1 A;  5BVS A;  4AZM A;  5FEN A;  3CBC A;  2AL0 X;  1PM1 X;  1DZJ A;  2QO6 A;  1JJX A;  3D95 A;  3LHN A;  4KC7 A;  3BLG A;  2Q9S A;  3B2J A;  4LKP A;  1DZK A;  2GJ5 A;  2HLV A;  5H9N A;  3RBY A;  2Q2P A;  1U17 A;  2ALL X;  2F73 A;  2HYS A;  3P6F A;  3Q6L A;  2RA6 A;  1VYG A;  4ZGF A;  4XMD A;  1YWD A;  3JQO A;  2AH7 X;  1ZNG A;  4O9S A;  4Y0S A;  2LBV A;  4FBV A;  3JSQ A;  1JV4 A;  3FR2 A;  1EI5 A;  1GT3 A;  4QAE A;  3ZQ3 A;  4EXZ A;  4HFO A;  2WQ9 A;  3O19 A;  5HZ6 A;  3TGA A;  3VE2 A;  1KZX A;  1XCA A;  2GTL N;  2GC9 A;  3HWG A;  4I3C A;  3VG6 A;  1DFV A;  4RUN A;  4ZHH A;  2HNX A;  2EU7 X;  5IO7 A;  1TOW A;  2A2U A;  3FW5 A;  4XMF A;  4IMN A;  3D4R A;  4IAX A;  1KOI A;  5AQ6 A;  2ZAI A;  2FWV A;  3B2L A;  5LJB A;  3O2Y A;  4QYN A;  2R74 A;  1E06 A;  5EDB A;  4TQ2 A;  1NP1 A;  1MX7 A;  4TKH A;  4WFU A;  1E5P A;  4TKB A;  1ZND A;  2JU8 A;  3DSZ A;  4IAB A;  1G74 A;  1KXO A;  2MWH A;  1L6M A;  1LNM A;  4M7M A;  5FQ6 E;  1I05 A;  2AT5 X;  1B0O A;  3WBG A;  3WJG A;  2L67 A;  1ICM A;  1A2D A;  3APW A;  4NLJ A;  5K06 A;  3P24 A;  4TJZ A;  4ORW A;  1SY0 A;  1B4M A;  3FMZ A;  4YBU A;  1LIB A;  4IMO A;  4ZR2 A;  1GKA A;  3KFG A;  4ARH A;  1IFC A;  3G7X A;  3GAQ A;  1DV9 A;  1BBP A;  2X8F A;  1OBP A;  4BQU A;  1JYD A;  1QFV A;  4IB8 A;  2POA A;  3F6Z B;  3P6G A;  5LJE A;  5AEO A;  2HZQ A;  1U18 A;  3UEU A;  5JR8 A;  5EEE A;  3B2H A;  4Y0R A;  3MVF A;  1HBP A;  4TNN A;  2NNQ A;  2DM5 A;  3V8U A;  4YFR A;  1Z24 A;  5HZQ A;  4WHI A;  2CZT A;  3WJE A;  2WQA E;  5D47 A;  4YKO A;  1BLR A;  2IFB A;  3ZI8 A;  4QGW A;  4ORS A;  4AZR A;  4NP1 A;  4FBR A;  1VPR A;  5FAZ A;  1T8V A;  1X71 A;  1HN2 A;  1YP7 A;  3BX7 A;  3OE3 A;  2ASN X;  5EZ2 A;  3ZUO A;  1TW4 A;  1BM5 A;  1R0U A;  1O1V A;  2BS5 A;  3MX7 A;  3KQ0 A;  2Z4I A;  3I17 A;  3PP6 A;  3VE1 A;  1B56 A;  2KT4 B;  3FA8 A;  4MIS A;  5B29 A;  2Z4H A;  4EDE A;  1O1U A;  1BWY A;  2PY1 A;  2AKQ A;  1X89 A;  3FEP A;  3ZW0 A;  1X8U A;  2NNE A;  1S7D A;  4EEJ A;  1BJ7 A;  3BX8 A;  1E02 A;  2QMI A;  5HCE C;  4QRL A;  4ZH6 A;  1SY1 A;  3UAQ A;  1IIU A;  4ZFX A;  1IKJ A;  3ZZV A;  5HTD A;  4GE1 A;  1LIC A;  2AT6 X;  1X8N A;  1ZNH A;  3FR4 A;  5B27 A;  2R73 A;  1I04 A;  5L8I A;  3S5V A;  1PBO A;  3S5X A;  4O4X A;  2JMB A;  1LKE A;  3AKM A;  3WVM A;  3APV A;  2LFO A;  3UEX A;  4FBO A;  3VG2 A;  1QQS A;  2LB6 A;  4OS3 A;  4YDB A;  3WOV A;  4YGG A;  5EED A;  1SY3 A;  4ODD A;  1TVQ A;  4GU8 A;  5C0N A;  1HMT A;  2A3F X;  3FR5 A;  1MVG A;  2A0A A;  2QOS C;  3NX2 A;  3NP1 A;  2Q39 A;  2OVE A;  1VYF A;  3RKG A;  3CQR A;  1KT4 A;  1NP4 A;  3ELZ A;  1JZU A;  1SMP I;  4ALO A;  1KT6 A;  4INN A;  1CBI A;  4MVK A;  1EW3 A;  4YBP A;  2A13 A;  4YMY A;  3TGC A;  1X8O A;  1BSY A;  3UEW A;  2QM9 A;  4FQB B;  4WBK A;  2WR6 A;  4XMC A;  1ZNL A;  1EPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...