1JBHA

Solution structure of cellular retinol binding protein type-i in the ligand-free state
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
135
structure length
135
Chain Sequence
MPVDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRAEGVTCKQVFKKVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords CELLULAR RETINOL-BINDING PROTEIN TYPE I
publication title Structure and backbone dynamics of Apo- and holo-cellular retinol-binding protein in solution.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 33
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2001-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1jbhA00
2K23A 4ZGUA 3STNA 3PH5A 4GKCA 3P6EA 5IO5A 4LKPA 2QO6A 2ACPX 1QABE 5HZ8A 5F6ZA 3TGBA 3WBGA 2FWVA 3DTQA 3K3LA 2HZRA 1N0SA 1A18A 3FLLA 3HWEA 3PEDA 4TQ2A 3FR5A 2CZUA 2AT5X 3B2HA 1GM6A 1IKEA 1ADLA 3FW4A 4D6AA 2A3FX 4ORYA 5HZ6A 3MVFA 5LJHA 5LJBA 3I0AA 1QY2A 4NYQA 5HZ9A 1U0XA 1KXOA 4GETA 2NNQA 4ZCBA 1OEKA 2PY1A 5H8TA 5HCEC 4OMWA 4IMNA 1EQDA 1IFCA 2RA6A 1UREA 2RD7C 2FS6A 4ZHCA 3CQNA 2OFRX 2A2GA 1GT1A 5EEEA 1LNMA 1ICMA 1TW4A 3NX1A 1JZUA 3P6DA 1MDCA 2WEWA 3FA6A 4UU3A 4TLJA 2W2BA 1EIOA 5HA1A 4IBAA 2L68A 5HTEA 2L5PA 4ARHA 3O2YA 3T1DA 3NR3A 5LJCA 4IAWA 1YP6A 4YGHA 2KTDA 4K19A 4ZHFA 3EM0A 1S7DA 1ZNKA 4AZOA 3AKMA 1GKAB 4YCHA 3BLGA 2F73A 4EEJA 5DPQA 3B2LA 5D47A 3VG6A 2EU7X 2X45A 4AZPA 1I4UA 3APUA 2MM3A 2CBSA 1FTPA 4IB7A 5FENA 5HA0A 1TXLA 1CBQA 2WQAE 3WJDA 2WR6A 3BU1A 4QGWA 4XMHA 4YH0A 3VG3A 2A2UA 2QOSC 3EBWA 2LFOA 3FW5A 1VPRA 4NP1A 4OS8A 3PP6A 1S44A 2ANSA 2G79A 4TKJA 3CBSA 1ICNA 3PPTA 1DZPA 1B4MA 2R74A 2L9CA 1T8VA 3P6GA 3QKGA 4GRJA 3WJFA 1CRBA 1E00A 1GT5A 4XMDA 2RQ0A 1EPAA 4I3DA 5IO6A 3CR6A 1I04A 1LIEA 2E4JA 3VG2A 5L8NA 3FMZA 1CBSA 3BS2A 1E5PA 1ACDA 3S26A 2FLJA 1X8PA 5HWZA 3KFGA 4EXZA 1QY1A 3NX2A 3Q6LA 2WEXA 1HMTA 3WJGA 1G7NA 2N93A 1GX9A 2NP1A 3FA9A 2Q4NA 2WUTA 4IMOA 5K06A 1DZJA 4N7CA 1LF7A 1QQSA 3HK1A 1YWDA 2Q2PA 4KIIA 2MO5A 2Q9SA 3TGAA 4ODDA 5D48A 2RCTA 3EMMA 4BOEA 2ALLX 1X89A 3AKNA 4YDAA 3ZQ3A 1EXSA 5EDCA 1KQXA 1NP1A 5AQ6A 1H91A 3C77X 2R56A 3ZUOA 3D95A 2CM9A 3HWDA 3KZAA 3MBTA 1O1VA 4YFQA 1VYGA 1BSQA 1T0VA 3BY0A 3C78X 5EDBA 2ASNX 1O1UA 3TF6A 3FR2A 4NNTA 1MVGA 3RSWA 5CE4A 2CZTA 5B29A 5F1EA 5H9LA 4YBUA 4IB9A 3I17A 5LJEA 1A57A 2MJIA 1I06A 2WQ9A 4I3CA 3WJEA 4ES7A 2AT3X 1U17A 2LKKA 1HMSA 3KFHA 4YKMA 2XKLA 3ZUIA 5FAZA 4ORXA 3FR4A 3O19A 3JSQA 3DSZA 3IFBA 1CJ5A 3F8AA 1A3YA 1AVGI 5H9KA 3U9PC 1KT6A 4AW8A 4AZQA 1YP7A 3KQ0A 4ZFXA 3WJBA 1FENA 1XCAA 2HNXA 4HPDA 4A60A 4YFRA 1YWAA 5HZ5A 5F6BA 3EYCA 4BQUA 1E06A 4GNYA 4O9SA 3UEVA 4Y0SA 1MX7A 2AMMX 3KFFA 1PBOA 1BSYA 1HBPA 2Q2MA 4BVMA 2LB6A 1JBHA 3NPOA 4M6SA 2QO4A 2GC9A 1GKAA 1JV4A 2AKQA 1BM5A 3STKA 1GT4A 3HWFA 4QGXA 2A13A 5L8OA 4TKBA 1ZNEA 4NLJA 5BVTA 3FA8A 1VYFA 4EDEA 1X71A 1AELA 1YIVA 4EFGA 5BVSA 4YFPA 1LIDA 4UU2A 3CBCA 4HFOA 2CBRA 3WJCA 1P6PA 1XKIA 1DFVA 1SY1A 5EPQA 5LJDA 2G78A 2LBAA 4WFVA 4OS3A 3BSZE 2K62A 4OS0A 4IAXA 4NNSA 1SXUA 3NQ3A 5H9NA 3FENA 1X8OA 2OVEA 2OVDA 1AQBA 1ERBA 1HMRA 3NADA 1BRQA 3P6HA 3UEXA 4NLIA 2XSTA 1B8EA 2ACOA 4Y0PA 2BLGA 1HBQA 4GE1A 5C0NA 2DM5A 2AT0X 1KT5A 1A2DA 1OBUA 1QG5A 5KHPA 1OPBA 4I9RA 1IW2A 1GGLA 4RUNA 1MUPA 1GX8A 1DC9A 1EALA 4ORWA 2X46A 2WWPA 4TNNA 2NNDA 3BX8A 4R0BA 1BJ7A 4QAEA 3P6CA 5L8IA 4AYHA 4IB6A 2P8GA 2HMBA 1MX8A 1SXWA 1X8UA 4GNWA 1KGLA 2L67A 1QFTA 4N7DA 3PH6A 4YDBA 3D97A 4IB8A 3FIQA 1KT3A 4CK4A 2OFMX 1EW3A 4GH7A 1KZWA 1G5WA 2G7BA 2OVAA 4ZHHA 4Y0QA 3U0DA 4Y0RA 4AZNA 3GAQA 2HZQA 4YGGA 2YG2A 5H9AA 4ALOA 4MVLA 4M7MA 2R73A 1IKJA 2AT6X 1G85A 3BX7A 3HWGA 4A1YA 3OJYC 3PECA 1PM1X 3B2IA 1FELA 5LJKA 4HPAA 1X8QA 1TVQA 1KOIA 4ALBA 1LIBA 4LZVA 1I05A 1SY0A 3FEKA 4XMGA 3BRNA 2FR3A 1JJJA 3APWA 4LKTA 1ZRYA 1QFVA 1HN2A 1L6MA 4WFUA 4LZUA 4NYRA 5D8JA 1ZNDA 5F58A 1GT3A 5HCCC 4QZTA 1EIIA 1LKEA 3FA7A 4PSQA 3EBKA 2IFBA 1EUOA 4ZHDA 4HPCA 3IA8A 3STMX 4ZR2A 3TGCA 2POAA 1ZNHA 2HYSA 3TZSA 2QO5A 5EEDA 4DQ3A 1DF3A 2O62A 1X8NA 2FTBA 4TJZA 3RZYA 1ZNLA 1NP4A 5EZ2A 1BRPA 1D2UA 1GXAA 5B27A 3F9DA 3C76X 4YBPA 3ELXA 5D45A 1B56A 2CM4A 2AL0X 1OEJA 2LBVA 4QGVA 3D96A 1KT4A 1SXYA 1SY3A 3NQ9A 4QZUA 1FDQA 4MVKA 4WBKA 1PEEA 5HBSA 2JU7A 1HQPA 5LKFA 1SXXA 4ORUA 4AZRA 1CBRA 2W2FA 3VG4A 5BVQA 1BLRA 1R0UA 4A8ZA 3CMPA 5FFHA 4ORSA 4QYNA 1EPBA 2RCQA 1B0OA 2HLVA 3WXQA 5LKEA 1DZMA 3JS1A 1RBPA 1FEMA 4ZHGA 1BWYA 1QY0A 1ML7A 1SA8A 2JN3A 4D6BA 5JR8A 1OPAA 1S2PA 3NP1A 1NGLA 1DZKA 4XMEA 3CWKA 1AB0A 1Z24A 2FS7A 4ORRA 4RUUA 1T68X 4DQ4A 3U03A 4TKHA 1PMPA 1KQWA 1G74A 1KT7A 2OZQA 2NNEA 3UEWA 1OEEA 3L4RA 1YWCA 1LPJA 3BDRA 2FRSA 1ALBA 1U18A 2JU3A 1IIUA 2QM9A 3ELZA 3VG5A 4HPBA 4YCEA 4AZMA 3CQRA 2A0AA 2Q39A 2W2AA 4I9SA 4YGZA 1E02A 5DG4A 2FT9A 1TOUA 4A1HA 4OMXA 3WVMA 3KFIA 3B2KA 3FEPA 1ZNGA 4I3BA 5HCDC 1IFBA 1CBIA 1BEBA 3VG7A 1KZXA 1OBQA 3FELA 1TOWA 3O22A 4MVIA 1BBPA 1D3SA 2JOZA 4YKOA 5HZQA 5LJGA 1JYDA 3P6FA 2GJ5A 2AH7X 1DV9A 2GTFX 3B2JA 4XMCA 3G7XA 2AT8X 1LFOA 1UZ2X 4ZH6A 2WSJA 5KIDA 5HAEA 1OBPA 1FE3A 1YWBA 4QYPA 4XMFA 2JU8A 1ERXA 5HTDA 1JJXA 3APVA 5IO7A 1QWDA 1LIFA 5KICA 3BU9A 2FR2A 4ZH9A 3UEUA 4YMYA 2KT4B 1LICA 1O8VA 1RLBE 1YUPA 3SAOA 5F7GA 3APXA 4ZJ0A 5D4AA 1JYJA 1SY2A 1BSOA
chains in the Genus database with same CATH superfamily
1SWUA 5FQ8E 2K23A 4ZGUA 4O3WA 3STNA 3PH5A 1SWDA 4GKCA 3JQOA 3P6EA 4GUZA 5IO5A 4LKPA 2QO6A 1SRJA 2ACPX 1QABE 2OL8O 5HZ8A 5F6ZA 3TGBA 1KL4A 3WBGA 2FWVA 3DTQA 2VDFA 3K3LA 2HZRA 1N0SA 2Y32A 1A18A 2OFBA 2RTEB 2ZAIA 2X56A 3FLLA 3HWEA 3PEDA 4TQ2A 1BM5A 3FR5A 2CZUA 2AT5X 3B2HA 4L1NA 1AVDA 2RTGB 2RTPB 1GM6A 1SLDB 4GDAA 1IKEA 1ADLA 2VFBA 3FW4A 4D6AA 1SLGB 2A3FX 4ORYA 3RE6A 3MVFA 3WZPA 5HZ6A 3I0AA 1QY2A 4NYQA 5LJHA 5LJBA 5HZ9A 1U0XA 1KXOA 3RE5A 1PTSA 4GETA 2NNQA 2AF5A 1SRGA 4ZCBA 1OEKA 4ZGFA 2PY1A 5H8TA 5HCEC 4ML7B 2Z4IA 1SWKA 4OMWA 4IMNA 1EQDA 1IFCA 2RA6A 1UREA 2RD7C 2RTHB 1FJ1E 2FS6A 4ZHCA 1OSPO 4B55A 3CQNA 2RTKA 2OFRX 3V8UA 4BCSA 2A2GA 1LCVA 1GT1A 5EEEA 2JMBA 1LNMA 1ICMA 1TW4A 2A5BA 3NX1A 5CYBA 1JZUA 3P6DA 1MDCA 4O3XB 2WEWA 3FA6A 2Y3EA 4JNJA 3WZOA 5B10O 1VWLB 3NQKA 4UU3A 4TLJA 2W2BA 1RXJA 1EIOA 4NV8A 4CDCA 2BC3A 4BX5A 3D4RA 5HA1A 4IBAA 2L68A 5HTEA 4FBOA 4CDEA 4CPIA 2IZBA 2L5PA 1W4TA 4ARHA 3O2YA 3T1DA 3LTWA 3NR3A 1RAVA 4IAWA 2MHDA 1YP6A 4U3QA 5LJCA 4YGHA 2KTDA 4K19A 4ZHFA 3MM0A 3EM0A 2UYWA 1S7DA 1ZNKA 4AZOA 4QRLA 4JHQA 3AKMA 1GKAB 3OE3A 4YCHA 3BLGA 3ZW1B 2OY7A 2F73A 4I95A 4EEJA 2OF8A 3B2LA 1RXKA 3CKFA 5D47A 4O3YA 1STSB 3OD9A 2EU7X 2X45A 3OBLA 4IRWA 4Z28A 3VG6A 4AZPA 1I4UA 3APUA 2MM3A 1K24A 2CBSA 1FTPA 2VFCA 2ZAGA 4IB7A 5HA0A 5FENA 4BX6B 1TXLA 1CBQA 2WQAE 3WJDA 2WR6A 1PBYA 1VWNB 3BU1A 3HPEA 4QGWA 4XMHA 4YH0A 3T2XA 3VG3A 2A2UA 2QOSC 2BHVA 2BS6A 3EBWA 2LFOA 3FW5A 3F6ZB 1VPRA 3T2WA 4NP1A 4OS8A 3PP6A 1S44A 1WBIA 2ANSA 2G79A 4TKJA 3CBSA 3RDQA 4Z27A 1ICNA 1VWJB 3PPTA 1DZPA 1B4MA 2R74A 4GJVA 1W5RA 1SWOA 2L9CA 1T8VA 3FDCA 3P6GA 3QKGA 4GRJA 3VHMA 1CRBA 5B5GA 3WJFA 1Y53X 1E00A 1GT5A 4XMDA 2RQ0A 1EPAA 1KFFA 3FIDA 4I3DA 5IO6A 4ON1A 3CR6A 1I04A 1LIEA 5B3MO 1N43A 1VWCB 2ZSCA 2E4JA 3VG2A 2IZLB 3FMZA 4GGTA 4MISA 2OY5O 1CBSA 3BS2A 1E5PA 4MEEA 1ACDA 3QQ2A 3S26A 2FLJA 1X8PA 5HWZA 3KFGA 3T6FA 4EXZA 1QY1A 3GE2A 2IZJA 2DJFA 3NX2A 4FBRA 3ZW0A 3Q6LA 2WEXA 2FHNX 2OYBO 2OF9A 1HXZA 1HMTA 3WJGA 1G7NA 2N93A 1GX9A 2NP1A 3FA9A 2Q4NA 2WUTA 2RN4A 4IMOA 1JIWI 4EQAC 2IZIA 3MX7A 1DZJA 4N7CA 1LF7A 1QQSA 1STPA 3HK1A 1YWDA 2Q2PA 4KIIA 2MO5A 3PQSA 4U46A 1MOYA 2Q9SA 3TGAA 2IZKA 3EC5A 3WYQA 4ODDA 5D48A 2RCTA 2GH7A 3EMMA 4BOEA 2ALLX 1JMXA 2FKJA 1X89A 3AKNA 4YDAA 3ZQ3A 2RTBB 1EXSA 5EDCA 5IRWA 1KQXA 1NP1A 5AQ6A 1H91A 3HOEA 3RDSA 3C77X 2R56A 3ZUOA 3D95A 2CM9A 3HWDA 2X8TA 4GGRA 3KZAA 3MBTA 1O1VA 4YFQA 3PQUA 1VYGA 1BSQA 1T0VA 5AJCA 3VE1A 3BY0A 2F09A 1MM9A 5DPQA 4O4UA 3C78X 5EDBA 5IRUA 1NDJA 4KCAA 1SLEB 2ASNX 1O1UA 3TF6A 3FR2A 4NNTA 4Y59A 2LA7A 1MVGA 3RSWA 5CE4A 5FQ6E 2CZTA 4CV7A 5B29A 5F1EA 3EW1A 2JGSA 4YBUA 5H9LA 4JGLA 4IB9A 3I17A 5LJEA 1SRIA 1SWFA 2MJIA 3S60A 1A57A 1I06A 2WQ9A 4I3CA 5L3YA 3WJEA 4ES7A 2AT3X 1U17A 3NBXX 1HXLA 2LKKA 3SLTA 4QNIA 1HMSA 3KFHA 1SWHA 2XKLA 4YKMA 5BYPA 1NQNA 3ZUIA 2GTLM 4NW4A 5FAZA 2QMIA 3FR4A 3O19A 4ORXA 1VYOA 3SZHA 3JSQA 2WPUA 5K67A 3DSZA 3IFBA 1CJ5A 1VWEB 3F8AA 1A3YA 1AVEA 2IZAA 1AVGI 5H9KA 4JO6A 3SZJA 3U9PC 4GZVA 1KT6A 4AW8A 1I9HA 1RSTB 4AZQA 4DCBA 1DF8A 1YP7A 3KQ0A 4ZFXA 3WJBA 3H3IA 1FENA 1XCAA 2HNXA 4HPDA 2RTJA 4KT5A 3ZI8A 1YWAA 2OL7A 4O4XA 3SOTA 4YFRA 4GGZA 5HZ5A 5F6BA 2DJGA 2X8FA 3EYCA 4BQUA 1E06A 4CDDA 4GNYA 5CSEA 2OY1O 2RTIB 4O9SA 3UEVA 3RKGA 1SWSA 4Y0SA 1MX7A 2AMMX 5JD2A 3KFFA 1PBOA 1BSYA 1HBPA 3ZW2A 2Q2MA 2RTNB 4BVMA 1LUQA 3E3CA 2LB6A 1JBHA 3NPOA 4M6SA 2QO4A 2GC9A 1GKAA 1JV4A 2AKQA 3ZW1A 3STKA 1GT4A 2BS5A 1NC9A 1SWRA 4O4SA 3HWFA 4QGXA 2A13A 3UAQA 5L8OA 4TKBA 1ZNEA 4ID2A 4NLJA 5BVTA 3FA8A 1VYFA 4EDEA 1X71A 2Z4HA 1RSUB 1AELA 1YIVA 4EFGA 5BVSA 4BX7B 2A5CA 4YFPA 1LIDA 2RTRB 4UU2A 1SWBA 1UYOX 3CBCA 4HFOA 2CBRA 3WJCA 4BX6A 1P6PA 1XKIA 1SWJA 1DFVA 4CPEA 4MVEA 1SY1A 5EPQA 1JQPA 5LJDA 1HQQA 1MK5A 3S5XA 1N7YA 2G78A 1SRHA 2LBAA 4WFVA 1Y9LA 4BGFA 1LELA 4OS3A 3BSZE 2K62A 4OS0A 4IAXA 4CPHA 4NNSA 1SXUA 3NQ3A 5H9NA 3RDMA 3FENA 1X8OA 2KW1A 2OVEA 2OVDA 1AQBA 1ERBA 1HMRA 4GDZA 3NADA 1BRQA 3P6HA 3UEXA 4NLIA 2MF6A 2XSTA 4CPHB 2GTLO 1B8EA 2ACOA 1SWTA 4Y0PA 1K3BA 3WZQA 2BLGA 1VWAB 1VWDB 1HBQA 3EW2A 4C5PA 4GE1A 3FYFA 2HKDA 3VHHA 5C0NA 2DM5A 2AT0X 1KT5A 1A2DA 1SLFB 1OBUA 1QG5A 3RBYA 5KHPA 2OY8A 1OPBA 1MEPA 1IW2A 4I9RA 4BBOA 1SREA 2QOMA 1GGLA 4RUNA 1MUPA 1GX8A 1DC9A 1EALA 4ORWA 2X46A 4CDFA 2WWPA 4TNNA 2NNDA 3BX8A 4O4OA 4NV7A 3RY1A 1STRB 4I60A 1E2TA 2IZDB 2I5VO 4R0BA 5L8NA 1BJ7A 2X4MA 4OKAA 3P6CA 4QAEA 5L8IA 3HTYA 4IB6A 3SZIA 3SLJA 2P8GA 4AYHA 2HMBA 1MX8A 1SXWA 2F01A 3Q34A 1X8UA 4PJ2A 4KC7A 1EI5A 1VWPB 4GNWA 2L67A 1KGLA 1QFTA 4N7DA 3PH6A 4YDBA 3D97A 4IB8A 1VWFB 3FIQA 1KT3A 4OELA 4CK4A 1Y0GA 2OFMX 1EW3A 2KD2A 2RTQB 4GH7A 1KZWA 1G5WA 3ZZVA 2G7BA 2OVAA 4ZHHA 4GD9A 3X00A 4Y0QA 3U0DA 2G5LA 5K06A 4Y0RA 2FGSA 3GAQA 2HZQA 2GTLN 4AZNA 3N91A 4YGGA 2YG2A 5H9AA 4ALOA 4MVLA 4M7MA 4U8UM 4YVBA 2RTFB 2R73A 1IKJA 1RXHA 2BT9A 2AT6X 3RDUA 5IXGA 1G85A 3BX7A 1KL5A 2IZEB 3HWGA 4DNEA 2C1SA 4A1YA 3OJYC 2BSZA 3PECA 1PM1X 3B2IA 1FELA 5LJKA 4HPAA 1X8QA 4FQBB 1TVQA 1KOIA 4ALBA 3VE2A 1LIBA 4HWMA 4LZVA 3AUMO 1I05A 1SY0A 2MWHA 3FEKA 4XMGA 2UZ2A 3VPJE 3BRNA 2FR3A 1GX3A 1JJJA 3RWXA 4CSBA 2RTLA 3APWA 4LKTA 1ZRYA 1QFVA 1HN2A 1L6MA 4GK9A 4WFUA 2JW1A 4LZUA 4NYRA 5D8JA 1ZNDA 5F58A 1GT3A 4COTA 5B5FA 1VWIB 2RTCB 4OEMA 5HCCC 2C4IA 4QZTA 1SWAA 1EIIA 1LKEA 3FA7A 2C1QA 4PSQA 2RTMA 3EBKA 4WHIA 3RDOA 2IFBA 3VGWA 1SWPA 1EUOA 1VWOB 4ZHDA 4HPCA 2PI3O 1SWNA 3IA8A 1VWHB 4ZR2A 3STMX 3TGCA 2POAA 1N9YA 1ZNHA 2HYSA 4O49A 3TZSA 2QO5A 1VWKB 1NQMA 5EEDA 4FBVA 4DQ3A 1SRFA 1Y55X 2O62A 1X8NA 2FTBA 1DF3A 4TJZA 3RZYA 1ZNLA 1NP4A 5EZ2A 1BRPA 1D2UA 1GXAA 5B27A 3F9DA 3P02A 3C76X 4YBPA 3ELXA 5D45A 4MIRA 1B56A 2CM4A 2M4LA 2AL0X 1OEJA 2I5ZO 2LBVA 4GU8A 3D96A 1KT4A 4BX7A 4QGVA 1SXYA 1SY3A 1HY2A 4Z2VA 2X34A 3T6LA 3NQ9A 4QZUA 1FDQA 4U8UO 1Y9TA 1LDQA 4MVKA 1SWEA 3ZW0B 4WBKA 1PEEA 1JMZA 5HBSA 1LCZA 1HQPA 2JU7A 2OL6O 5LKFA 1SXXA 4ORUA 4AZRA 5FQ7E 3WZNA 3AEHA 1CBRA 2W2FA 3PK2A 3VG4A 1Y52X 5BVQA 1LDOA 3WOVA 1BLRA 4GJSA 1R0UA 4A8ZA 3CMPA 2FKGA 5FFHA 4ORSA 4QYNA 1EPBA 2RCQA 2RTDB 1B0OA 2HLVA 3WXQA 5LKEA 1VWQB 5F2BA 3VHIA 1UYNX 1DZMA 1SWQA 3JS1A 4FGIB 4Z2PA 4Z2OA 1RBPA 1FEMA 3P24A 5AJBA 2FHLA 4ZHGA 1QY0A 1BWYA 1ML7A 1SA8A 2JN3A 4D6BA 5JR8A 1OPAA 1S2PA 3NP1A 4L3RA 1VWGB 1NGLA 1DZKA 4XMEA 3CWKA 1AB0A 5AEOA 1Z24A 2FS7A 4O3ZA 4ORRA 1T68X 4IABA 4RUUA 4EKVA 4U9CA 4DQ4A 3U03A 5K68A 4BX5B 4TKHA 3SLOA 1PMPA 1KQWA 1G74A 1KT7A 2OZQA 2NNEA 3UEWA 1OEEA 1VWRB 3D9WA 1SWCA 3L4RA 1YWCA 2G8CO 1LPJA 2RTOB 1LCWA 2FRSA 2OVSA 3BDRA 1ALBA 1U18A 2X8SA 4BJ8A 3HOLA 2AVIA 2JU3A 1IIUA 4A60A 1I78A 5B2AO 2QM9A 3ELZA 3VG5A 4HPBA 4YCEA 4AZMA 3CQRA 2A0AA 2Q39A 3PDFA 2W2AA 4I9SA 4YGZA 1E02A 2Y3FA 5DG4A 2FT9A 1NBXA 1TOUA 2RTAA 4QQ1A 4A1HA 4OMXA 3WVMA 4U8UN 3KVNA 3KFIA 1VWBB 3LV4A 3B2KA 3FEPA 1ZNGA 4I3BA 5HCDC 1KL3A 3LHNA 1IFBA 1SMPI 1CBIA 2IZHB 2X55A 4CPFA 3CKGA 1BEBA 3VG7A 1KZXA 1OBQA 1IJ8A 2QCBA 1SWLA 1TOWA 2YMSA 3FELA 3O22A 2IZGB 1BBPA 4MVIA 1D3SA 1SWGA 2JOZA 4YKOA 5HZQA 5LJGA 1JJUA 1N9MA 1JYDA 3P6FA 2GJ5A 2AH7X 3WYPA 3S5VA 1DV9A 2IZCB 1W6FA 2GTFX 3B2JA 4XMCA 3G7XA 4KH8A 5B11O 3VU1A 5IRAA 2AT8X 1LFOA 2IZFB 2CAMA 1UZ2X 4ZH6A 2WSJA 5KIDA 5CHKA 1VWMB 4Z6JA 5HAEA 1OBPA 4LQZA 1FE3A 1YWBA 1WUBA 4QYPA 4XMFA 2JU8A 1ERXA 5HTDA 3MG5A 1JJXA 3APVA 5IO7A 1QWDA 1LIFA 3RY2A 3ZWEA 3BU9A 2FR2A 4ZH9A 3UEUA 5KICA 2X32A 4YMYA 2KT4B 4INNA 3RDXA 4KC8A 1LICA 1O8VA 1N4JA 1RLBE 1YUPA 4Y5DA 3SAOA 5F7GA 3APXA 4ZJ0A 4I6SA 5D4AA 2A8GA 2OFAA 2KTSA 1JYJA 1SY2A 1BSOA
chains in the Genus database with same CATH topology
5FQ8E 2K23A 4ZGUA 4O3WA 3STNA 3PH5A 4GKCA 3JQOA 3P6EA 5IO5A 4LKPA 2QO6A 2ACPX 1QABE 5HZ8A 5F6ZA 3TGBA 3WBGA 2FWVA 3DTQA 3K3LA 2HZRA 1N0SA 1A18A 2ZAIA 3FLLA 3HWEA 3PEDA 4TQ2A 3FR5A 2CZUA 2AT5X 3B2HA 4L1NA 1GM6A 1IKEA 1ADLA 3FW4A 4D6AA 2A3FX 4ORYA 5HZ6A 3MVFA 5LJHA 5LJBA 3I0AA 1QY2A 4NYQA 5HZ9A 1U0XA 1KXOA 4GETA 2NNQA 4ZCBA 4ZGFA 1OEKA 2PY1A 5H8TA 5HCEC 4ML7B 2Z4IA 4OMWA 4IMNA 1EQDA 1IFCA 2RA6A 1UREA 2RD7C 2FS6A 4ZHCA 3CQNA 3V8UA 2OFRX 2A2GA 1GT1A 5EEEA 2JMBA 1LNMA 1ICMA 1TW4A 3NX1A 5CYBA 1JZUA 3P6DA 1MDCA 4O3XB 2WEWA 3FA6A 3NQKA 4UU3A 4TLJA 2W2BA 1EIOA 3D4RA 5HA1A 4IBAA 2L68A 5HTEA 4FBOA 2L5PA 4ARHA 3O2YA 3T1DA 3NR3A 5LJCA 4IAWA 2MHDA 1YP6A 4U3QA 4YGHA 2KTDA 4K19A 4ZHFA 3EM0A 1S7DA 1ZNKA 4AZOA 4QRLA 3AKMA 1GKAB 3OE3A 4YCHA 3BLGA 3ZW1B 2F73A 4I95A 4EEJA 5DPQA 3B2LA 5D47A 4O3YA 3VG6A 3OD9A 2EU7X 2X45A 3OBLA 4AZPA 1I4UA 3APUA 2MM3A 2CBSA 1FTPA 2ZAGA 4IB7A 5FENA 5HA0A 1TXLA 1CBQA 2WQAE 3WJDA 2WR6A 3BU1A 4QGWA 4XMHA 4YH0A 3VG3A 2A2UA 2QOSC 2BHVA 2BS6A 3EBWA 2LFOA 3FW5A 3F6ZB 1VPRA 4NP1A 4OS8A 3PP6A 1S44A 2ANSA 2G79A 4TKJA 3CBSA 1ICNA 3PPTA 1DZPA 1B4MA 2R74A 2L9CA 1T8VA 3P6GA 3QKGA 4GRJA 3WJFA 1CRBA 1E00A 1GT5A 4XMDA 2RQ0A 1EPAA 4I3DA 5IO6A 4ON1A 3CR6A 1I04A 1LIEA 2E4JA 3VG2A 3ZW0B 3FMZA 5L8NA 4MISA 1CBSA 3BS2A 1E5PA 1ACDA 3S26A 2FLJA 1X8PA 5HWZA 3KFGA 4EXZA 1QY1A 3GE2A 3NX2A 4FBRA 3ZW0A 3Q6LA 2WEXA 1HMTA 3WJGA 1G7NA 2N93A 1GX9A 2NP1A 3FA9A 2Q4NA 2WUTA 2RN4A 4IMOA 1JIWI 4EQAC 3MX7A 1DZJA 4N7CA 1LF7A 1QQSA 3HK1A 1YWDA 2Q2PA 4KIIA 2MO5A 3PQSA 2Q9SA 3TGAA 4ODDA 5D48A 2RCTA 3EMMA 4BOEA 2ALLX 1X89A 3AKNA 4YDAA 3ZQ3A 1EXSA 5EDCA 1KQXA 1NP1A 5AQ6A 1H91A 3HOEA 3C77X 2R56A 3ZUOA 3D95A 2CM9A 3HWDA 2X8TA 3KZAA 3MBTA 1O1VA 4YFQA 3PQUA 1VYGA 1BSQA 1T0VA 5AJCA 3VE1A 3BY0A 2F09A 4O4UA 3C78X 5EDBA 4KCAA 2ASNX 1O1UA 3TF6A 3FR2A 4NNTA 2LA7A 1MVGA 3RSWA 5CE4A 5FQ6E 2CZTA 4CV7A 5B29A 5F1EA 5H9LA 4YBUA 4JGLA 4IB9A 3I17A 5LJEA 1A57A 2MJIA 3S60A 1I06A 2WQ9A 4I3CA 3WJEA 4ES7A 2AT3X 1U17A 3NBXX 2LKKA 4QNIA 1HMSA 3KFHA 4YKMA 2XKLA 5BYPA 3ZUIA 2GTLM 4NW4A 5FAZA 2QMIA 3FR4A 3O19A 4ORXA 3JSQA 3DSZA 3IFBA 1CJ5A 3F8AA 1A3YA 1AVGI 5H9KA 3U9PC 4GZVA 1KT6A 4AW8A 4AZQA 1YP7A 3KQ0A 4ZFXA 3WJBA 3H3IA 1FENA 1XCAA 2HNXA 4HPDA 4KT5A 3ZI8A 4A60A 1YWAA 4O4XA 3SOTA 4YFRA 5HZ5A 5F6BA 3EYCA 2X8FA 4BQUA 1E06A 4GNYA 4O9SA 3UEVA 3RKGA 4Y0SA 1MX7A 2AMMX 3KFFA 1PBOA 1BSYA 1HBPA 3ZW2A 2Q2MA 4BVMA 3E3CA 2LB6A 1JBHA 3NPOA 4M6SA 2QO4A 2GC9A 1GKAA 1JV4A 2AKQA 3ZW1A 3STKA 1GT4A 2BS5A 4O4SA 1BM5A 3HWFA 4QGXA 2A13A 3UAQA 5L8OA 4TKBA 1ZNEA 4ID2A 4NLJA 5BVTA 3FA8A 1VYFA 4EDEA 1X71A 2Z4HA 1AELA 1YIVA 4EFGA 5BVSA 4YFPA 1LIDA 4UU2A 3CBCA 4HFOA 2CBRA 3WJCA 1P6PA 1XKIA 1DFVA 4MVEA 1SY1A 5EPQA 5LJDA 3S5XA 2G78A 2LBAA 4WFVA 1Y9LA 4OS3A 3BSZE 2K62A 4OS0A 4IAXA 4NNSA 1SXUA 3NQ3A 5H9NA 3FENA 1X8OA 2KW1A 2OVEA 2OVDA 1AQBA 1ERBA 1HMRA 4GDZA 3NADA 1BRQA 3P6HA 3UEXA 4NLIA 2XSTA 2GTLO 1B8EA 2ACOA 4Y0PA 2BLGA 1HBQA 4GE1A 3FYFA 5C0NA 2DM5A 2AT0X 1KT5A 1A2DA 1OBUA 1QG5A 3RBYA 5KHPA 1OPBA 4I9RA 1IW2A 1GGLA 4RUNA 1MUPA 1GX8A 1DC9A 1EALA 4ORWA 2X46A 2WWPA 4TNNA 2NNDA 3BX8A 4O4OA 4R0BA 1BJ7A 4QAEA 3P6CA 5L8IA 4AYHA 3HTYA 4IB6A 2P8GA 2HMBA 1MX8A 1SXWA 1X8UA 4PJ2A 4KC7A 1EI5A 4GNWA 1KGLA 2L67A 1QFTA 4N7DA 3PH6A 4YDBA 3D97A 4IB8A 3FIQA 1KT3A 4CK4A 2OFMX 1EW3A 2KD2A 4GH7A 1KZWA 1G5WA 3ZZVA 2G7BA 2OVAA 4ZHHA 4Y0QA 3U0DA 5K06A 4Y0RA 4AZNA 3GAQA 2HZQA 2GTLN 3N91A 4YGGA 2YG2A 5H9AA 4ALOA 4MVLA 4M7MA 4U8UM 2R73A 1IKJA 2BT9A 2AT6X 1G85A 3BX7A 3HWGA 4A1YA 3OJYC 3PECA 1PM1X 3B2IA 1FELA 5LJKA 4HPAA 1X8QA 4FQBB 1TVQA 1KOIA 4ALBA 3VE2A 1LIBA 4HWMA 4LZVA 1I05A 1SY0A 2MWHA 3FEKA 4XMGA 3VPJE 3BRNA 2FR3A 1JJJA 4CSBA 3APWA 4LKTA 1ZRYA 1QFVA 1HN2A 1L6MA 4GK9A 4WFUA 2JW1A 4LZUA 4NYRA 5D8JA 1ZNDA 5F58A 1GT3A 4COTA 5HCCC 4QZTA 1EIIA 1LKEA 3FA7A 4PSQA 3EBKA 4WHIA 2IFBA 1EUOA 4ZHDA 4HPCA 3IA8A 3STMX 4ZR2A 3TGCA 2POAA 1ZNHA 2HYSA 4O49A 3TZSA 2QO5A 5EEDA 4DQ3A 4FBVA 1DF3A 2O62A 1X8NA 2FTBA 4TJZA 3RZYA 1ZNLA 1NP4A 5EZ2A 1BRPA 1D2UA 1GXAA 5B27A 3F9DA 3P02A 3C76X 4YBPA 3ELXA 5D45A 4MIRA 1B56A 2CM4A 2M4LA 2AL0X 1OEJA 2LBVA 4QGVA 4GU8A 3D96A 1KT4A 1SXYA 1SY3A 3NQ9A 4QZUA 1FDQA 4U8UO 1Y9TA 4MVKA 4WBKA 1PEEA 5HBSA 2JU7A 1HQPA 5LKFA 1SXXA 4ORUA 4AZRA 5FQ7E 1CBRA 2W2FA 3VG4A 5BVQA 3WOVA 1BLRA 1R0UA 4A8ZA 3CMPA 5FFHA 4ORSA 4QYNA 1EPBA 2RCQA 1B0OA 2HLVA 3WXQA 5LKEA 1DZMA 3JS1A 4FGIB 1RBPA 1FEMA 3P24A 5AJBA 4ZHGA 1BWYA 1QY0A 1ML7A 1SA8A 2JN3A 4D6BA 5JR8A 1OPAA 1S2PA 3NP1A 4L3RA 1NGLA 1DZKA 4XMEA 3CWKA 1AB0A 5AEOA 1Z24A 2FS7A 4O3ZA 4ORRA 1T68X 4IABA 4RUUA 4U9CA 4DQ4A 3U03A 4TKHA 1PMPA 1KQWA 1G74A 1KT7A 2OZQA 2NNEA 3UEWA 1OEEA 3L4RA 1YWCA 3RWXA 1LPJA 3BDRA 2FRSA 2OVSA 1ALBA 1U18A 2X8SA 3HOLA 2JU3A 1IIUA 2QM9A 3ELZA 3VG5A 4HPBA 4YCEA 4AZMA 3CQRA 2A0AA 2Q39A 2W2AA 4I9SA 4YGZA 1E02A 5DG4A 2FT9A 1TOUA 4A1HA 4QQ1A 4OMXA 3WVMA 4U8UN 3KFIA 3LV4A 3B2KA 3FEPA 1ZNGA 4I3BA 5HCDC 3LHNA 1IFBA 1SMPI 1CBIA 1BEBA 3VG7A 1KZXA 1OBQA 2YMSA 3FELA 1TOWA 3O22A 4MVIA 1BBPA 1D3SA 2JOZA 4YKOA 5HZQA 5LJGA 1JYDA 3P6FA 2GJ5A 2AH7X 3S5VA 1DV9A 2GTFX 3B2JA 4XMCA 3G7XA 4KH8A 3VU1A 2AT8X 1LFOA 1UZ2X 4ZH6A 2WSJA 5KIDA 5HAEA 1OBPA 4LQZA 1FE3A 1YWBA 4QYPA 4XMFA 2JU8A 1ERXA 5HTDA 1JJXA 3APVA 5IO7A 1QWDA 1LIFA 3ZWEA 3BU9A 2FR2A 4ZH9A 3UEUA 5KICA 4YMYA 2KT4B 4INNA 4KC8A 1LICA 1O8VA 1RLBE 1YUPA 3SAOA 5F7GA 3APXA 4ZJ0A 4I6SA 5D4AA 2KTSA 1JYJA 1SY2A 1BSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K23 A;  4ZGU A;  3STN A;  3PH5 A;  4GKC A;  3P6E A;  5IO5 A;  4LKP A;  2QO6 A;  2ACP X;  1QAB E;  5HZ8 A;  5F6Z A;  3TGB A;  3WBG A;  2FWV A;  3DTQ A;  3K3L A;  2HZR A;  1N0S A;  1A18 A;  3FLL A;  3HWE A;  3PED A;  4TQ2 A;  3FR5 A;  2CZU A;  2AT5 X;  3B2H A;  1GM6 A;  1IKE A;  1ADL A;  3FW4 A;  4D6A A;  2A3F X;  4ORY A;  5HZ6 A;  3MVF A;  5LJH A;  5LJB A;  3I0A A;  1QY2 A;  4NYQ A;  5HZ9 A;  1U0X A;  1KXO A;  4GET A;  2NNQ A;  4ZCB A;  1OEK A;  2PY1 A;  5H8T A;  5HCE C;  4OMW A;  4IMN A;  1EQD A;  1IFC A;  2RA6 A;  1URE A;  2RD7 C;  2FS6 A;  4ZHC A;  3CQN A;  2OFR X;  2A2G A;  1GT1 A;  5EEE A;  1LNM A;  1ICM A;  1TW4 A;  3NX1 A;  1JZU A;  3P6D A;  1MDC A;  2WEW A;  3FA6 A;  4UU3 A;  4TLJ A;  2W2B A;  1EIO A;  5HA1 A;  4IBA A;  2L68 A;  5HTE A;  2L5P A;  4ARH A;  3O2Y A;  3T1D A;  3NR3 A;  5LJC A;  4IAW A;  1YP6 A;  4YGH A;  2KTD A;  4K19 A;  4ZHF A;  3EM0 A;  1S7D A;  1ZNK A;  4AZO A;  3AKM A;  1GKA B;  4YCH A;  3BLG A;  2F73 A;  4EEJ A;  5DPQ A;  3B2L A;  5D47 A;  3VG6 A;  2EU7 X;  2X45 A;  4AZP A;  1I4U A;  3APU A;  2MM3 A;  2CBS A;  1FTP A;  4IB7 A;  5FEN A;  5HA0 A;  1TXL A;  1CBQ A;  2WQA E;  3WJD A;  2WR6 A;  3BU1 A;  4QGW A;  4XMH A;  4YH0 A;  3VG3 A;  2A2U A;  2QOS C;  3EBW A;  2LFO A;  3FW5 A;  1VPR A;  4NP1 A;  4OS8 A;  3PP6 A;  1S44 A;  2ANS A;  2G79 A;  4TKJ A;  3CBS A;  1ICN A;  3PPT A;  1DZP A;  1B4M A;  2R74 A;  2L9C A;  1T8V A;  3P6G A;  3QKG A;  4GRJ A;  3WJF A;  1CRB A;  1E00 A;  1GT5 A;  4XMD A;  2RQ0 A;  1EPA A;  4I3D A;  5IO6 A;  3CR6 A;  1I04 A;  1LIE A;  2E4J A;  3VG2 A;  5L8N A;  3FMZ A;  1CBS A;  3BS2 A;  1E5P A;  1ACD A;  3S26 A;  2FLJ A;  1X8P A;  5HWZ A;  3KFG A;  4EXZ A;  1QY1 A;  3NX2 A;  3Q6L A;  2WEX A;  1HMT A;  3WJG A;  1G7N A;  2N93 A;  1GX9 A;  2NP1 A;  3FA9 A;  2Q4N A;  2WUT A;  4IMO A;  5K06 A;  1DZJ A;  4N7C A;  1LF7 A;  1QQS A;  3HK1 A;  1YWD A;  2Q2P A;  4KII A;  2MO5 A;  2Q9S A;  3TGA A;  4ODD A;  5D48 A;  2RCT A;  3EMM A;  4BOE A;  2ALL X;  1X89 A;  3AKN A;  4YDA A;  3ZQ3 A;  1EXS A;  5EDC A;  1KQX A;  1NP1 A;  5AQ6 A;  1H91 A;  3C77 X;  2R56 A;  3ZUO A;  3D95 A;  2CM9 A;  3HWD A;  3KZA A;  3MBT A;  1O1V A;  4YFQ A;  1VYG A;  1BSQ A;  1T0V A;  3BY0 A;  3C78 X;  5EDB A;  2ASN X;  1O1U A;  3TF6 A;  3FR2 A;  4NNT A;  1MVG A;  3RSW A;  5CE4 A;  2CZT A;  5B29 A;  5F1E A;  5H9L A;  4YBU A;  4IB9 A;  3I17 A;  5LJE A;  1A57 A;  2MJI A;  1I06 A;  2WQ9 A;  4I3C A;  3WJE A;  4ES7 A;  2AT3 X;  1U17 A;  2LKK A;  1HMS A;  3KFH A;  4YKM A;  2XKL A;  3ZUI A;  5FAZ A;  4ORX A;  3FR4 A;  3O19 A;  3JSQ A;  3DSZ A;  3IFB A;  1CJ5 A;  3F8A A;  1A3Y A;  1AVG I;  5H9K A;  3U9P C;  1KT6 A;  4AW8 A;  4AZQ A;  1YP7 A;  3KQ0 A;  4ZFX A;  3WJB A;  1FEN A;  1XCA A;  2HNX A;  4HPD A;  4A60 A;  4YFR A;  1YWA A;  5HZ5 A;  5F6B A;  3EYC A;  4BQU A;  1E06 A;  4GNY A;  4O9S A;  3UEV A;  4Y0S A;  1MX7 A;  2AMM X;  3KFF A;  1PBO A;  1BSY A;  1HBP A;  2Q2M A;  4BVM A;  2LB6 A;  1JBH A;  3NPO A;  4M6S A;  2QO4 A;  2GC9 A;  1GKA A;  1JV4 A;  2AKQ A;  1BM5 A;  3STK A;  1GT4 A;  3HWF A;  4QGX A;  2A13 A;  5L8O A;  4TKB A;  1ZNE A;  4NLJ A;  5BVT A;  3FA8 A;  1VYF A;  4EDE A;  1X71 A;  1AEL A;  1YIV A;  4EFG A;  5BVS A;  4YFP A;  1LID A;  4UU2 A;  3CBC A;  4HFO A;  2CBR A;  3WJC A;  1P6P A;  1XKI A;  1DFV A;  1SY1 A;  5EPQ A;  5LJD A;  2G78 A;  2LBA A;  4WFV A;  4OS3 A;  3BSZ E;  2K62 A;  4OS0 A;  4IAX A;  4NNS A;  1SXU A;  3NQ3 A;  5H9N A;  3FEN A;  1X8O A;  2OVE A;  2OVD A;  1AQB A;  1ERB A;  1HMR A;  3NAD A;  1BRQ A;  3P6H A;  3UEX A;  4NLI A;  2XST A;  1B8E A;  2ACO A;  4Y0P A;  2BLG A;  1HBQ A;  4GE1 A;  5C0N A;  2DM5 A;  2AT0 X;  1KT5 A;  1A2D A;  1OBU A;  1QG5 A;  5KHP A;  1OPB A;  4I9R A;  1IW2 A;  1GGL A;  4RUN A;  1MUP A;  1GX8 A;  1DC9 A;  1EAL A;  4ORW A;  2X46 A;  2WWP A;  4TNN A;  2NND A;  3BX8 A;  4R0B A;  1BJ7 A;  4QAE A;  3P6C A;  5L8I A;  4AYH A;  4IB6 A;  2P8G A;  2HMB A;  1MX8 A;  1SXW A;  1X8U A;  4GNW A;  1KGL A;  2L67 A;  1QFT A;  4N7D A;  3PH6 A;  4YDB A;  3D97 A;  4IB8 A;  3FIQ A;  1KT3 A;  4CK4 A;  2OFM X;  1EW3 A;  4GH7 A;  1KZW A;  1G5W A;  2G7B A;  2OVA A;  4ZHH A;  4Y0Q A;  3U0D A;  4Y0R A;  4AZN A;  3GAQ A;  2HZQ A;  4YGG A;  2YG2 A;  5H9A A;  4ALO A;  4MVL A;  4M7M A;  2R73 A;  1IKJ A;  2AT6 X;  1G85 A;  3BX7 A;  3HWG A;  4A1Y A;  3OJY C;  3PEC A;  1PM1 X;  3B2I A;  1FEL A;  5LJK A;  4HPA A;  1X8Q A;  1TVQ A;  1KOI A;  4ALB A;  1LIB A;  4LZV A;  1I05 A;  1SY0 A;  3FEK A;  4XMG A;  3BRN A;  2FR3 A;  1JJJ A;  3APW A;  4LKT A;  1ZRY A;  1QFV A;  1HN2 A;  1L6M A;  4WFU A;  4LZU A;  4NYR A;  5D8J A;  1ZND A;  5F58 A;  1GT3 A;  5HCC C;  4QZT A;  1EII A;  1LKE A;  3FA7 A;  4PSQ A;  3EBK A;  2IFB A;  1EUO A;  4ZHD A;  4HPC A;  3IA8 A;  3STM X;  4ZR2 A;  3TGC A;  2POA A;  1ZNH A;  2HYS A;  3TZS A;  2QO5 A;  5EED A;  4DQ3 A;  1DF3 A;  2O62 A;  1X8N A;  2FTB A;  4TJZ A;  3RZY A;  1ZNL A;  1NP4 A;  5EZ2 A;  1BRP A;  1D2U A;  1GXA A;  5B27 A;  3F9D A;  3C76 X;  4YBP A;  3ELX A;  5D45 A;  1B56 A;  2CM4 A;  2AL0 X;  1OEJ A;  2LBV A;  4QGV A;  3D96 A;  1KT4 A;  1SXY A;  1SY3 A;  3NQ9 A;  4QZU A;  1FDQ A;  4MVK A;  4WBK A;  1PEE A;  5HBS A;  2JU7 A;  1HQP A;  5LKF A;  1SXX A;  4ORU A;  4AZR A;  1CBR A;  2W2F A;  3VG4 A;  5BVQ A;  1BLR A;  1R0U A;  4A8Z A;  3CMP A;  5FFH A;  4ORS A;  4QYN A;  1EPB A;  2RCQ A;  1B0O A;  2HLV A;  3WXQ A;  5LKE A;  1DZM A;  3JS1 A;  1RBP A;  1FEM A;  4ZHG A;  1BWY A;  1QY0 A;  1ML7 A;  1SA8 A;  2JN3 A;  4D6B A;  5JR8 A;  1OPA A;  1S2P A;  3NP1 A;  1NGL A;  1DZK A;  4XME A;  3CWK A;  1AB0 A;  1Z24 A;  2FS7 A;  4ORR A;  4RUU A;  1T68 X;  4DQ4 A;  3U03 A;  4TKH A;  1PMP A;  1KQW A;  1G74 A;  1KT7 A;  2OZQ A;  2NNE A;  3UEW A;  1OEE A;  3L4R A;  1YWC A;  1LPJ A;  3BDR A;  2FRS A;  1ALB A;  1U18 A;  2JU3 A;  1IIU A;  2QM9 A;  3ELZ A;  3VG5 A;  4HPB A;  4YCE A;  4AZM A;  3CQR A;  2A0A A;  2Q39 A;  2W2A A;  4I9S A;  4YGZ A;  1E02 A;  5DG4 A;  2FT9 A;  1TOU A;  4A1H A;  4OMX A;  3WVM A;  3KFI A;  3B2K A;  3FEP A;  1ZNG A;  4I3B A;  5HCD C;  1IFB A;  1CBI A;  1BEB A;  3VG7 A;  1KZX A;  1OBQ A;  3FEL A;  1TOW A;  3O22 A;  4MVI A;  1BBP A;  1D3S A;  2JOZ A;  4YKO A;  5HZQ A;  5LJG A;  1JYD A;  3P6F A;  2GJ5 A;  2AH7 X;  1DV9 A;  2GTF X;  3B2J A;  4XMC A;  3G7X A;  2AT8 X;  1LFO A;  1UZ2 X;  4ZH6 A;  2WSJ A;  5KID A;  5HAE A;  1OBP A;  1FE3 A;  1YWB A;  4QYP A;  4XMF A;  2JU8 A;  1ERX A;  5HTD A;  1JJX A;  3APV A;  5IO7 A;  1QWD A;  1LIF A;  5KIC A;  3BU9 A;  2FR2 A;  4ZH9 A;  3UEU A;  4YMY A;  2KT4 B;  1LIC A;  1O8V A;  1RLB E;  1YUP A;  3SAO A;  5F7G A;  3APX A;  4ZJ0 A;  5D4A A;  1JYJ A;  1SY2 A;  1BSO A; 
#chains in the Genus database with same CATH topology
 1SWU A;  5FQ8 E;  2K23 A;  4ZGU A;  4O3W A;  3STN A;  3PH5 A;  1SWD A;  4GKC A;  3JQO A;  3P6E A;  4GUZ A;  5IO5 A;  4LKP A;  2QO6 A;  1SRJ A;  2ACP X;  1QAB E;  2OL8 O;  5HZ8 A;  5F6Z A;  3TGB A;  1KL4 A;  3WBG A;  2FWV A;  3DTQ A;  2VDF A;  3K3L A;  2HZR A;  1N0S A;  2Y32 A;  1A18 A;  2OFB A;  2RTE B;  2ZAI A;  2X56 A;  3FLL A;  3HWE A;  3PED A;  4TQ2 A;  1BM5 A;  3FR5 A;  2CZU A;  2AT5 X;  3B2H A;  4L1N A;  1AVD A;  2RTG B;  2RTP B;  1GM6 A;  1SLD B;  4GDA A;  1IKE A;  1ADL A;  2VFB A;  3FW4 A;  4D6A A;  1SLG B;  2A3F X;  4ORY A;  3RE6 A;  3MVF A;  3WZP A;  5HZ6 A;  3I0A A;  1QY2 A;  4NYQ A;  5LJH A;  5LJB A;  5HZ9 A;  1U0X A;  1KXO A;  3RE5 A;  1PTS A;  4GET A;  2NNQ A;  2AF5 A;  1SRG A;  4ZCB A;  1OEK A;  4ZGF A;  2PY1 A;  5H8T A;  5HCE C;  4ML7 B;  2Z4I A;  1SWK A;  4OMW A;  4IMN A;  1EQD A;  1IFC A;  2RA6 A;  1URE A;  2RD7 C;  2RTH B;  1FJ1 E;  2FS6 A;  4ZHC A;  1OSP O;  4B55 A;  3CQN A;  2RTK A;  2OFR X;  3V8U A;  4BCS A;  2A2G A;  1LCV A;  1GT1 A;  5EEE A;  2JMB A;  1LNM A;  1ICM A;  1TW4 A;  2A5B A;  3NX1 A;  5CYB A;  1JZU A;  3P6D A;  1MDC A;  4O3X B;  2WEW A;  3FA6 A;  2Y3E A;  4JNJ A;  3WZO A;  5B10 O;  1VWL B;  3NQK A;  4UU3 A;  4TLJ A;  2W2B A;  1RXJ A;  1EIO A;  4NV8 A;  4CDC A;  2BC3 A;  4BX5 A;  3D4R A;  5HA1 A;  4IBA A;  2L68 A;  5HTE A;  4FBO A;  4CDE A;  4CPI A;  2IZB A;  2L5P A;  1W4T A;  4ARH A;  3O2Y A;  3T1D A;  3LTW A;  3NR3 A;  1RAV A;  4IAW A;  2MHD A;  1YP6 A;  4U3Q A;  5LJC A;  4YGH A;  2KTD A;  4K19 A;  4ZHF A;  3MM0 A;  3EM0 A;  2UYW A;  1S7D A;  1ZNK A;  4AZO A;  4QRL A;  4JHQ A;  3AKM A;  1GKA B;  3OE3 A;  4YCH A;  3BLG A;  3ZW1 B;  2OY7 A;  2F73 A;  4I95 A;  4EEJ A;  2OF8 A;  3B2L A;  1RXK A;  3CKF A;  5D47 A;  4O3Y A;  1STS B;  3OD9 A;  2EU7 X;  2X45 A;  3OBL A;  4IRW A;  4Z28 A;  3VG6 A;  4AZP A;  1I4U A;  3APU A;  2MM3 A;  1K24 A;  2CBS A;  1FTP A;  2VFC A;  2ZAG A;  4IB7 A;  5HA0 A;  5FEN A;  4BX6 B;  1TXL A;  1CBQ A;  2WQA E;  3WJD A;  2WR6 A;  1PBY A;  1VWN B;  3BU1 A;  3HPE A;  4QGW A;  4XMH A;  4YH0 A;  3T2X A;  3VG3 A;  2A2U A;  2QOS C;  2BHV A;  2BS6 A;  3EBW A;  2LFO A;  3FW5 A;  3F6Z B;  1VPR A;  3T2W A;  4NP1 A;  4OS8 A;  3PP6 A;  1S44 A;  1WBI A;  2ANS A;  2G79 A;  4TKJ A;  3CBS A;  3RDQ A;  4Z27 A;  1ICN A;  1VWJ B;  3PPT A;  1DZP A;  1B4M A;  2R74 A;  4GJV A;  1W5R A;  1SWO A;  2L9C A;  1T8V A;  3FDC A;  3P6G A;  3QKG A;  4GRJ A;  3VHM A;  1CRB A;  5B5G A;  3WJF A;  1Y53 X;  1E00 A;  1GT5 A;  4XMD A;  2RQ0 A;  1EPA A;  1KFF A;  3FID A;  4I3D A;  5IO6 A;  4ON1 A;  3CR6 A;  1I04 A;  1LIE A;  5B3M O;  1N43 A;  1VWC B;  2ZSC A;  2E4J A;  3VG2 A;  2IZL B;  3FMZ A;  4GGT A;  4MIS A;  2OY5 O;  1CBS A;  3BS2 A;  1E5P A;  4MEE A;  1ACD A;  3QQ2 A;  3S26 A;  2FLJ A;  1X8P A;  5HWZ A;  3KFG A;  3T6F A;  4EXZ A;  1QY1 A;  3GE2 A;  2IZJ A;  2DJF A;  3NX2 A;  4FBR A;  3ZW0 A;  3Q6L A;  2WEX A;  2FHN X;  2OYB O;  2OF9 A;  1HXZ A;  1HMT A;  3WJG A;  1G7N A;  2N93 A;  1GX9 A;  2NP1 A;  3FA9 A;  2Q4N A;  2WUT A;  2RN4 A;  4IMO A;  1JIW I;  4EQA C;  2IZI A;  3MX7 A;  1DZJ A;  4N7C A;  1LF7 A;  1QQS A;  1STP A;  3HK1 A;  1YWD A;  2Q2P A;  4KII A;  2MO5 A;  3PQS A;  4U46 A;  1MOY A;  2Q9S A;  3TGA A;  2IZK A;  3EC5 A;  3WYQ A;  4ODD A;  5D48 A;  2RCT A;  2GH7 A;  3EMM A;  4BOE A;  2ALL X;  1JMX A;  2FKJ A;  1X89 A;  3AKN A;  4YDA A;  3ZQ3 A;  2RTB B;  1EXS A;  5EDC A;  5IRW A;  1KQX A;  1NP1 A;  5AQ6 A;  1H91 A;  3HOE A;  3RDS A;  3C77 X;  2R56 A;  3ZUO A;  3D95 A;  2CM9 A;  3HWD A;  2X8T A;  4GGR A;  3KZA A;  3MBT A;  1O1V A;  4YFQ A;  3PQU A;  1VYG A;  1BSQ A;  1T0V A;  5AJC A;  3VE1 A;  3BY0 A;  2F09 A;  1MM9 A;  5DPQ A;  4O4U A;  3C78 X;  5EDB A;  5IRU A;  1NDJ A;  4KCA A;  1SLE B;  2ASN X;  1O1U A;  3TF6 A;  3FR2 A;  4NNT A;  4Y59 A;  2LA7 A;  1MVG A;  3RSW A;  5CE4 A;  5FQ6 E;  2CZT A;  4CV7 A;  5B29 A;  5F1E A;  3EW1 A;  2JGS A;  4YBU A;  5H9L A;  4JGL A;  4IB9 A;  3I17 A;  5LJE A;  1SRI A;  1SWF A;  2MJI A;  3S60 A;  1A57 A;  1I06 A;  2WQ9 A;  4I3C A;  5L3Y A;  3WJE A;  4ES7 A;  2AT3 X;  1U17 A;  3NBX X;  1HXL A;  2LKK A;  3SLT A;  4QNI A;  1HMS A;  3KFH A;  1SWH A;  2XKL A;  4YKM A;  5BYP A;  1NQN A;  3ZUI A;  2GTL M;  4NW4 A;  5FAZ A;  2QMI A;  3FR4 A;  3O19 A;  4ORX A;  1VYO A;  3SZH A;  3JSQ A;  2WPU A;  5K67 A;  3DSZ A;  3IFB A;  1CJ5 A;  1VWE B;  3F8A A;  1A3Y A;  1AVE A;  2IZA A;  1AVG I;  5H9K A;  4JO6 A;  3SZJ A;  3U9P C;  4GZV A;  1KT6 A;  4AW8 A;  1I9H A;  1RST B;  4AZQ A;  4DCB A;  1DF8 A;  1YP7 A;  3KQ0 A;  4ZFX A;  3WJB A;  3H3I A;  1FEN A;  1XCA A;  2HNX A;  4HPD A;  2RTJ A;  4KT5 A;  3ZI8 A;  1YWA A;  2OL7 A;  4O4X A;  3SOT A;  4YFR A;  4GGZ A;  5HZ5 A;  5F6B A;  2DJG A;  2X8F A;  3EYC A;  4BQU A;  1E06 A;  4CDD A;  4GNY A;  5CSE A;  2OY1 O;  2RTI B;  4O9S A;  3UEV A;  3RKG A;  1SWS A;  4Y0S A;  1MX7 A;  2AMM X;  5JD2 A;  3KFF A;  1PBO A;  1BSY A;  1HBP A;  3ZW2 A;  2Q2M A;  2RTN B;  4BVM A;  1LUQ A;  3E3C A;  2LB6 A;  1JBH A;  3NPO A;  4M6S A;  2QO4 A;  2GC9 A;  1GKA A;  1JV4 A;  2AKQ A;  3ZW1 A;  3STK A;  1GT4 A;  2BS5 A;  1NC9 A;  1SWR A;  4O4S A;  3HWF A;  4QGX A;  2A13 A;  3UAQ A;  5L8O A;  4TKB A;  1ZNE A;  4ID2 A;  4NLJ A;  5BVT A;  3FA8 A;  1VYF A;  4EDE A;  1X71 A;  2Z4H A;  1RSU B;  1AEL A;  1YIV A;  4EFG A;  5BVS A;  4BX7 B;  2A5C A;  4YFP A;  1LID A;  2RTR B;  4UU2 A;  1SWB A;  1UYO X;  3CBC A;  4HFO A;  2CBR A;  3WJC A;  4BX6 A;  1P6P A;  1XKI A;  1SWJ A;  1DFV A;  4CPE A;  4MVE A;  1SY1 A;  5EPQ A;  1JQP A;  5LJD A;  1HQQ A;  1MK5 A;  3S5X A;  1N7Y A;  2G78 A;  1SRH A;  2LBA A;  4WFV A;  1Y9L A;  4BGF A;  1LEL A;  4OS3 A;  3BSZ E;  2K62 A;  4OS0 A;  4IAX A;  4CPH A;  4NNS A;  1SXU A;  3NQ3 A;  5H9N A;  3RDM A;  3FEN A;  1X8O A;  2KW1 A;  2OVE A;  2OVD A;  1AQB A;  1ERB A;  1HMR A;  4GDZ A;  3NAD A;  1BRQ A;  3P6H A;  3UEX A;  4NLI A;  2MF6 A;  2XST A;  4CPH B;  2GTL O;  1B8E A;  2ACO A;  1SWT A;  4Y0P A;  1K3B A;  3WZQ A;  2BLG A;  1VWA B;  1VWD B;  1HBQ A;  3EW2 A;  4C5P A;  4GE1 A;  3FYF A;  2HKD A;  3VHH A;  5C0N A;  2DM5 A;  2AT0 X;  1KT5 A;  1A2D A;  1SLF B;  1OBU A;  1QG5 A;  3RBY A;  5KHP A;  2OY8 A;  1OPB A;  1MEP A;  1IW2 A;  4I9R A;  4BBO A;  1SRE A;  2QOM A;  1GGL A;  4RUN A;  1MUP A;  1GX8 A;  1DC9 A;  1EAL A;  4ORW A;  2X46 A;  4CDF A;  2WWP A;  4TNN A;  2NND A;  3BX8 A;  4O4O A;  4NV7 A;  3RY1 A;  1STR B;  4I60 A;  1E2T A;  2IZD B;  2I5V O;  4R0B A;  5L8N A;  1BJ7 A;  2X4M A;  4OKA A;  3P6C A;  4QAE A;  5L8I A;  3HTY A;  4IB6 A;  3SZI A;  3SLJ A;  2P8G A;  4AYH A;  2HMB A;  1MX8 A;  1SXW A;  2F01 A;  3Q34 A;  1X8U A;  4PJ2 A;  4KC7 A;  1EI5 A;  1VWP B;  4GNW A;  2L67 A;  1KGL A;  1QFT A;  4N7D A;  3PH6 A;  4YDB A;  3D97 A;  4IB8 A;  1VWF B;  3FIQ A;  1KT3 A;  4OEL A;  4CK4 A;  1Y0G A;  2OFM X;  1EW3 A;  2KD2 A;  2RTQ B;  4GH7 A;  1KZW A;  1G5W A;  3ZZV A;  2G7B A;  2OVA A;  4ZHH A;  4GD9 A;  3X00 A;  4Y0Q A;  3U0D A;  2G5L A;  5K06 A;  4Y0R A;  2FGS A;  3GAQ A;  2HZQ A;  2GTL N;  4AZN A;  3N91 A;  4YGG A;  2YG2 A;  5H9A A;  4ALO A;  4MVL A;  4M7M A;  4U8U M;  4YVB A;  2RTF B;  2R73 A;  1IKJ A;  1RXH A;  2BT9 A;  2AT6 X;  3RDU A;  5IXG A;  1G85 A;  3BX7 A;  1KL5 A;  2IZE B;  3HWG A;  4DNE A;  2C1S A;  4A1Y A;  3OJY C;  2BSZ A;  3PEC A;  1PM1 X;  3B2I A;  1FEL A;  5LJK A;  4HPA A;  1X8Q A;  4FQB B;  1TVQ A;  1KOI A;  4ALB A;  3VE2 A;  1LIB A;  4HWM A;  4LZV A;  3AUM O;  1I05 A;  1SY0 A;  2MWH A;  3FEK A;  4XMG A;  2UZ2 A;  3VPJ E;  3BRN A;  2FR3 A;  1GX3 A;  1JJJ A;  3RWX A;  4CSB A;  2RTL A;  3APW A;  4LKT A;  1ZRY A;  1QFV A;  1HN2 A;  1L6M A;  4GK9 A;  4WFU A;  2JW1 A;  4LZU A;  4NYR A;  5D8J A;  1ZND A;  5F58 A;  1GT3 A;  4COT A;  5B5F A;  1VWI B;  2RTC B;  4OEM A;  5HCC C;  2C4I A;  4QZT A;  1SWA A;  1EII A;  1LKE A;  3FA7 A;  2C1Q A;  4PSQ A;  2RTM A;  3EBK A;  4WHI A;  3RDO A;  2IFB A;  3VGW A;  1SWP A;  1EUO A;  1VWO B;  4ZHD A;  4HPC A;  2PI3 O;  1SWN A;  3IA8 A;  1VWH B;  4ZR2 A;  3STM X;  3TGC A;  2POA A;  1N9Y A;  1ZNH A;  2HYS A;  4O49 A;  3TZS A;  2QO5 A;  1VWK B;  1NQM A;  5EED A;  4FBV A;  4DQ3 A;  1SRF A;  1Y55 X;  2O62 A;  1X8N A;  2FTB A;  1DF3 A;  4TJZ A;  3RZY A;  1ZNL A;  1NP4 A;  5EZ2 A;  1BRP A;  1D2U A;  1GXA A;  5B27 A;  3F9D A;  3P02 A;  3C76 X;  4YBP A;  3ELX A;  5D45 A;  4MIR A;  1B56 A;  2CM4 A;  2M4L A;  2AL0 X;  1OEJ A;  2I5Z O;  2LBV A;  4GU8 A;  3D96 A;  1KT4 A;  4BX7 A;  4QGV A;  1SXY A;  1SY3 A;  1HY2 A;  4Z2V A;  2X34 A;  3T6L A;  3NQ9 A;  4QZU A;  1FDQ A;  4U8U O;  1Y9T A;  1LDQ A;  4MVK A;  1SWE A;  3ZW0 B;  4WBK A;  1PEE A;  1JMZ A;  5HBS A;  1LCZ A;  1HQP A;  2JU7 A;  2OL6 O;  5LKF A;  1SXX A;  4ORU A;  4AZR A;  5FQ7 E;  3WZN A;  3AEH A;  1CBR A;  2W2F A;  3PK2 A;  3VG4 A;  1Y52 X;  5BVQ A;  1LDO A;  3WOV A;  1BLR A;  4GJS A;  1R0U A;  4A8Z A;  3CMP A;  2FKG A;  5FFH A;  4ORS A;  4QYN A;  1EPB A;  2RCQ A;  2RTD B;  1B0O A;  2HLV A;  3WXQ A;  5LKE A;  1VWQ B;  5F2B A;  3VHI A;  1UYN X;  1DZM A;  1SWQ A;  3JS1 A;  4FGI B;  4Z2P A;  4Z2O A;  1RBP A;  1FEM A;  3P24 A;  5AJB A;  2FHL A;  4ZHG A;  1QY0 A;  1BWY A;  1ML7 A;  1SA8 A;  2JN3 A;  4D6B A;  5JR8 A;  1OPA A;  1S2P A;  3NP1 A;  4L3R A;  1VWG B;  1NGL A;  1DZK A;  4XME A;  3CWK A;  1AB0 A;  5AEO A;  1Z24 A;  2FS7 A;  4O3Z A;  4ORR A;  1T68 X;  4IAB A;  4RUU A;  4EKV A;  4U9C A;  4DQ4 A;  3U03 A;  5K68 A;  4BX5 B;  4TKH A;  3SLO A;  1PMP A;  1KQW A;  1G74 A;  1KT7 A;  2OZQ A;  2NNE A;  3UEW A;  1OEE A;  1VWR B;  3D9W A;  1SWC A;  3L4R A;  1YWC A;  2G8C O;  1LPJ A;  2RTO B;  1LCW A;  2FRS A;  2OVS A;  3BDR A;  1ALB A;  1U18 A;  2X8S A;  4BJ8 A;  3HOL A;  2AVI A;  2JU3 A;  1IIU A;  4A60 A;  1I78 A;  5B2A O;  2QM9 A;  3ELZ A;  3VG5 A;  4HPB A;  4YCE A;  4AZM A;  3CQR A;  2A0A A;  2Q39 A;  3PDF A;  2W2A A;  4I9S A;  4YGZ A;  1E02 A;  2Y3F A;  5DG4 A;  2FT9 A;  1NBX A;  1TOU A;  2RTA A;  4QQ1 A;  4A1H A;  4OMX A;  3WVM A;  4U8U N;  3KVN A;  3KFI A;  1VWB B;  3LV4 A;  3B2K A;  3FEP A;  1ZNG A;  4I3B A;  5HCD C;  1KL3 A;  3LHN A;  1IFB A;  1SMP I;  1CBI A;  2IZH B;  2X55 A;  4CPF A;  3CKG A;  1BEB A;  3VG7 A;  1KZX A;  1OBQ A;  1IJ8 A;  2QCB A;  1SWL A;  1TOW A;  2YMS A;  3FEL A;  3O22 A;  2IZG B;  1BBP A;  4MVI A;  1D3S A;  1SWG A;  2JOZ A;  4YKO A;  5HZQ A;  5LJG A;  1JJU A;  1N9M A;  1JYD A;  3P6F A;  2GJ5 A;  2AH7 X;  3WYP A;  3S5V A;  1DV9 A;  2IZC B;  1W6F A;  2GTF X;  3B2J A;  4XMC A;  3G7X A;  4KH8 A;  5B11 O;  3VU1 A;  5IRA A;  2AT8 X;  1LFO A;  2IZF B;  2CAM A;  1UZ2 X;  4ZH6 A;  2WSJ A;  5KID A;  5CHK A;  1VWM B;  4Z6J A;  5HAE A;  1OBP A;  4LQZ A;  1FE3 A;  1YWB A;  1WUB A;  4QYP A;  4XMF A;  2JU8 A;  1ERX A;  5HTD A;  3MG5 A;  1JJX A;  3APV A;  5IO7 A;  1QWD A;  1LIF A;  3RY2 A;  3ZWE A;  3BU9 A;  2FR2 A;  4ZH9 A;  3UEU A;  5KIC A;  2X32 A;  4YMY A;  2KT4 B;  4INN A;  3RDX A;  4KC8 A;  1LIC A;  1O8V A;  1N4J A;  1RLB E;  1YUP A;  4Y5D A;  3SAO A;  5F7G A;  3APX A;  4ZJ0 A;  4I6S A;  5D4A A;  2A8G A;  2OFA A;  2KTS A;  1JYJ A;  1SY2 A;  1BSO A; 
#chains in the Genus database with same CATH homology
 5FQ8 E;  2K23 A;  4ZGU A;  4O3W A;  3STN A;  3PH5 A;  4GKC A;  3JQO A;  3P6E A;  5IO5 A;  4LKP A;  2QO6 A;  2ACP X;  1QAB E;  5HZ8 A;  5F6Z A;  3TGB A;  3WBG A;  2FWV A;  3DTQ A;  3K3L A;  2HZR A;  1N0S A;  1A18 A;  2ZAI A;  3FLL A;  3HWE A;  3PED A;  4TQ2 A;  3FR5 A;  2CZU A;  2AT5 X;  3B2H A;  4L1N A;  1GM6 A;  1IKE A;  1ADL A;  3FW4 A;  4D6A A;  2A3F X;  4ORY A;  5HZ6 A;  3MVF A;  5LJH A;  5LJB A;  3I0A A;  1QY2 A;  4NYQ A;  5HZ9 A;  1U0X A;  1KXO A;  4GET A;  2NNQ A;  4ZCB A;  4ZGF A;  1OEK A;  2PY1 A;  5H8T A;  5HCE C;  4ML7 B;  2Z4I A;  4OMW A;  4IMN A;  1EQD A;  1IFC A;  2RA6 A;  1URE A;  2RD7 C;  2FS6 A;  4ZHC A;  3CQN A;  3V8U A;  2OFR X;  2A2G A;  1GT1 A;  5EEE A;  2JMB A;  1LNM A;  1ICM A;  1TW4 A;  3NX1 A;  5CYB A;  1JZU A;  3P6D A;  1MDC A;  4O3X B;  2WEW A;  3FA6 A;  3NQK A;  4UU3 A;  4TLJ A;  2W2B A;  1EIO A;  3D4R A;  5HA1 A;  4IBA A;  2L68 A;  5HTE A;  4FBO A;  2L5P A;  4ARH A;  3O2Y A;  3T1D A;  3NR3 A;  5LJC A;  4IAW A;  2MHD A;  1YP6 A;  4U3Q A;  4YGH A;  2KTD A;  4K19 A;  4ZHF A;  3EM0 A;  1S7D A;  1ZNK A;  4AZO A;  4QRL A;  3AKM A;  1GKA B;  3OE3 A;  4YCH A;  3BLG A;  3ZW1 B;  2F73 A;  4I95 A;  4EEJ A;  5DPQ A;  3B2L A;  5D47 A;  4O3Y A;  3VG6 A;  3OD9 A;  2EU7 X;  2X45 A;  3OBL A;  4AZP A;  1I4U A;  3APU A;  2MM3 A;  2CBS A;  1FTP A;  2ZAG A;  4IB7 A;  5FEN A;  5HA0 A;  1TXL A;  1CBQ A;  2WQA E;  3WJD A;  2WR6 A;  3BU1 A;  4QGW A;  4XMH A;  4YH0 A;  3VG3 A;  2A2U A;  2QOS C;  2BHV A;  2BS6 A;  3EBW A;  2LFO A;  3FW5 A;  3F6Z B;  1VPR A;  4NP1 A;  4OS8 A;  3PP6 A;  1S44 A;  2ANS A;  2G79 A;  4TKJ A;  3CBS A;  1ICN A;  3PPT A;  1DZP A;  1B4M A;  2R74 A;  2L9C A;  1T8V A;  3P6G A;  3QKG A;  4GRJ A;  3WJF A;  1CRB A;  1E00 A;  1GT5 A;  4XMD A;  2RQ0 A;  1EPA A;  4I3D A;  5IO6 A;  4ON1 A;  3CR6 A;  1I04 A;  1LIE A;  2E4J A;  3VG2 A;  3ZW0 B;  3FMZ A;  5L8N A;  4MIS A;  1CBS A;  3BS2 A;  1E5P A;  1ACD A;  3S26 A;  2FLJ A;  1X8P A;  5HWZ A;  3KFG A;  4EXZ A;  1QY1 A;  3GE2 A;  3NX2 A;  4FBR A;  3ZW0 A;  3Q6L A;  2WEX A;  1HMT A;  3WJG A;  1G7N A;  2N93 A;  1GX9 A;  2NP1 A;  3FA9 A;  2Q4N A;  2WUT A;  2RN4 A;  4IMO A;  1JIW I;  4EQA C;  3MX7 A;  1DZJ A;  4N7C A;  1LF7 A;  1QQS A;  3HK1 A;  1YWD A;  2Q2P A;  4KII A;  2MO5 A;  3PQS A;  2Q9S A;  3TGA A;  4ODD A;  5D48 A;  2RCT A;  3EMM A;  4BOE A;  2ALL X;  1X89 A;  3AKN A;  4YDA A;  3ZQ3 A;  1EXS A;  5EDC A;  1KQX A;  1NP1 A;  5AQ6 A;  1H91 A;  3HOE A;  3C77 X;  2R56 A;  3ZUO A;  3D95 A;  2CM9 A;  3HWD A;  2X8T A;  3KZA A;  3MBT A;  1O1V A;  4YFQ A;  3PQU A;  1VYG A;  1BSQ A;  1T0V A;  5AJC A;  3VE1 A;  3BY0 A;  2F09 A;  4O4U A;  3C78 X;  5EDB A;  4KCA A;  2ASN X;  1O1U A;  3TF6 A;  3FR2 A;  4NNT A;  2LA7 A;  1MVG A;  3RSW A;  5CE4 A;  5FQ6 E;  2CZT A;  4CV7 A;  5B29 A;  5F1E A;  5H9L A;  4YBU A;  4JGL A;  4IB9 A;  3I17 A;  5LJE A;  1A57 A;  2MJI A;  3S60 A;  1I06 A;  2WQ9 A;  4I3C A;  3WJE A;  4ES7 A;  2AT3 X;  1U17 A;  3NBX X;  2LKK A;  4QNI A;  1HMS A;  3KFH A;  4YKM A;  2XKL A;  5BYP A;  3ZUI A;  2GTL M;  4NW4 A;  5FAZ A;  2QMI A;  3FR4 A;  3O19 A;  4ORX A;  3JSQ A;  3DSZ A;  3IFB A;  1CJ5 A;  3F8A A;  1A3Y A;  1AVG I;  5H9K A;  3U9P C;  4GZV A;  1KT6 A;  4AW8 A;  4AZQ A;  1YP7 A;  3KQ0 A;  4ZFX A;  3WJB A;  3H3I A;  1FEN A;  1XCA A;  2HNX A;  4HPD A;  4KT5 A;  3ZI8 A;  4A60 A;  1YWA A;  4O4X A;  3SOT A;  4YFR A;  5HZ5 A;  5F6B A;  3EYC A;  2X8F A;  4BQU A;  1E06 A;  4GNY A;  4O9S A;  3UEV A;  3RKG A;  4Y0S A;  1MX7 A;  2AMM X;  3KFF A;  1PBO A;  1BSY A;  1HBP A;  3ZW2 A;  2Q2M A;  4BVM A;  3E3C A;  2LB6 A;  1JBH A;  3NPO A;  4M6S A;  2QO4 A;  2GC9 A;  1GKA A;  1JV4 A;  2AKQ A;  3ZW1 A;  3STK A;  1GT4 A;  2BS5 A;  4O4S A;  1BM5 A;  3HWF A;  4QGX A;  2A13 A;  3UAQ A;  5L8O A;  4TKB A;  1ZNE A;  4ID2 A;  4NLJ A;  5BVT A;  3FA8 A;  1VYF A;  4EDE A;  1X71 A;  2Z4H A;  1AEL A;  1YIV A;  4EFG A;  5BVS A;  4YFP A;  1LID A;  4UU2 A;  3CBC A;  4HFO A;  2CBR A;  3WJC A;  1P6P A;  1XKI A;  1DFV A;  4MVE A;  1SY1 A;  5EPQ A;  5LJD A;  3S5X A;  2G78 A;  2LBA A;  4WFV A;  1Y9L A;  4OS3 A;  3BSZ E;  2K62 A;  4OS0 A;  4IAX A;  4NNS A;  1SXU A;  3NQ3 A;  5H9N A;  3FEN A;  1X8O A;  2KW1 A;  2OVE A;  2OVD A;  1AQB A;  1ERB A;  1HMR A;  4GDZ A;  3NAD A;  1BRQ A;  3P6H A;  3UEX A;  4NLI A;  2XST A;  2GTL O;  1B8E A;  2ACO A;  4Y0P A;  2BLG A;  1HBQ A;  4GE1 A;  3FYF A;  5C0N A;  2DM5 A;  2AT0 X;  1KT5 A;  1A2D A;  1OBU A;  1QG5 A;  3RBY A;  5KHP A;  1OPB A;  4I9R A;  1IW2 A;  1GGL A;  4RUN A;  1MUP A;  1GX8 A;  1DC9 A;  1EAL A;  4ORW A;  2X46 A;  2WWP A;  4TNN A;  2NND A;  3BX8 A;  4O4O A;  4R0B A;  1BJ7 A;  4QAE A;  3P6C A;  5L8I A;  4AYH A;  3HTY A;  4IB6 A;  2P8G A;  2HMB A;  1MX8 A;  1SXW A;  1X8U A;  4PJ2 A;  4KC7 A;  1EI5 A;  4GNW A;  1KGL A;  2L67 A;  1QFT A;  4N7D A;  3PH6 A;  4YDB A;  3D97 A;  4IB8 A;  3FIQ A;  1KT3 A;  4CK4 A;  2OFM X;  1EW3 A;  2KD2 A;  4GH7 A;  1KZW A;  1G5W A;  3ZZV A;  2G7B A;  2OVA A;  4ZHH A;  4Y0Q A;  3U0D A;  5K06 A;  4Y0R A;  4AZN A;  3GAQ A;  2HZQ A;  2GTL N;  3N91 A;  4YGG A;  2YG2 A;  5H9A A;  4ALO A;  4MVL A;  4M7M A;  4U8U M;  2R73 A;  1IKJ A;  2BT9 A;  2AT6 X;  1G85 A;  3BX7 A;  3HWG A;  4A1Y A;  3OJY C;  3PEC A;  1PM1 X;  3B2I A;  1FEL A;  5LJK A;  4HPA A;  1X8Q A;  4FQB B;  1TVQ A;  1KOI A;  4ALB A;  3VE2 A;  1LIB A;  4HWM A;  4LZV A;  1I05 A;  1SY0 A;  2MWH A;  3FEK A;  4XMG A;  3VPJ E;  3BRN A;  2FR3 A;  1JJJ A;  4CSB A;  3APW A;  4LKT A;  1ZRY A;  1QFV A;  1HN2 A;  1L6M A;  4GK9 A;  4WFU A;  2JW1 A;  4LZU A;  4NYR A;  5D8J A;  1ZND A;  5F58 A;  1GT3 A;  4COT A;  5HCC C;  4QZT A;  1EII A;  1LKE A;  3FA7 A;  4PSQ A;  3EBK A;  4WHI A;  2IFB A;  1EUO A;  4ZHD A;  4HPC A;  3IA8 A;  3STM X;  4ZR2 A;  3TGC A;  2POA A;  1ZNH A;  2HYS A;  4O49 A;  3TZS A;  2QO5 A;  5EED A;  4DQ3 A;  4FBV A;  1DF3 A;  2O62 A;  1X8N A;  2FTB A;  4TJZ A;  3RZY A;  1ZNL A;  1NP4 A;  5EZ2 A;  1BRP A;  1D2U A;  1GXA A;  5B27 A;  3F9D A;  3P02 A;  3C76 X;  4YBP A;  3ELX A;  5D45 A;  4MIR A;  1B56 A;  2CM4 A;  2M4L A;  2AL0 X;  1OEJ A;  2LBV A;  4QGV A;  4GU8 A;  3D96 A;  1KT4 A;  1SXY A;  1SY3 A;  3NQ9 A;  4QZU A;  1FDQ A;  4U8U O;  1Y9T A;  4MVK A;  4WBK A;  1PEE A;  5HBS A;  2JU7 A;  1HQP A;  5LKF A;  1SXX A;  4ORU A;  4AZR A;  5FQ7 E;  1CBR A;  2W2F A;  3VG4 A;  5BVQ A;  3WOV A;  1BLR A;  1R0U A;  4A8Z A;  3CMP A;  5FFH A;  4ORS A;  4QYN A;  1EPB A;  2RCQ A;  1B0O A;  2HLV A;  3WXQ A;  5LKE A;  1DZM A;  3JS1 A;  4FGI B;  1RBP A;  1FEM A;  3P24 A;  5AJB A;  4ZHG A;  1BWY A;  1QY0 A;  1ML7 A;  1SA8 A;  2JN3 A;  4D6B A;  5JR8 A;  1OPA A;  1S2P A;  3NP1 A;  4L3R A;  1NGL A;  1DZK A;  4XME A;  3CWK A;  1AB0 A;  5AEO A;  1Z24 A;  2FS7 A;  4O3Z A;  4ORR A;  1T68 X;  4IAB A;  4RUU A;  4U9C A;  4DQ4 A;  3U03 A;  4TKH A;  1PMP A;  1KQW A;  1G74 A;  1KT7 A;  2OZQ A;  2NNE A;  3UEW A;  1OEE A;  3L4R A;  1YWC A;  3RWX A;  1LPJ A;  3BDR A;  2FRS A;  2OVS A;  1ALB A;  1U18 A;  2X8S A;  3HOL A;  2JU3 A;  1IIU A;  2QM9 A;  3ELZ A;  3VG5 A;  4HPB A;  4YCE A;  4AZM A;  3CQR A;  2A0A A;  2Q39 A;  2W2A A;  4I9S A;  4YGZ A;  1E02 A;  5DG4 A;  2FT9 A;  1TOU A;  4A1H A;  4QQ1 A;  4OMX A;  3WVM A;  4U8U N;  3KFI A;  3LV4 A;  3B2K A;  3FEP A;  1ZNG A;  4I3B A;  5HCD C;  3LHN A;  1IFB A;  1SMP I;  1CBI A;  1BEB A;  3VG7 A;  1KZX A;  1OBQ A;  2YMS A;  3FEL A;  1TOW A;  3O22 A;  4MVI A;  1BBP A;  1D3S A;  2JOZ A;  4YKO A;  5HZQ A;  5LJG A;  1JYD A;  3P6F A;  2GJ5 A;  2AH7 X;  3S5V A;  1DV9 A;  2GTF X;  3B2J A;  4XMC A;  3G7X A;  4KH8 A;  3VU1 A;  2AT8 X;  1LFO A;  1UZ2 X;  4ZH6 A;  2WSJ A;  5KID A;  5HAE A;  1OBP A;  4LQZ A;  1FE3 A;  1YWB A;  4QYP A;  4XMF A;  2JU8 A;  1ERX A;  5HTD A;  1JJX A;  3APV A;  5IO7 A;  1QWD A;  1LIF A;  3ZWE A;  3BU9 A;  2FR2 A;  4ZH9 A;  3UEU A;  5KIC A;  4YMY A;  2KT4 B;  4INN A;  4KC8 A;  1LIC A;  1O8V A;  1RLB E;  1YUP A;  3SAO A;  5F7G A;  3APX A;  4ZJ0 A;  4I6S A;  5D4A A;  2KTS A;  1JYJ A;  1SY2 A;  1BSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...