1JJXA

Solution structure of recombinant human brain-type fatty acid binding protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
131
structure length
131
Chain Sequence
VEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords BRAIN-TYPE FATTY ACID BINDING PROTEIN
publication title Solution structure of fatty acid-binding protein from human brain.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2001-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1jjxA00
4AZPA 3AKNA 3STMX 2ACOA 1ZNHA 4QGXA 2AT0X 1CBIA 2AT3X 3HWEA 1ICMA 4DQ4A 1DF3A 1AELA 4IBAA 1CBRA 2FR3A 3BX8A 2FRSA 1E5PA 4GETA 1XKIA 3TGBA 2X46A 3FENA 1X8OA 3BX7A 1KGLA 3FR2A 5KHPA 4GE1A 3FEKA 1KZWA 1JV4A 2WR6A 3VG5A 1BSQA 1LIEA 2QO4A 4ES7A 4ORWA 3NR3A 4YKOA 4D6BA 1JYDA 5HZ6A 4IAXA 1L6MA 3STNA 5LKFA 4K19A 3BRNA 1YWCA 4I9RA 3VG6A 3RZYA 1BWYA 2OVDA 2EU7X 1PM1X 4ARHA 1JJJA 5EDBA 2QM9A 3FEPA 1ERXA 5KICA 1AVGI 1SY3A 3FW4A 1RBPA 1BRPA 2AT8X 4QAEA 4NP1A 4TJZA 4Y0SA 5EDCA 4A1HA 1O8VA 1OEJA 1X71A 3D97A 2PY1A 3I17A 3FLLA 3D95A 2ASNX 1GT5A 4AZNA 2WQ9A 3NX1A 3B2KA 1HQPA 5F58A 2R73A 1YIVA 4YDAA 3FR5A 4A8ZA 3CBSA 2A0AA 2Q4NA 2LBVA 1SA8A 3BSZE 4IB9A 2W2AA 2CBRA 3PECA 4OS8A 3WJEA 5B29A 1TVQA 1GT3A 4GNWA 4ZHHA 2FTBA 3K3LA 1OBPA 5HAEA 4AZOA 5FFHA 2X45A 3NQ3A 1IKEA 1E02A 1PEEA 4M6SA 3UEUA 1H91A 2E4JA 2OFMX 2HLVA 1BSOA 1LF7A 2A13A 3FA9A 4IAWA 4YCHA 4ORSA 3P6EA 1SY1A 2W2BA 1QY1A 1X8PA 3G7XA 1ZNEA 1VYGA 2A2UA 1UZ2X 2P8GA 2WWPA 3B2IA 4M7MA 4ALBA 5HZ5A 1NP4A 4OMWA 3HK1A 5HA1A 5L8NA 1KQXA 1LIFA 4WBKA 4D6AA 1X8QA 1O1UA 4AW8A 3CR6A 2RA6A 4YFRA 1O1VA 3HWDA 2ACPX 1B0OA 1T0VA 4OMXA 3EYCA 4QGWA 1TOWA 4N7DA 4GH7A 3F8AA 2R74A 1BJ7A 1G85A 4YGHA 4YCEA 1ZNDA 4AZRA 3HWGA 5HTDA 1SXXA 1SY0A 3IFBA 2HZQA 5HZQA 3KFFA 1QWDA 3WJGA 4GRJA 2Q39A 2L67A 4YDBA 3P6GA 1EXSA 1YP6A 4OS0A 5DG4A 3DSZA 1S7DA 5L8OA 1UREA 5HTEA 2MO5A 3APXA 2HZRA 1EUOA 1A3YA 5HCEC 1DZJA 4ALOA 1NP1A 1E06A 1OBQA 1ZNGA 5F7GA 1X8UA 1YP7A 3KZAA 2GJ5A 5BVSA 1LNMA 1U17A 3WJFA 1EIOA 2RD7C 5BVQA 1VYFA 4Y0RA 5LJGA 4NNTA 2XKLA 3KFIA 2RQ0A 1LFOA 1VPRA 4MVIA 4Y0QA 3JSQA 3EMMA 3WJCA 2G79A 3WVMA 1N0SA 1KXOA 1QY2A 1AQBA 1BM5A 4NLJA 2QO6A 2ANSA 3ZUIA 5EZ2A 3O2YA 4NYQA 5D47A 1CRBA 4ORXA 4YMYA 2Q2PA 4ZH9A 1HMRA 2Q2MA 4KIIA 1QFVA 3TGAA 4NYRA 5H9AA 2NP1A 3F9DA 3PH5A 1IIUA 2DM5A 3S26A 4YFPA 5IO6A 2CM9A 1IFCA 4HPDA 5H8TA 1D3SA 3B2LA 1A57A 2L9CA 2WEWA 4RUNA 1R0UA 3BY0A 3P6CA 3SAOA 4TKBA 2F73A 5DPQA 3OJYC 4ORYA 5F6BA 3U03A 5L8IA 5LJCA 3B2HA 1A2DA 1KT4A 4I9SA 1TOUA 3FELA 4ZGUA 1T8VA 5FAZA 4A1YA 1S44A 2YG2A 3KFGA 2FS6A 3EBWA 4YBUA 3TF6A 5C0NA 1DZPA 1GT4A 2K23A 2XSTA 4AZQA 4YGGA 3WJDA 1ICNA 4XMGA 1YWBA 4ORRA 5KIDA 4EDEA 2FS7A 4BVMA 5LJBA 2RCTA 4HFOA 4NLIA 1XCAA 4YGZA 3P6DA 1QG5A 1T68X 4ZR2A 1DZKA 3D96A 1X89A 4GKCA 4MVLA 3VG2A 4WFUA 5FENA 1OEEA 4LZVA 3UEVA 2JU3A 1DZMA 3KFHA 5LJDA 4UU2A 4HPBA 4CK4A 1YWDA 1ADLA 1SXUA 2JOZA 4TQ2A 2WUTA 4GNYA 1YWAA 2FWVA 4QGVA 1QABE 3VG7A 4BQUA 2OZQA 4DQ3A 4XMDA 4BOEA 1AB0A 2WQAE 2L5PA 4TKHA 1OPAA 3PEDA 1CJ5A 5HZ8A 2CM4A 4I3DA 1EIIA 5D8JA 1KZXA 1OEKA 2AT5X 1U18A 1OPBA 1PBOA 1GGLA 1FEMA 2OFRX 1S2PA 4TLJA 1DC9A 3O19A 4O9SA 4RUUA 4IB6A 2LB6A 1FDQA 3NQ9A 3STKA 3CWKA 4QZTA 1KQWA 3EBKA 5EPQA 1I4UA 1GXAA 1ML7A 1PMPA 1JZUA 2LKKA 2GC9A 1HN2A 1Z24A 4IMNA 1JBHA 4YH0A 3DTQA 3I0AA 1MUPA 1ACDA 4A60A 2R56A 3BLGA 3MBTA 3ZUOA 3CQNA 4ZCBA 1TXLA 3FMZA 4Y0PA 3FA8A 5IO5A 1GX9A 2KT4B 1MVGA 4XMCA 1ALBA 2KTDA 4HPCA 4YBPA 5BVTA 1JYJA 1QFTA 5LJEA 2HYSA 2CZTA 1E00A 2OVAA 5JR8A 1FE3A 1GKAA 1RLBE 2W2FA 2JU7A 2G78A 1GT1A 2JN3A 2O62A 1X8NA 3NADA 1D2UA 3KQ0A 1GKAB 4QYNA 1IKJA 4IB8A 5D4AA 1BSYA 2WEXA 1BLRA 3PPTA 4ZFXA 1SXYA 3BS2A 1GX8A 4MVKA 3Q6LA 3APUA 1ZNKA 2NNEA 4I3BA 4ZH6A 2FR2A 3RSWA 3WBGA 2LFOA 1FENA 4ZJ0A 2L68A 2BLGA 3L4RA 4OS3A 4EXZA 4UU3A 4ODDA 1KT3A 1DFVA 3BU9A 5IO7A 3ELXA 1EALA 2CBSA 1HMSA 3APVA 2Q9SA 3UEWA 4LKTA 1QY0A 4QYPA 4XMHA 1FELA 3PP6A 3HWFA 3C77X 5D45A 1LIBA 1KT5A 1MX8A 3AKMA 1JJXA 4PSQA 4LZUA 3T1DA 1CBSA 1U0XA 2LBAA 3CQRA 4QZUA 2AT6X 4ZHFA 1GM6A 4IMOA 4ZHDA 1TW4A 5H9NA 4NNSA 2QOSC 1I06A 1NGLA 4ZHGA 5B27A 3U0DA 4EFGA 5LJKA 5HA0A 2NNQA 1LICA 5D48A 1KT6A 2JU8A 3IA8A 3P6FA 2AH7X 1DV9A 4IB7A 2A2GA 2IFBA 4HPAA 4EEJA 2MM3A 2GTFX 4TNNA 2N93A 1IW2A 2K62A 4XMFA 1HBPA 2MJIA 1ZNLA 2HNXA 5HZ9A 2AL0X 2ALLX 4YKMA 3BDRA 5CE4A 3ELZA 4I3CA 1BBPA 4ZHCA 1MDCA 3APWA 3FW5A 3O22A 3PH6A 5F1EA 5HWZA 5HCDC 1B8EA 2AKQA 1YUPA 1QQSA 5HCCC 1HBQA 4AZMA 5H9KA 3ZQ3A 1SY2A 4ORUA 1ZRYA 4WFVA 1P6PA 1BEBA 5EEEA 1IFBA 4R0BA 1KT7A 1G5WA 1KOIA 3BU1A 2NNDA 3VG3A 1HMTA 1EQDA 3WJBA 3U9PC 1LIDA 1G74A 1MX7A 3NP1A 3NX2A 1FTPA 3B2JA 1LKEA 2RCQA 1I04A 2A3FX 3CBCA 3FA6A 3JS1A 1I05A 3FIQA 3C76X 3NPOA 5EEDA 4AYHA 4N7CA 2FLJA 1SXWA 1ERBA 2HMBA 5H9LA 3FR4A 2FT9A 1BRQA 4XMEA 1EPBA 1CBQA 5LKEA 5F6ZA 1G7NA 1B4MA 2QO5A 3TGCA 3WXQA 2WSJA 2AMMX 2CZUA 3C78X 3FA7A 2G7BA 1EPAA 1A18A 5LJHA 1EW3A 1OBUA 3GAQA 5AQ6A 3EM0A 4TKJA 1LPJA 3VG4A 5K06A 3TZSA 3P6HA 4LKPA 3QKGA 2POAA 3UEXA 3MVFA 5HBSA 3CMPA 1B56A 2OVEA 4YFQA
chains in the Genus database with same CATH superfamily
4AZPA 3AKNA 4Z27A 4OELA 1SWCA 1W6FA 2ACOA 1ZNHA 4QGXA 2AT0X 3D4RA 3STMX 3AEHA 1CBIA 2CAMA 2AT3X 3HWEA 1ICMA 4DQ4A 1DF3A 1SWJA 1AELA 4IBAA 1CBRA 2FR3A 3BX8A 2FRSA 2IZBA 1E5PA 4GETA 3V8UA 1XKIA 3TGBA 3T2XA 2X46A 2RTFB 3FENA 1X8OA 3BX7A 1KGLA 2GTLO 3FR2A 5KHPA 4COTA 4O3YA 4FBVA 4GE1A 1SWFA 3FEKA 3NQKA 4O4XA 3VPJE 1JV4A 2WR6A 2Y3FA 3VG5A 1KZWA 3CKFA 1BSQA 1LIEA 2QO4A 2OFAA 3T2WA 4ORWA 3NR3A 4U3QA 4ES7A 4BBOA 4FBRA 1N7YA 4YKOA 1Y52X 1JYDA 4D6BA 4IAXA 1L6MA 5HZ6A 2RTGB 5B3MO 5LKFA 4K19A 3STNA 1VWFB 4BX5A 2F09A 3BRNA 1YWCA 4I9RA 4I95A 3VG6A 3RZYA 1BWYA 4C5PA 2OVDA 3MX7A 2EU7X 2QMIA 1PM1X 2A5CA 3RBYA 4ARHA 3RDQA 3VHIA 4BX5B 3P02A 1JJJA 1LUQA 5EDBA 2QM9A 3FEPA 1ERXA 5KICA 1AVGI 1SY3A 2RTKA 3LHNA 3FW4A 3VHMA 1RBPA 1BRPA 2AT8X 4QAEA 2AF5A 4NP1A 4TJZA 4Y0SA 5EDCA 4A1HA 1O8VA 1OEJA 2GTLN 1X71A 3D97A 2C4IA 1SWOA 2PY1A 3I17A 3FLLA 1KL3A 2HKDA 3D95A 2ASNX 2C1QA 1GT5A 4FQBB 1NQMA 2WQ9A 3B2KA 3NX1A 1HQPA 5F58A 4AZNA 2R73A 1YIVA 4YDAA 4HWMA 3FR5A 2PI3O 3CBSA 2A0AA 1MOYA 2RTRB 3RWXA 4A8ZA 2Q4NA 2LBVA 1SA8A 2IZAA 3BSZE 2W2AA 2CBRA 4IB9A 4WHIA 3PECA 1SWSA 3HPEA 4OS8A 3WJEA 4Y59A 4IABA 5B29A 4PJ2A 1TVQA 1GT3A 2JMBA 4GNWA 4ZHHA 2FTBA 2RN4A 3K3LA 1OBPA 5HAEA 4AZOA 5B2AO 5FFHA 4I6SA 2IZDB 2X45A 2RTQB 2OL8O 1KL5A 3NQ3A 1IKEA 3OE3A 1E02A 1PEEA 4M6SA 3UEUA 4O4OA 1H91A 2E4JA 2HLVA 2OFMX 1BSOA 1LF7A 2A13A 3FA9A 1FJ1E 4FBOA 1VWDB 4YCHA 4ORSA 4U8UN 5IRUA 3P6EA 1E2TA 1SY1A 2W2BA 1QY1A 4JO6A 1X8PA 2QCBA 3G7XA 1ZNEA 4EKVA 1IJ8A 1VYGA 2A2UA 1UZ2X 4U8UM 3ZZVA 3WOVA 1SRHA 2P8GA 4LQZA 5HBSA 4CPIA 2WWPA 3SOTA 3LV4A 3B2IA 4M7MA 4ALBA 1SLFB 1SWDA 5HZ5A 1NP4A 4OMWA 3HK1A 5HA1A 5L8NA 3OD9A 1KQXA 3ZI8A 1LIFA 4WBKA 1N9MA 3MG5A 3S5VA 4D6AA 1JJUA 2BS5A 3WYQA 2ZAIA 1X8QA 1O1UA 3HOEA 3CR6A 2RA6A 4AW8A 1SWNA 4YFRA 1O1VA 3HWDA 2ACPX 1B0OA 1T0VA 4GU8A 4OMXA 1AVDA 3EYCA 4CPFA 4QGWA 1VWMB 4CDFA 1TOWA 2X32A 4N7DA 4GH7A 3F8AA 1BJ7A 1G85A 2R74A 4YGHA 4YCEA 1ZNDA 1VWJB 4AZRA 4BX6A 5IXGA 3HWGA 4GZVA 5HTDA 3RE6A 4BX6B 1SXXA 1SY0A 4Z28A 3IFBA 4CDCA 2JGSA 1JMXA 5B5FA 2M4LA 2HZQA 1LDQA 5HZQA 3KFFA 1QWDA 1SWEA 3WJGA 4GRJA 2Q39A 2DJFA 1SLEB 2A5BA 2L67A 3T6FA 3PQUA 3P6GA 4YDBA 2LA7A 3SLOA 3VE2A 1EXSA 1YP6A 4OS0A 5DG4A 3SZIA 3DSZA 1S7DA 4GGZA 5L8OA 1UREA 5HTEA 3Q34A 3WZOA 5AEOA 1SRIA 2MO5A 4Y5DA 3APXA 3S5XA 2HZRA 2X8TA 4L3RA 1HXLA 1EUOA 4I60A 1A3YA 5HCEC 1DZJA 4ALOA 1NP1A 2OFBA 1E06A 4OEMA 4KC7A 1OBQA 1ZNGA 5F7GA 1X8UA 1I78A 1YP7A 2GJ5A 3KZAA 5BVSA 1LNMA 1U17A 1DF8A 3WJFA 1SWHA 1LDOA 3KVNA 1EIOA 2RD7C 4GGRA 5BVQA 1VYFA 4Y0RA 5LJGA 4NNTA 2XKLA 3KFIA 1N9YA 2RQ0A 1LFOA 1VPRA 1NQNA 4MVIA 4Y0QA 3JSQA 3PK2A 3EMMA 2QOMA 2G79A 3WJCA 1N0SA 3WVMA 1KXOA 1QY2A 1AQBA 1BM5A 4NLJA 5FQ7E 2QO6A 2IZLB 1SREA 2ANSA 3ZUIA 4O4UA 5CHKA 4OKAA 5EZ2A 2BSZA 4Z2VA 2BT9A 3O2YA 4NV7A 4NYQA 5D47A 1CRBA 1NC9A 2Z4HA 4ORXA 1UYOX 5B10O 4YMYA 2Q2PA 4ZH9A 2I5ZO 1HMRA 2Q2MA 4KIIA 1QFVA 3TGAA 4NYRA 5H9AA 2NP1A 2ZAGA 3F9DA 1IIUA 2DM5A 3PH5A 4YFPA 3RY2A 3S26A 2X4MA 4MISA 2OL7A 5IO6A 4O3WA 2CM9A 1VWEB 1IFCA 2A8GA 4HPDA 5H8TA 1D3SA 3B2LA 4MIRA 2L9CA 2WEWA 1SWTA 1A57A 3VE1A 4RUNA 4QQ1A 1VWIB 1R0UA 4MVEA 2RTHB 3BY0A 3ZW2A 3P6CA 1VWLB 3SAOA 4TKBA 2DJGA 2F73A 5DPQA 4QRLA 2KTSA 1JIWI 3OJYC 4GDAA 4ORYA 5JD2A 5F6BA 4U8UO 1SWBA 2MHDA 3VHHA 3JQOA 5L8IA 1SRGA 3B2HA 1A2DA 5LJCA 1KT4A 1VWRB 1TOUA 1WBIA 3FELA 4I9SA 3U03A 3SLTA 4ZGUA 1T8VA 2X56A 5FAZA 4A1YA 1S44A 1RXHA 2IZJA 2YG2A 3KFGA 2FS6A 3EBWA 3RDSA 4YBUA 3TF6A 5C0NA 1DZPA 1N4JA 1GT4A 2OF8A 3ZW0A 2K23A 2JW1A 2XSTA 3WZQA 4JNJA 4AZQA 1VWAB 2BC3A 2RTOB 1KFFA 4CPHB 3CKGA 4YGGA 2I5VO 3WJDA 3ZW0B 2KW1A 4B55A 1ICNA 4XMGA 1YWBA 1HXZA 4ORRA 3SZJA 1VWQB 5KIDA 4EDEA 2FS7A 4BVMA 5LJBA 2RCTA 4HFOA 3RE5A 4NLIA 1XCAA 4YGZA 1RXJA 3P6DA 1QG5A 1T68X 4ZR2A 2RTPB 3AUMO 1DZKA 3D96A 1X89A 4GKCA 4MVLA 3S60A 3VG2A 2VFCA 3QQ2A 4WFUA 5BYPA 1OEEA 5FENA 4LZVA 1PBYA 2BS6A 2JU3A 3UEVA 1DZMA 1PTSA 2Z4IA 3KFHA 4UU2A 5LJDA 1Y55X 4HPBA 4CK4A 1VWCB 1YWDA 1ADLA 1SXUA 2JOZA 4TQ2A 2WUTA 4GNYA 5IRAA 1YWAA 2FWVA 4QGVA 1QABE 3VG7A 4BQUA 2OZQA 5B11O 4DQ3A 4XMDA 4BOEA 1SLDB 4CDEA 1AB0A 2G8CO 2WQAE 3MM0A 2L5PA 1SRFA 1OPAA 3PEDA 4TKHA 2OY5O 4CPEA 5HZ8A 1CJ5A 2CM4A 4I3DA 1EIIA 1MK5A 5D8JA 3FIDA 1KZXA 1OEKA 2AT5X 1U18A 1OPBA 2X8FA 1PBOA 1GGLA 4GK9A 1FEMA 2OFRX 5B5GA 2OL6O 1S2PA 1Y0GA 2RTNB 4TLJA 1OSPO 1DC9A 3O19A 2YMSA 1UYNX 4O9SA 4RUUA 4IAWA 4IB6A 1MM9A 2LB6A 1FDQA 3NQ9A 3STKA 3CWKA 4QZTA 1KQWA 3EBKA 5EPQA 5L3YA 2RTAA 1I4UA 1GXAA 1ML7A 1PMPA 4GDZA 1JZUA 1Y9TA 2LKKA 2GC9A 3EC5A 1HN2A 1Z24A 2RTCB 4IMNA 1JBHA 3F6ZB 4YH0A 3DTQA 2OY8A 4ZGFA 3I0AA 1MUPA 4NW4A 1ACDA 4A60A 2R56A 3BLGA 3MBTA 4JHQA 3ZUOA 3CQNA 3N91A 4ZCBA 1TXLA 3FMZA 4Y0PA 4CSBA 3FA8A 4EQAC 5AJCA 5IO5A 1GX9A 2KT4B 1MVGA 4XMCA 4Z2PA 1HY2A 1ALBA 2KTDA 4HPCA 4YBPA 2RTLA 3E3CA 1JYJA 1QFTA 5CYBA 5BVTA 3RDOA 5LJEA 3HOLA 4CDDA 2OF9A 1SWAA 2HYSA 2CZTA 4KH8A 4YVBA 1RAVA 1E00A 2F01A 2OVAA 1FE3A 1GKAA 4Z2OA 5JR8A 1RLBE 2VFBA 2W2FA 2JU7A 2G78A 1GT1A 2JN3A 2O62A 1GX3A 1SWUA 1X8NA 2OVSA 3NADA 1STRB 2ZSCA 3T6LA 1D2UA 1MEPA 3SLJA 3KQ0A 1GKAB 4MEEA 3WZNA 1VWPB 1IKJA 4QYNA 4IB8A 5D4AA 5FQ6E 4ML7B 1SWRA 1BSYA 1LELA 2IZIA 2WEXA 4KT5A 3ZW1A 4BGFA 1HQQA 1BLRA 1RSUB 2RTIB 3PPTA 3X00A 4ZFXA 1SXYA 3BS2A 1GX8A 4MVKA 3ZW1B 4FGIB 3Q6LA 3APUA 4JGLA 1ZNKA 2NNEA 2X34A 4I3BA 2FR2A 4ZH6A 3RSWA 2LFOA 1FENA 3WBGA 4ZJ0A 2BHVA 4DCBA 3ZWEA 3WZPA 2L68A 2BLGA 3L4RA 4OS3A 2MWHA 4EXZA 4UU3A 4ODDA 1KT3A 4NV8A 1DFVA 3BU9A 4GJVA 4U46A 3RDXA 5IO7A 3ELXA 5K68A 1I9HA 4DNEA 1EALA 2CBSA 1HMSA 2FKGA 3APVA 2Q9SA 2G5LA 1SRJA 3UEWA 4LKTA 4BCSA 5CE4A 1QY0A 4QYPA 4XMHA 2UYWA 4ID2A 1FELA 3PP6A 1STSB 3HWFA 3C77X 5D45A 1LIBA 4Z6JA 1KT5A 1MX8A 2GH7A 3AKMA 2Y32A 4PSQA 3FDCA 1JJXA 4LZUA 2OYBO 1CBSA 1U0XA 2LBAA 3CQRA 4QZUA 3T1DA 2AT6X 4ZHFA 1GM6A 1W5RA 4IMOA 4ZHDA 1TW4A 4CPHA 1K3BA 1SWKA 2FKJA 4O3ZA 1NBXA 4NNSA 2QOSC 5H9NA 1I06A 1NGLA 1VWNB 2IZFB 5B27A 4ZHGA 2OY1O 4EFGA 3U0DA 5LJKA 5HA0A 1VWKB 1VWGB 1LCVA 3PDFA 2NNQA 1LICA 5D48A 1KT6A 2JU8A 3IA8A 2GTLM 2RTDB 3P6FA 2AH7X 1DV9A 2IZCB 4IB7A 2FHLA 2A2GA 2IFBA 4HPAA 4EEJA 1VWOB 2GTFX 2MM3A 2X8SA 4TNNA 1SWLA 2N93A 3PQSA 1IW2A 4L1NA 2UZ2A 2K62A 4KC8A 1N43A 2FGSA 3SZHA 4BX7A 4XMFA 1LCWA 4GGTA 4U9CA 1HBPA 2MJIA 1ZNLA 2WPUA 2HNXA 2IZKA 5HZ9A 4O49A 2AL0X 2IZEB 2ALLX 4YKMA 2X55A 3BDRA 4BX7B 4GJSA 1VYOA 3ELZA 1BBPA 4I3CA 4ZHCA 1MDCA 5K67A 3APWA 3FW5A 5AJBA 3O22A 3PH6A 5F1EA 5HWZA 1K24A 5HCDC 1B8EA 2AKQA 3HTYA 3VU1A 1YUPA 1QQSA 1RXKA 5HCCC 1HBQA 4AZMA 2RTBB 2RTMA 5H9KA 3ZQ3A 1SY2A 1JQPA 1ZRYA 1SWGA 4ORUA 4WFVA 1P6PA 1LCZA 1BEBA 3RY1A 5EEEA 1IFBA 1STPA 4R0BA 1KT7A 1G5WA 1KOIA 2VDFA 3BU1A 2RTJA 2AVIA 2NNDA 3VG3A 1HMTA 4GD9A 2Y3EA 1NDJA 5FQ8E 1EQDA 1SMPI 3WJBA 4ON1A 3U9PC 1LIDA 1G74A 1MX7A 2KD2A 3NP1A 3NX2A 3RDUA 1FTPA 3WYPA 4BJ8A 3B2JA 1LKEA 2RCQA 1I04A 2A3FX 3CBCA 3FA6A 1SWQA 3JS1A 3RKGA 3RDMA 3H3IA 1I05A 3FIQA 2FHNX 3C76X 3NPOA 5EEDA 4AYHA 4N7CA 2FLJA 1SXWA 1ERBA 2HMBA 4GUZA 5H9LA 3GE2A 2IZGB 3EW2A 2IZHB 1RSTB 3FR4A 2FT9A 4O4SA 1VWBB 1BRQA 4XMEA 1EPBA 1CBQA 1Y9LA 5LKEA 2C1SA 1VWHB 5CSEA 5F6ZA 4IRWA 1G7NA 1B4MA 2RTEB 3EW1A 1SLGB 5IRWA 2QO5A 3D9WA 1AVEA 3LTWA 3P24A 3TGCA 3VGWA 4O3XB 3NBXX 3WXQA 2WSJA 1EI5A 2AMMX 2CZUA 3C78X 3FA7A 2G7BA 4INNA 1EPAA 1A18A 1Y53X 5LJHA 1EW3A 1OBUA 3GAQA 4KCAA 5AQ6A 3UAQA 3EM0A 2OY7A 4TKJA 1JMZA 1LPJA 4CV7A 3VG4A 4QNIA 5K06A 1SWPA 3TZSA 2MF6A 3P6HA 4LKPA 3QKGA 2POAA 3OBLA 1WUBA 3UEXA 3MVFA 1W4TA 5F2BA 1KL4A 3FYFA 3CMPA 1B56A 2OVEA 4YFQA
chains in the Genus database with same CATH topology
4AZPA 3AKNA 3STMX 2ACOA 1ZNHA 4QGXA 2AT0X 3D4RA 1CBIA 2AT3X 3HWEA 1ICMA 4DQ4A 1DF3A 1AELA 4IBAA 1CBRA 2FR3A 3BX8A 2FRSA 1E5PA 4GETA 3V8UA 1XKIA 3TGBA 2X46A 3FENA 1X8OA 3BX7A 1KGLA 2GTLO 3FR2A 5KHPA 4COTA 4O3YA 4FBVA 4GE1A 3FEKA 3NQKA 4O4XA 1KZWA 3VPJE 1JV4A 2WR6A 3VG5A 1BSQA 1LIEA 2QO4A 4ES7A 4ORWA 3NR3A 4U3QA 4FBRA 4YKOA 4D6BA 1JYDA 5HZ6A 4IAXA 1L6MA 3STNA 5LKFA 4K19A 2F09A 3BRNA 1YWCA 4I9RA 4I95A 3VG6A 3RZYA 1BWYA 2OVDA 3MX7A 2EU7X 2QMIA 1PM1X 3RBYA 4ARHA 1JJJA 3P02A 5EDBA 2QM9A 3FEPA 1ERXA 5KICA 1AVGI 1SY3A 3LHNA 3FW4A 1RBPA 1BRPA 2AT8X 4QAEA 4NP1A 4TJZA 4Y0SA 5EDCA 4A1HA 1O8VA 1OEJA 2GTLN 1X71A 3D97A 2PY1A 3I17A 3FLLA 3D95A 2ASNX 1GT5A 4FQBB 2WQ9A 3NX1A 3B2KA 4AZNA 1HQPA 5F58A 2R73A 1YIVA 4YDAA 4HWMA 3FR5A 4A8ZA 3CBSA 2A0AA 3RWXA 2Q4NA 2LBVA 1SA8A 3BSZE 4IB9A 2W2AA 2CBRA 4WHIA 3PECA 4OS8A 3WJEA 4IABA 5B29A 4PJ2A 1TVQA 1GT3A 2JMBA 4GNWA 4ZHHA 2FTBA 2RN4A 3K3LA 1OBPA 5HAEA 4AZOA 5FFHA 4I6SA 2X45A 3NQ3A 3OE3A 1IKEA 1E02A 1PEEA 4M6SA 3UEUA 4O4OA 1H91A 2E4JA 2OFMX 2HLVA 1BSOA 1LF7A 2A13A 3FA9A 4IAWA 4FBOA 4YCHA 4ORSA 4U8UN 3P6EA 1SY1A 2W2BA 1QY1A 1X8PA 3G7XA 1ZNEA 1VYGA 2A2UA 1UZ2X 4U8UM 3ZZVA 3WOVA 2P8GA 4LQZA 2WWPA 3SOTA 3LV4A 3B2IA 4M7MA 4ALBA 5HZ5A 1NP4A 4OMWA 3HK1A 5HA1A 5L8NA 3OD9A 1KQXA 3ZI8A 1LIFA 4WBKA 3S5VA 4D6AA 2BS5A 2ZAIA 1X8QA 1O1UA 3HOEA 3CR6A 2RA6A 4AW8A 4YFRA 1O1VA 3HWDA 2ACPX 1B0OA 1T0VA 4GU8A 4OMXA 3EYCA 4QGWA 1TOWA 4N7DA 4GH7A 3F8AA 1BJ7A 1G85A 2R74A 4YGHA 4YCEA 1ZNDA 4AZRA 3HWGA 4GZVA 5HTDA 1SXXA 1SY0A 3IFBA 2M4LA 2HZQA 5HZQA 3KFFA 1QWDA 3WJGA 4GRJA 2Q39A 2L67A 3PQUA 3P6GA 4YDBA 2LA7A 3VE2A 1EXSA 1YP6A 4OS0A 5DG4A 3DSZA 1S7DA 5L8OA 1UREA 5HTEA 5AEOA 2MO5A 3S5XA 3APXA 2HZRA 2X8TA 4L3RA 1EUOA 1A3YA 5HCEC 1DZJA 4ALOA 1NP1A 1E06A 4KC7A 1OBQA 1ZNGA 5F7GA 1X8UA 1YP7A 3KZAA 2GJ5A 5BVSA 1LNMA 1U17A 3WJFA 1EIOA 2RD7C 5BVQA 1VYFA 4Y0RA 5LJGA 4NNTA 2XKLA 3KFIA 2RQ0A 1LFOA 1VPRA 4MVIA 4Y0QA 3JSQA 3EMMA 3WJCA 2G79A 3WVMA 1N0SA 1KXOA 1QY2A 1AQBA 1BM5A 4NLJA 5FQ7E 2QO6A 2ANSA 3ZUIA 4O4UA 5EZ2A 2BT9A 3O2YA 4NYQA 5D47A 1CRBA 2Z4HA 4ORXA 4YMYA 2Q2PA 4ZH9A 1HMRA 2Q2MA 4KIIA 1QFVA 3TGAA 4NYRA 5H9AA 2NP1A 2ZAGA 3F9DA 1IIUA 2DM5A 3PH5A 4YFPA 3S26A 4MISA 5IO6A 4O3WA 2CM9A 1IFCA 4HPDA 5H8TA 1D3SA 3B2LA 4MIRA 2L9CA 2WEWA 1A57A 3VE1A 4RUNA 4QQ1A 1R0UA 4MVEA 3BY0A 3ZW2A 3P6CA 3SAOA 4TKBA 2F73A 5DPQA 4QRLA 2KTSA 1JIWI 3OJYC 4ORYA 5F6BA 4U8UO 2MHDA 3JQOA 5L8IA 5LJCA 3B2HA 1A2DA 3U03A 1KT4A 4I9SA 1TOUA 3FELA 4ZGUA 1T8VA 5FAZA 4A1YA 1S44A 2YG2A 3KFGA 2FS6A 3EBWA 4YBUA 3TF6A 5C0NA 1DZPA 1GT4A 3ZW0A 2K23A 2JW1A 2XSTA 4AZQA 3ZW0B 4YGGA 3WJDA 2KW1A 1ICNA 4XMGA 1YWBA 4ORRA 5KIDA 4EDEA 2FS7A 4BVMA 5LJBA 2RCTA 4HFOA 4NLIA 1XCAA 4YGZA 3P6DA 1QG5A 1T68X 4ZR2A 1DZKA 3D96A 1X89A 4GKCA 4MVLA 3S60A 3VG2A 4WFUA 5BYPA 1OEEA 5FENA 4LZVA 3UEVA 2BS6A 2JU3A 1DZMA 2Z4IA 3KFHA 4UU2A 5LJDA 4HPBA 4CK4A 1YWDA 1ADLA 1SXUA 2JOZA 4TQ2A 2WUTA 4GNYA 1YWAA 2FWVA 4QGVA 1QABE 3VG7A 4BQUA 2OZQA 4DQ3A 4XMDA 4BOEA 1AB0A 2WQAE 2L5PA 4TKHA 1OPAA 3PEDA 1CJ5A 5HZ8A 2CM4A 4I3DA 1EIIA 5D8JA 1KZXA 1OEKA 2AT5X 1U18A 1OPBA 2X8FA 1PBOA 1GGLA 4GK9A 1FEMA 2OFRX 1S2PA 4TLJA 1DC9A 3O19A 2YMSA 4O9SA 4RUUA 4IB6A 2LB6A 1FDQA 3NQ9A 3STKA 3CWKA 4QZTA 1KQWA 3EBKA 5EPQA 1I4UA 1GXAA 1ML7A 1PMPA 4GDZA 1JZUA 1Y9TA 2LKKA 2GC9A 1HN2A 1Z24A 4IMNA 1JBHA 3F6ZB 4YH0A 3DTQA 4ZGFA 3I0AA 1MUPA 4NW4A 1ACDA 4A60A 2R56A 3BLGA 3MBTA 3ZUOA 3CQNA 3N91A 4ZCBA 1TXLA 3FMZA 4Y0PA 4CSBA 3FA8A 4EQAC 5AJCA 5IO5A 1GX9A 2KT4B 1MVGA 4XMCA 1ALBA 2KTDA 4HPCA 4YBPA 3E3CA 1JYJA 1QFTA 5CYBA 5BVTA 5LJEA 3HOLA 2HYSA 2CZTA 4KH8A 1E00A 2OVAA 5JR8A 1FE3A 1GKAA 1RLBE 2W2FA 2JU7A 2G78A 1GT1A 2JN3A 2O62A 1X8NA 2OVSA 3NADA 1D2UA 3KQ0A 1GKAB 4QYNA 1IKJA 4IB8A 5D4AA 5FQ6E 4ML7B 1BSYA 4KT5A 2WEXA 3ZW1A 1BLRA 3PPTA 4ZFXA 1SXYA 3BS2A 1GX8A 4MVKA 3ZW1B 4FGIB 3Q6LA 3APUA 4JGLA 1ZNKA 2NNEA 4I3BA 4ZH6A 2FR2A 3RSWA 3WBGA 2LFOA 1FENA 4ZJ0A 2BHVA 3ZWEA 2L68A 2BLGA 3L4RA 4OS3A 2MWHA 4EXZA 4UU3A 4ODDA 1KT3A 1DFVA 3BU9A 5IO7A 3ELXA 1EALA 2CBSA 1HMSA 3APVA 2Q9SA 3UEWA 4LKTA 1QY0A 4QYPA 4XMHA 4ID2A 1FELA 3PP6A 3HWFA 3C77X 5D45A 1LIBA 1KT5A 1MX8A 3AKMA 1JJXA 4PSQA 4LZUA 3T1DA 1CBSA 1U0XA 2LBAA 3CQRA 4QZUA 2AT6X 4ZHFA 1GM6A 4IMOA 4ZHDA 1TW4A 4O3ZA 5H9NA 4NNSA 2QOSC 1I06A 1NGLA 4ZHGA 5B27A 3U0DA 4EFGA 5LJKA 5HA0A 2NNQA 1LICA 5D48A 1KT6A 2JU8A 3IA8A 2GTLM 3P6FA 2AH7X 1DV9A 4IB7A 2A2GA 2IFBA 4HPAA 4EEJA 2MM3A 2GTFX 2X8SA 4TNNA 2N93A 3PQSA 4L1NA 1IW2A 2K62A 4KC8A 4XMFA 4U9CA 1HBPA 2MJIA 1ZNLA 2HNXA 5HZ9A 4O49A 2AL0X 2ALLX 4YKMA 3BDRA 5CE4A 3ELZA 4I3CA 1BBPA 4ZHCA 1MDCA 3APWA 3FW5A 5AJBA 3O22A 3PH6A 5F1EA 5HWZA 5HCDC 1B8EA 2AKQA 3HTYA 3VU1A 1YUPA 1QQSA 5HCCC 1HBQA 4AZMA 5H9KA 3ZQ3A 1SY2A 4ORUA 1ZRYA 4WFVA 1P6PA 1BEBA 5EEEA 1IFBA 4R0BA 1KT7A 1G5WA 1KOIA 3BU1A 2NNDA 3VG3A 1HMTA 5FQ8E 1EQDA 1SMPI 3WJBA 4ON1A 3U9PC 1LIDA 1G74A 1MX7A 2KD2A 3NP1A 3NX2A 1FTPA 3B2JA 1LKEA 2RCQA 1I04A 2A3FX 3CBCA 3FA6A 3RKGA 3JS1A 3H3IA 1I05A 3FIQA 3C76X 3NPOA 5EEDA 4AYHA 4N7CA 2FLJA 1SXWA 1ERBA 2HMBA 5H9LA 3GE2A 3FR4A 2FT9A 4O4SA 1BRQA 4XMEA 1EPBA 1CBQA 1Y9LA 5LKEA 5F6ZA 1G7NA 1B4MA 2QO5A 3TGCA 3P24A 4O3XB 3NBXX 3WXQA 2WSJA 1EI5A 2AMMX 2CZUA 3C78X 3FA7A 2G7BA 4INNA 1EPAA 1A18A 5LJHA 1EW3A 1OBUA 3GAQA 4KCAA 5AQ6A 3UAQA 3EM0A 4TKJA 1LPJA 4CV7A 3VG4A 4QNIA 5K06A 3TZSA 3P6HA 4LKPA 3QKGA 2POAA 3OBLA 3UEXA 3MVFA 5HBSA 3FYFA 3CMPA 1B56A 2OVEA 4YFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AZP A;  3AKN A;  3STM X;  2ACO A;  1ZNH A;  4QGX A;  2AT0 X;  1CBI A;  2AT3 X;  3HWE A;  1ICM A;  4DQ4 A;  1DF3 A;  1AEL A;  4IBA A;  1CBR A;  2FR3 A;  3BX8 A;  2FRS A;  1E5P A;  4GET A;  1XKI A;  3TGB A;  2X46 A;  3FEN A;  1X8O A;  3BX7 A;  1KGL A;  3FR2 A;  5KHP A;  4GE1 A;  3FEK A;  1KZW A;  1JV4 A;  2WR6 A;  3VG5 A;  1BSQ A;  1LIE A;  2QO4 A;  4ES7 A;  4ORW A;  3NR3 A;  4YKO A;  4D6B A;  1JYD A;  5HZ6 A;  4IAX A;  1L6M A;  3STN A;  5LKF A;  4K19 A;  3BRN A;  1YWC A;  4I9R A;  3VG6 A;  3RZY A;  1BWY A;  2OVD A;  2EU7 X;  1PM1 X;  4ARH A;  1JJJ A;  5EDB A;  2QM9 A;  3FEP A;  1ERX A;  5KIC A;  1AVG I;  1SY3 A;  3FW4 A;  1RBP A;  1BRP A;  2AT8 X;  4QAE A;  4NP1 A;  4TJZ A;  4Y0S A;  5EDC A;  4A1H A;  1O8V A;  1OEJ A;  1X71 A;  3D97 A;  2PY1 A;  3I17 A;  3FLL A;  3D95 A;  2ASN X;  1GT5 A;  4AZN A;  2WQ9 A;  3NX1 A;  3B2K A;  1HQP A;  5F58 A;  2R73 A;  1YIV A;  4YDA A;  3FR5 A;  4A8Z A;  3CBS A;  2A0A A;  2Q4N A;  2LBV A;  1SA8 A;  3BSZ E;  4IB9 A;  2W2A A;  2CBR A;  3PEC A;  4OS8 A;  3WJE A;  5B29 A;  1TVQ A;  1GT3 A;  4GNW A;  4ZHH A;  2FTB A;  3K3L A;  1OBP A;  5HAE A;  4AZO A;  5FFH A;  2X45 A;  3NQ3 A;  1IKE A;  1E02 A;  1PEE A;  4M6S A;  3UEU A;  1H91 A;  2E4J A;  2OFM X;  2HLV A;  1BSO A;  1LF7 A;  2A13 A;  3FA9 A;  4IAW A;  4YCH A;  4ORS A;  3P6E A;  1SY1 A;  2W2B A;  1QY1 A;  1X8P A;  3G7X A;  1ZNE A;  1VYG A;  2A2U A;  1UZ2 X;  2P8G A;  2WWP A;  3B2I A;  4M7M A;  4ALB A;  5HZ5 A;  1NP4 A;  4OMW A;  3HK1 A;  5HA1 A;  5L8N A;  1KQX A;  1LIF A;  4WBK A;  4D6A A;  1X8Q A;  1O1U A;  4AW8 A;  3CR6 A;  2RA6 A;  4YFR A;  1O1V A;  3HWD A;  2ACP X;  1B0O A;  1T0V A;  4OMX A;  3EYC A;  4QGW A;  1TOW A;  4N7D A;  4GH7 A;  3F8A A;  2R74 A;  1BJ7 A;  1G85 A;  4YGH A;  4YCE A;  1ZND A;  4AZR A;  3HWG A;  5HTD A;  1SXX A;  1SY0 A;  3IFB A;  2HZQ A;  5HZQ A;  3KFF A;  1QWD A;  3WJG A;  4GRJ A;  2Q39 A;  2L67 A;  4YDB A;  3P6G A;  1EXS A;  1YP6 A;  4OS0 A;  5DG4 A;  3DSZ A;  1S7D A;  5L8O A;  1URE A;  5HTE A;  2MO5 A;  3APX A;  2HZR A;  1EUO A;  1A3Y A;  5HCE C;  1DZJ A;  4ALO A;  1NP1 A;  1E06 A;  1OBQ A;  1ZNG A;  5F7G A;  1X8U A;  1YP7 A;  3KZA A;  2GJ5 A;  5BVS A;  1LNM A;  1U17 A;  3WJF A;  1EIO A;  2RD7 C;  5BVQ A;  1VYF A;  4Y0R A;  5LJG A;  4NNT A;  2XKL A;  3KFI A;  2RQ0 A;  1LFO A;  1VPR A;  4MVI A;  4Y0Q A;  3JSQ A;  3EMM A;  3WJC A;  2G79 A;  3WVM A;  1N0S A;  1KXO A;  1QY2 A;  1AQB A;  1BM5 A;  4NLJ A;  2QO6 A;  2ANS A;  3ZUI A;  5EZ2 A;  3O2Y A;  4NYQ A;  5D47 A;  1CRB A;  4ORX A;  4YMY A;  2Q2P A;  4ZH9 A;  1HMR A;  2Q2M A;  4KII A;  1QFV A;  3TGA A;  4NYR A;  5H9A A;  2NP1 A;  3F9D A;  3PH5 A;  1IIU A;  2DM5 A;  3S26 A;  4YFP A;  5IO6 A;  2CM9 A;  1IFC A;  4HPD A;  5H8T A;  1D3S A;  3B2L A;  1A57 A;  2L9C A;  2WEW A;  4RUN A;  1R0U A;  3BY0 A;  3P6C A;  3SAO A;  4TKB A;  2F73 A;  5DPQ A;  3OJY C;  4ORY A;  5F6B A;  3U03 A;  5L8I A;  5LJC A;  3B2H A;  1A2D A;  1KT4 A;  4I9S A;  1TOU A;  3FEL A;  4ZGU A;  1T8V A;  5FAZ A;  4A1Y A;  1S44 A;  2YG2 A;  3KFG A;  2FS6 A;  3EBW A;  4YBU A;  3TF6 A;  5C0N A;  1DZP A;  1GT4 A;  2K23 A;  2XST A;  4AZQ A;  4YGG A;  3WJD A;  1ICN A;  4XMG A;  1YWB A;  4ORR A;  5KID A;  4EDE A;  2FS7 A;  4BVM A;  5LJB A;  2RCT A;  4HFO A;  4NLI A;  1XCA A;  4YGZ A;  3P6D A;  1QG5 A;  1T68 X;  4ZR2 A;  1DZK A;  3D96 A;  1X89 A;  4GKC A;  4MVL A;  3VG2 A;  4WFU A;  5FEN A;  1OEE A;  4LZV A;  3UEV A;  2JU3 A;  1DZM A;  3KFH A;  5LJD A;  4UU2 A;  4HPB A;  4CK4 A;  1YWD A;  1ADL A;  1SXU A;  2JOZ A;  4TQ2 A;  2WUT A;  4GNY A;  1YWA A;  2FWV A;  4QGV A;  1QAB E;  3VG7 A;  4BQU A;  2OZQ A;  4DQ3 A;  4XMD A;  4BOE A;  1AB0 A;  2WQA E;  2L5P A;  4TKH A;  1OPA A;  3PED A;  1CJ5 A;  5HZ8 A;  2CM4 A;  4I3D A;  1EII A;  5D8J A;  1KZX A;  1OEK A;  2AT5 X;  1U18 A;  1OPB A;  1PBO A;  1GGL A;  1FEM A;  2OFR X;  1S2P A;  4TLJ A;  1DC9 A;  3O19 A;  4O9S A;  4RUU A;  4IB6 A;  2LB6 A;  1FDQ A;  3NQ9 A;  3STK A;  3CWK A;  4QZT A;  1KQW A;  3EBK A;  5EPQ A;  1I4U A;  1GXA A;  1ML7 A;  1PMP A;  1JZU A;  2LKK A;  2GC9 A;  1HN2 A;  1Z24 A;  4IMN A;  1JBH A;  4YH0 A;  3DTQ A;  3I0A A;  1MUP A;  1ACD A;  4A60 A;  2R56 A;  3BLG A;  3MBT A;  3ZUO A;  3CQN A;  4ZCB A;  1TXL A;  3FMZ A;  4Y0P A;  3FA8 A;  5IO5 A;  1GX9 A;  2KT4 B;  1MVG A;  4XMC A;  1ALB A;  2KTD A;  4HPC A;  4YBP A;  5BVT A;  1JYJ A;  1QFT A;  5LJE A;  2HYS A;  2CZT A;  1E00 A;  2OVA A;  5JR8 A;  1FE3 A;  1GKA A;  1RLB E;  2W2F A;  2JU7 A;  2G78 A;  1GT1 A;  2JN3 A;  2O62 A;  1X8N A;  3NAD A;  1D2U A;  3KQ0 A;  1GKA B;  4QYN A;  1IKJ A;  4IB8 A;  5D4A A;  1BSY A;  2WEX A;  1BLR A;  3PPT A;  4ZFX A;  1SXY A;  3BS2 A;  1GX8 A;  4MVK A;  3Q6L A;  3APU A;  1ZNK A;  2NNE A;  4I3B A;  4ZH6 A;  2FR2 A;  3RSW A;  3WBG A;  2LFO A;  1FEN A;  4ZJ0 A;  2L68 A;  2BLG A;  3L4R A;  4OS3 A;  4EXZ A;  4UU3 A;  4ODD A;  1KT3 A;  1DFV A;  3BU9 A;  5IO7 A;  3ELX A;  1EAL A;  2CBS A;  1HMS A;  3APV A;  2Q9S A;  3UEW A;  4LKT A;  1QY0 A;  4QYP A;  4XMH A;  1FEL A;  3PP6 A;  3HWF A;  3C77 X;  5D45 A;  1LIB A;  1KT5 A;  1MX8 A;  3AKM A;  1JJX A;  4PSQ A;  4LZU A;  3T1D A;  1CBS A;  1U0X A;  2LBA A;  3CQR A;  4QZU A;  2AT6 X;  4ZHF A;  1GM6 A;  4IMO A;  4ZHD A;  1TW4 A;  5H9N A;  4NNS A;  2QOS C;  1I06 A;  1NGL A;  4ZHG A;  5B27 A;  3U0D A;  4EFG A;  5LJK A;  5HA0 A;  2NNQ A;  1LIC A;  5D48 A;  1KT6 A;  2JU8 A;  3IA8 A;  3P6F A;  2AH7 X;  1DV9 A;  4IB7 A;  2A2G A;  2IFB A;  4HPA A;  4EEJ A;  2MM3 A;  2GTF X;  4TNN A;  2N93 A;  1IW2 A;  2K62 A;  4XMF A;  1HBP A;  2MJI A;  1ZNL A;  2HNX A;  5HZ9 A;  2AL0 X;  2ALL X;  4YKM A;  3BDR A;  5CE4 A;  3ELZ A;  4I3C A;  1BBP A;  4ZHC A;  1MDC A;  3APW A;  3FW5 A;  3O22 A;  3PH6 A;  5F1E A;  5HWZ A;  5HCD C;  1B8E A;  2AKQ A;  1YUP A;  1QQS A;  5HCC C;  1HBQ A;  4AZM A;  5H9K A;  3ZQ3 A;  1SY2 A;  4ORU A;  1ZRY A;  4WFV A;  1P6P A;  1BEB A;  5EEE A;  1IFB A;  4R0B A;  1KT7 A;  1G5W A;  1KOI A;  3BU1 A;  2NND A;  3VG3 A;  1HMT A;  1EQD A;  3WJB A;  3U9P C;  1LID A;  1G74 A;  1MX7 A;  3NP1 A;  3NX2 A;  1FTP A;  3B2J A;  1LKE A;  2RCQ A;  1I04 A;  2A3F X;  3CBC A;  3FA6 A;  3JS1 A;  1I05 A;  3FIQ A;  3C76 X;  3NPO A;  5EED A;  4AYH A;  4N7C A;  2FLJ A;  1SXW A;  1ERB A;  2HMB A;  5H9L A;  3FR4 A;  2FT9 A;  1BRQ A;  4XME A;  1EPB A;  1CBQ A;  5LKE A;  5F6Z A;  1G7N A;  1B4M A;  2QO5 A;  3TGC A;  3WXQ A;  2WSJ A;  2AMM X;  2CZU A;  3C78 X;  3FA7 A;  2G7B A;  1EPA A;  1A18 A;  5LJH A;  1EW3 A;  1OBU A;  3GAQ A;  5AQ6 A;  3EM0 A;  4TKJ A;  1LPJ A;  3VG4 A;  5K06 A;  3TZS A;  3P6H A;  4LKP A;  3QKG A;  2POA A;  3UEX A;  3MVF A;  5HBS A;  3CMP A;  1B56 A;  2OVE A;  4YFQ A; 
#chains in the Genus database with same CATH topology
 4AZP A;  3AKN A;  4Z27 A;  4OEL A;  1SWC A;  1W6F A;  2ACO A;  1ZNH A;  4QGX A;  2AT0 X;  3D4R A;  3STM X;  3AEH A;  1CBI A;  2CAM A;  2AT3 X;  3HWE A;  1ICM A;  4DQ4 A;  1DF3 A;  1SWJ A;  1AEL A;  4IBA A;  1CBR A;  2FR3 A;  3BX8 A;  2FRS A;  2IZB A;  1E5P A;  4GET A;  3V8U A;  1XKI A;  3TGB A;  3T2X A;  2X46 A;  2RTF B;  3FEN A;  1X8O A;  3BX7 A;  1KGL A;  2GTL O;  3FR2 A;  5KHP A;  4COT A;  4O3Y A;  4FBV A;  4GE1 A;  1SWF A;  3FEK A;  3NQK A;  4O4X A;  3VPJ E;  1JV4 A;  2WR6 A;  2Y3F A;  3VG5 A;  1KZW A;  3CKF A;  1BSQ A;  1LIE A;  2QO4 A;  2OFA A;  3T2W A;  4ORW A;  3NR3 A;  4U3Q A;  4ES7 A;  4BBO A;  4FBR A;  1N7Y A;  4YKO A;  1Y52 X;  1JYD A;  4D6B A;  4IAX A;  1L6M A;  5HZ6 A;  2RTG B;  5B3M O;  5LKF A;  4K19 A;  3STN A;  1VWF B;  4BX5 A;  2F09 A;  3BRN A;  1YWC A;  4I9R A;  4I95 A;  3VG6 A;  3RZY A;  1BWY A;  4C5P A;  2OVD A;  3MX7 A;  2EU7 X;  2QMI A;  1PM1 X;  2A5C A;  3RBY A;  4ARH A;  3RDQ A;  3VHI A;  4BX5 B;  3P02 A;  1JJJ A;  1LUQ A;  5EDB A;  2QM9 A;  3FEP A;  1ERX A;  5KIC A;  1AVG I;  1SY3 A;  2RTK A;  3LHN A;  3FW4 A;  3VHM A;  1RBP A;  1BRP A;  2AT8 X;  4QAE A;  2AF5 A;  4NP1 A;  4TJZ A;  4Y0S A;  5EDC A;  4A1H A;  1O8V A;  1OEJ A;  2GTL N;  1X71 A;  3D97 A;  2C4I A;  1SWO A;  2PY1 A;  3I17 A;  3FLL A;  1KL3 A;  2HKD A;  3D95 A;  2ASN X;  2C1Q A;  1GT5 A;  4FQB B;  1NQM A;  2WQ9 A;  3B2K A;  3NX1 A;  1HQP A;  5F58 A;  4AZN A;  2R73 A;  1YIV A;  4YDA A;  4HWM A;  3FR5 A;  2PI3 O;  3CBS A;  2A0A A;  1MOY A;  2RTR B;  3RWX A;  4A8Z A;  2Q4N A;  2LBV A;  1SA8 A;  2IZA A;  3BSZ E;  2W2A A;  2CBR A;  4IB9 A;  4WHI A;  3PEC A;  1SWS A;  3HPE A;  4OS8 A;  3WJE A;  4Y59 A;  4IAB A;  5B29 A;  4PJ2 A;  1TVQ A;  1GT3 A;  2JMB A;  4GNW A;  4ZHH A;  2FTB A;  2RN4 A;  3K3L A;  1OBP A;  5HAE A;  4AZO A;  5B2A O;  5FFH A;  4I6S A;  2IZD B;  2X45 A;  2RTQ B;  2OL8 O;  1KL5 A;  3NQ3 A;  1IKE A;  3OE3 A;  1E02 A;  1PEE A;  4M6S A;  3UEU A;  4O4O A;  1H91 A;  2E4J A;  2HLV A;  2OFM X;  1BSO A;  1LF7 A;  2A13 A;  3FA9 A;  1FJ1 E;  4FBO A;  1VWD B;  4YCH A;  4ORS A;  4U8U N;  5IRU A;  3P6E A;  1E2T A;  1SY1 A;  2W2B A;  1QY1 A;  4JO6 A;  1X8P A;  2QCB A;  3G7X A;  1ZNE A;  4EKV A;  1IJ8 A;  1VYG A;  2A2U A;  1UZ2 X;  4U8U M;  3ZZV A;  3WOV A;  1SRH A;  2P8G A;  4LQZ A;  5HBS A;  4CPI A;  2WWP A;  3SOT A;  3LV4 A;  3B2I A;  4M7M A;  4ALB A;  1SLF B;  1SWD A;  5HZ5 A;  1NP4 A;  4OMW A;  3HK1 A;  5HA1 A;  5L8N A;  3OD9 A;  1KQX A;  3ZI8 A;  1LIF A;  4WBK A;  1N9M A;  3MG5 A;  3S5V A;  4D6A A;  1JJU A;  2BS5 A;  3WYQ A;  2ZAI A;  1X8Q A;  1O1U A;  3HOE A;  3CR6 A;  2RA6 A;  4AW8 A;  1SWN A;  4YFR A;  1O1V A;  3HWD A;  2ACP X;  1B0O A;  1T0V A;  4GU8 A;  4OMX A;  1AVD A;  3EYC A;  4CPF A;  4QGW A;  1VWM B;  4CDF A;  1TOW A;  2X32 A;  4N7D A;  4GH7 A;  3F8A A;  1BJ7 A;  1G85 A;  2R74 A;  4YGH A;  4YCE A;  1ZND A;  1VWJ B;  4AZR A;  4BX6 A;  5IXG A;  3HWG A;  4GZV A;  5HTD A;  3RE6 A;  4BX6 B;  1SXX A;  1SY0 A;  4Z28 A;  3IFB A;  4CDC A;  2JGS A;  1JMX A;  5B5F A;  2M4L A;  2HZQ A;  1LDQ A;  5HZQ A;  3KFF A;  1QWD A;  1SWE A;  3WJG A;  4GRJ A;  2Q39 A;  2DJF A;  1SLE B;  2A5B A;  2L67 A;  3T6F A;  3PQU A;  3P6G A;  4YDB A;  2LA7 A;  3SLO A;  3VE2 A;  1EXS A;  1YP6 A;  4OS0 A;  5DG4 A;  3SZI A;  3DSZ A;  1S7D A;  4GGZ A;  5L8O A;  1URE A;  5HTE A;  3Q34 A;  3WZO A;  5AEO A;  1SRI A;  2MO5 A;  4Y5D A;  3APX A;  3S5X A;  2HZR A;  2X8T A;  4L3R A;  1HXL A;  1EUO A;  4I60 A;  1A3Y A;  5HCE C;  1DZJ A;  4ALO A;  1NP1 A;  2OFB A;  1E06 A;  4OEM A;  4KC7 A;  1OBQ A;  1ZNG A;  5F7G A;  1X8U A;  1I78 A;  1YP7 A;  2GJ5 A;  3KZA A;  5BVS A;  1LNM A;  1U17 A;  1DF8 A;  3WJF A;  1SWH A;  1LDO A;  3KVN A;  1EIO A;  2RD7 C;  4GGR A;  5BVQ A;  1VYF A;  4Y0R A;  5LJG A;  4NNT A;  2XKL A;  3KFI A;  1N9Y A;  2RQ0 A;  1LFO A;  1VPR A;  1NQN A;  4MVI A;  4Y0Q A;  3JSQ A;  3PK2 A;  3EMM A;  2QOM A;  2G79 A;  3WJC A;  1N0S A;  3WVM A;  1KXO A;  1QY2 A;  1AQB A;  1BM5 A;  4NLJ A;  5FQ7 E;  2QO6 A;  2IZL B;  1SRE A;  2ANS A;  3ZUI A;  4O4U A;  5CHK A;  4OKA A;  5EZ2 A;  2BSZ A;  4Z2V A;  2BT9 A;  3O2Y A;  4NV7 A;  4NYQ A;  5D47 A;  1CRB A;  1NC9 A;  2Z4H A;  4ORX A;  1UYO X;  5B10 O;  4YMY A;  2Q2P A;  4ZH9 A;  2I5Z O;  1HMR A;  2Q2M A;  4KII A;  1QFV A;  3TGA A;  4NYR A;  5H9A A;  2NP1 A;  2ZAG A;  3F9D A;  1IIU A;  2DM5 A;  3PH5 A;  4YFP A;  3RY2 A;  3S26 A;  2X4M A;  4MIS A;  2OL7 A;  5IO6 A;  4O3W A;  2CM9 A;  1VWE B;  1IFC A;  2A8G A;  4HPD A;  5H8T A;  1D3S A;  3B2L A;  4MIR A;  2L9C A;  2WEW A;  1SWT A;  1A57 A;  3VE1 A;  4RUN A;  4QQ1 A;  1VWI B;  1R0U A;  4MVE A;  2RTH B;  3BY0 A;  3ZW2 A;  3P6C A;  1VWL B;  3SAO A;  4TKB A;  2DJG A;  2F73 A;  5DPQ A;  4QRL A;  2KTS A;  1JIW I;  3OJY C;  4GDA A;  4ORY A;  5JD2 A;  5F6B A;  4U8U O;  1SWB A;  2MHD A;  3VHH A;  3JQO A;  5L8I A;  1SRG A;  3B2H A;  1A2D A;  5LJC A;  1KT4 A;  1VWR B;  1TOU A;  1WBI A;  3FEL A;  4I9S A;  3U03 A;  3SLT A;  4ZGU A;  1T8V A;  2X56 A;  5FAZ A;  4A1Y A;  1S44 A;  1RXH A;  2IZJ A;  2YG2 A;  3KFG A;  2FS6 A;  3EBW A;  3RDS A;  4YBU A;  3TF6 A;  5C0N A;  1DZP A;  1N4J A;  1GT4 A;  2OF8 A;  3ZW0 A;  2K23 A;  2JW1 A;  2XST A;  3WZQ A;  4JNJ A;  4AZQ A;  1VWA B;  2BC3 A;  2RTO B;  1KFF A;  4CPH B;  3CKG A;  4YGG A;  2I5V O;  3WJD A;  3ZW0 B;  2KW1 A;  4B55 A;  1ICN A;  4XMG A;  1YWB A;  1HXZ A;  4ORR A;  3SZJ A;  1VWQ B;  5KID A;  4EDE A;  2FS7 A;  4BVM A;  5LJB A;  2RCT A;  4HFO A;  3RE5 A;  4NLI A;  1XCA A;  4YGZ A;  1RXJ A;  3P6D A;  1QG5 A;  1T68 X;  4ZR2 A;  2RTP B;  3AUM O;  1DZK A;  3D96 A;  1X89 A;  4GKC A;  4MVL A;  3S60 A;  3VG2 A;  2VFC A;  3QQ2 A;  4WFU A;  5BYP A;  1OEE A;  5FEN A;  4LZV A;  1PBY A;  2BS6 A;  2JU3 A;  3UEV A;  1DZM A;  1PTS A;  2Z4I A;  3KFH A;  4UU2 A;  5LJD A;  1Y55 X;  4HPB A;  4CK4 A;  1VWC B;  1YWD A;  1ADL A;  1SXU A;  2JOZ A;  4TQ2 A;  2WUT A;  4GNY A;  5IRA A;  1YWA A;  2FWV A;  4QGV A;  1QAB E;  3VG7 A;  4BQU A;  2OZQ A;  5B11 O;  4DQ3 A;  4XMD A;  4BOE A;  1SLD B;  4CDE A;  1AB0 A;  2G8C O;  2WQA E;  3MM0 A;  2L5P A;  1SRF A;  1OPA A;  3PED A;  4TKH A;  2OY5 O;  4CPE A;  5HZ8 A;  1CJ5 A;  2CM4 A;  4I3D A;  1EII A;  1MK5 A;  5D8J A;  3FID A;  1KZX A;  1OEK A;  2AT5 X;  1U18 A;  1OPB A;  2X8F A;  1PBO A;  1GGL A;  4GK9 A;  1FEM A;  2OFR X;  5B5G A;  2OL6 O;  1S2P A;  1Y0G A;  2RTN B;  4TLJ A;  1OSP O;  1DC9 A;  3O19 A;  2YMS A;  1UYN X;  4O9S A;  4RUU A;  4IAW A;  4IB6 A;  1MM9 A;  2LB6 A;  1FDQ A;  3NQ9 A;  3STK A;  3CWK A;  4QZT A;  1KQW A;  3EBK A;  5EPQ A;  5L3Y A;  2RTA A;  1I4U A;  1GXA A;  1ML7 A;  1PMP A;  4GDZ A;  1JZU A;  1Y9T A;  2LKK A;  2GC9 A;  3EC5 A;  1HN2 A;  1Z24 A;  2RTC B;  4IMN A;  1JBH A;  3F6Z B;  4YH0 A;  3DTQ A;  2OY8 A;  4ZGF A;  3I0A A;  1MUP A;  4NW4 A;  1ACD A;  4A60 A;  2R56 A;  3BLG A;  3MBT A;  4JHQ A;  3ZUO A;  3CQN A;  3N91 A;  4ZCB A;  1TXL A;  3FMZ A;  4Y0P A;  4CSB A;  3FA8 A;  4EQA C;  5AJC A;  5IO5 A;  1GX9 A;  2KT4 B;  1MVG A;  4XMC A;  4Z2P A;  1HY2 A;  1ALB A;  2KTD A;  4HPC A;  4YBP A;  2RTL A;  3E3C A;  1JYJ A;  1QFT A;  5CYB A;  5BVT A;  3RDO A;  5LJE A;  3HOL A;  4CDD A;  2OF9 A;  1SWA A;  2HYS A;  2CZT A;  4KH8 A;  4YVB A;  1RAV A;  1E00 A;  2F01 A;  2OVA A;  1FE3 A;  1GKA A;  4Z2O A;  5JR8 A;  1RLB E;  2VFB A;  2W2F A;  2JU7 A;  2G78 A;  1GT1 A;  2JN3 A;  2O62 A;  1GX3 A;  1SWU A;  1X8N A;  2OVS A;  3NAD A;  1STR B;  2ZSC A;  3T6L A;  1D2U A;  1MEP A;  3SLJ A;  3KQ0 A;  1GKA B;  4MEE A;  3WZN A;  1VWP B;  1IKJ A;  4QYN A;  4IB8 A;  5D4A A;  5FQ6 E;  4ML7 B;  1SWR A;  1BSY A;  1LEL A;  2IZI A;  2WEX A;  4KT5 A;  3ZW1 A;  4BGF A;  1HQQ A;  1BLR A;  1RSU B;  2RTI B;  3PPT A;  3X00 A;  4ZFX A;  1SXY A;  3BS2 A;  1GX8 A;  4MVK A;  3ZW1 B;  4FGI B;  3Q6L A;  3APU A;  4JGL A;  1ZNK A;  2NNE A;  2X34 A;  4I3B A;  2FR2 A;  4ZH6 A;  3RSW A;  2LFO A;  1FEN A;  3WBG A;  4ZJ0 A;  2BHV A;  4DCB A;  3ZWE A;  3WZP A;  2L68 A;  2BLG A;  3L4R A;  4OS3 A;  2MWH A;  4EXZ A;  4UU3 A;  4ODD A;  1KT3 A;  4NV8 A;  1DFV A;  3BU9 A;  4GJV A;  4U46 A;  3RDX A;  5IO7 A;  3ELX A;  5K68 A;  1I9H A;  4DNE A;  1EAL A;  2CBS A;  1HMS A;  2FKG A;  3APV A;  2Q9S A;  2G5L A;  1SRJ A;  3UEW A;  4LKT A;  4BCS A;  5CE4 A;  1QY0 A;  4QYP A;  4XMH A;  2UYW A;  4ID2 A;  1FEL A;  3PP6 A;  1STS B;  3HWF A;  3C77 X;  5D45 A;  1LIB A;  4Z6J A;  1KT5 A;  1MX8 A;  2GH7 A;  3AKM A;  2Y32 A;  4PSQ A;  3FDC A;  1JJX A;  4LZU A;  2OYB O;  1CBS A;  1U0X A;  2LBA A;  3CQR A;  4QZU A;  3T1D A;  2AT6 X;  4ZHF A;  1GM6 A;  1W5R A;  4IMO A;  4ZHD A;  1TW4 A;  4CPH A;  1K3B A;  1SWK A;  2FKJ A;  4O3Z A;  1NBX A;  4NNS A;  2QOS C;  5H9N A;  1I06 A;  1NGL A;  1VWN B;  2IZF B;  5B27 A;  4ZHG A;  2OY1 O;  4EFG A;  3U0D A;  5LJK A;  5HA0 A;  1VWK B;  1VWG B;  1LCV A;  3PDF A;  2NNQ A;  1LIC A;  5D48 A;  1KT6 A;  2JU8 A;  3IA8 A;  2GTL M;  2RTD B;  3P6F A;  2AH7 X;  1DV9 A;  2IZC B;  4IB7 A;  2FHL A;  2A2G A;  2IFB A;  4HPA A;  4EEJ A;  1VWO B;  2GTF X;  2MM3 A;  2X8S A;  4TNN A;  1SWL A;  2N93 A;  3PQS A;  1IW2 A;  4L1N A;  2UZ2 A;  2K62 A;  4KC8 A;  1N43 A;  2FGS A;  3SZH A;  4BX7 A;  4XMF A;  1LCW A;  4GGT A;  4U9C A;  1HBP A;  2MJI A;  1ZNL A;  2WPU A;  2HNX A;  2IZK A;  5HZ9 A;  4O49 A;  2AL0 X;  2IZE B;  2ALL X;  4YKM A;  2X55 A;  3BDR A;  4BX7 B;  4GJS A;  1VYO A;  3ELZ A;  1BBP A;  4I3C A;  4ZHC A;  1MDC A;  5K67 A;  3APW A;  3FW5 A;  5AJB A;  3O22 A;  3PH6 A;  5F1E A;  5HWZ A;  1K24 A;  5HCD C;  1B8E A;  2AKQ A;  3HTY A;  3VU1 A;  1YUP A;  1QQS A;  1RXK A;  5HCC C;  1HBQ A;  4AZM A;  2RTB B;  2RTM A;  5H9K A;  3ZQ3 A;  1SY2 A;  1JQP A;  1ZRY A;  1SWG A;  4ORU A;  4WFV A;  1P6P A;  1LCZ A;  1BEB A;  3RY1 A;  5EEE A;  1IFB A;  1STP A;  4R0B A;  1KT7 A;  1G5W A;  1KOI A;  2VDF A;  3BU1 A;  2RTJ A;  2AVI A;  2NND A;  3VG3 A;  1HMT A;  4GD9 A;  2Y3E A;  1NDJ A;  5FQ8 E;  1EQD A;  1SMP I;  3WJB A;  4ON1 A;  3U9P C;  1LID A;  1G74 A;  1MX7 A;  2KD2 A;  3NP1 A;  3NX2 A;  3RDU A;  1FTP A;  3WYP A;  4BJ8 A;  3B2J A;  1LKE A;  2RCQ A;  1I04 A;  2A3F X;  3CBC A;  3FA6 A;  1SWQ A;  3JS1 A;  3RKG A;  3RDM A;  3H3I A;  1I05 A;  3FIQ A;  2FHN X;  3C76 X;  3NPO A;  5EED A;  4AYH A;  4N7C A;  2FLJ A;  1SXW A;  1ERB A;  2HMB A;  4GUZ A;  5H9L A;  3GE2 A;  2IZG B;  3EW2 A;  2IZH B;  1RST B;  3FR4 A;  2FT9 A;  4O4S A;  1VWB B;  1BRQ A;  4XME A;  1EPB A;  1CBQ A;  1Y9L A;  5LKE A;  2C1S A;  1VWH B;  5CSE A;  5F6Z A;  4IRW A;  1G7N A;  1B4M A;  2RTE B;  3EW1 A;  1SLG B;  5IRW A;  2QO5 A;  3D9W A;  1AVE A;  3LTW A;  3P24 A;  3TGC A;  3VGW A;  4O3X B;  3NBX X;  3WXQ A;  2WSJ A;  1EI5 A;  2AMM X;  2CZU A;  3C78 X;  3FA7 A;  2G7B A;  4INN A;  1EPA A;  1A18 A;  1Y53 X;  5LJH A;  1EW3 A;  1OBU A;  3GAQ A;  4KCA A;  5AQ6 A;  3UAQ A;  3EM0 A;  2OY7 A;  4TKJ A;  1JMZ A;  1LPJ A;  4CV7 A;  3VG4 A;  4QNI A;  5K06 A;  1SWP A;  3TZS A;  2MF6 A;  3P6H A;  4LKP A;  3QKG A;  2POA A;  3OBL A;  1WUB A;  3UEX A;  3MVF A;  1W4T A;  5F2B A;  1KL4 A;  3FYF A;  3CMP A;  1B56 A;  2OVE A;  4YFQ A; 
#chains in the Genus database with same CATH homology
 4AZP A;  3AKN A;  3STM X;  2ACO A;  1ZNH A;  4QGX A;  2AT0 X;  3D4R A;  1CBI A;  2AT3 X;  3HWE A;  1ICM A;  4DQ4 A;  1DF3 A;  1AEL A;  4IBA A;  1CBR A;  2FR3 A;  3BX8 A;  2FRS A;  1E5P A;  4GET A;  3V8U A;  1XKI A;  3TGB A;  2X46 A;  3FEN A;  1X8O A;  3BX7 A;  1KGL A;  2GTL O;  3FR2 A;  5KHP A;  4COT A;  4O3Y A;  4FBV A;  4GE1 A;  3FEK A;  3NQK A;  4O4X A;  1KZW A;  3VPJ E;  1JV4 A;  2WR6 A;  3VG5 A;  1BSQ A;  1LIE A;  2QO4 A;  4ES7 A;  4ORW A;  3NR3 A;  4U3Q A;  4FBR A;  4YKO A;  4D6B A;  1JYD A;  5HZ6 A;  4IAX A;  1L6M A;  3STN A;  5LKF A;  4K19 A;  2F09 A;  3BRN A;  1YWC A;  4I9R A;  4I95 A;  3VG6 A;  3RZY A;  1BWY A;  2OVD A;  3MX7 A;  2EU7 X;  2QMI A;  1PM1 X;  3RBY A;  4ARH A;  1JJJ A;  3P02 A;  5EDB A;  2QM9 A;  3FEP A;  1ERX A;  5KIC A;  1AVG I;  1SY3 A;  3LHN A;  3FW4 A;  1RBP A;  1BRP A;  2AT8 X;  4QAE A;  4NP1 A;  4TJZ A;  4Y0S A;  5EDC A;  4A1H A;  1O8V A;  1OEJ A;  2GTL N;  1X71 A;  3D97 A;  2PY1 A;  3I17 A;  3FLL A;  3D95 A;  2ASN X;  1GT5 A;  4FQB B;  2WQ9 A;  3NX1 A;  3B2K A;  4AZN A;  1HQP A;  5F58 A;  2R73 A;  1YIV A;  4YDA A;  4HWM A;  3FR5 A;  4A8Z A;  3CBS A;  2A0A A;  3RWX A;  2Q4N A;  2LBV A;  1SA8 A;  3BSZ E;  4IB9 A;  2W2A A;  2CBR A;  4WHI A;  3PEC A;  4OS8 A;  3WJE A;  4IAB A;  5B29 A;  4PJ2 A;  1TVQ A;  1GT3 A;  2JMB A;  4GNW A;  4ZHH A;  2FTB A;  2RN4 A;  3K3L A;  1OBP A;  5HAE A;  4AZO A;  5FFH A;  4I6S A;  2X45 A;  3NQ3 A;  3OE3 A;  1IKE A;  1E02 A;  1PEE A;  4M6S A;  3UEU A;  4O4O A;  1H91 A;  2E4J A;  2OFM X;  2HLV A;  1BSO A;  1LF7 A;  2A13 A;  3FA9 A;  4IAW A;  4FBO A;  4YCH A;  4ORS A;  4U8U N;  3P6E A;  1SY1 A;  2W2B A;  1QY1 A;  1X8P A;  3G7X A;  1ZNE A;  1VYG A;  2A2U A;  1UZ2 X;  4U8U M;  3ZZV A;  3WOV A;  2P8G A;  4LQZ A;  2WWP A;  3SOT A;  3LV4 A;  3B2I A;  4M7M A;  4ALB A;  5HZ5 A;  1NP4 A;  4OMW A;  3HK1 A;  5HA1 A;  5L8N A;  3OD9 A;  1KQX A;  3ZI8 A;  1LIF A;  4WBK A;  3S5V A;  4D6A A;  2BS5 A;  2ZAI A;  1X8Q A;  1O1U A;  3HOE A;  3CR6 A;  2RA6 A;  4AW8 A;  4YFR A;  1O1V A;  3HWD A;  2ACP X;  1B0O A;  1T0V A;  4GU8 A;  4OMX A;  3EYC A;  4QGW A;  1TOW A;  4N7D A;  4GH7 A;  3F8A A;  1BJ7 A;  1G85 A;  2R74 A;  4YGH A;  4YCE A;  1ZND A;  4AZR A;  3HWG A;  4GZV A;  5HTD A;  1SXX A;  1SY0 A;  3IFB A;  2M4L A;  2HZQ A;  5HZQ A;  3KFF A;  1QWD A;  3WJG A;  4GRJ A;  2Q39 A;  2L67 A;  3PQU A;  3P6G A;  4YDB A;  2LA7 A;  3VE2 A;  1EXS A;  1YP6 A;  4OS0 A;  5DG4 A;  3DSZ A;  1S7D A;  5L8O A;  1URE A;  5HTE A;  5AEO A;  2MO5 A;  3S5X A;  3APX A;  2HZR A;  2X8T A;  4L3R A;  1EUO A;  1A3Y A;  5HCE C;  1DZJ A;  4ALO A;  1NP1 A;  1E06 A;  4KC7 A;  1OBQ A;  1ZNG A;  5F7G A;  1X8U A;  1YP7 A;  3KZA A;  2GJ5 A;  5BVS A;  1LNM A;  1U17 A;  3WJF A;  1EIO A;  2RD7 C;  5BVQ A;  1VYF A;  4Y0R A;  5LJG A;  4NNT A;  2XKL A;  3KFI A;  2RQ0 A;  1LFO A;  1VPR A;  4MVI A;  4Y0Q A;  3JSQ A;  3EMM A;  3WJC A;  2G79 A;  3WVM A;  1N0S A;  1KXO A;  1QY2 A;  1AQB A;  1BM5 A;  4NLJ A;  5FQ7 E;  2QO6 A;  2ANS A;  3ZUI A;  4O4U A;  5EZ2 A;  2BT9 A;  3O2Y A;  4NYQ A;  5D47 A;  1CRB A;  2Z4H A;  4ORX A;  4YMY A;  2Q2P A;  4ZH9 A;  1HMR A;  2Q2M A;  4KII A;  1QFV A;  3TGA A;  4NYR A;  5H9A A;  2NP1 A;  2ZAG A;  3F9D A;  1IIU A;  2DM5 A;  3PH5 A;  4YFP A;  3S26 A;  4MIS A;  5IO6 A;  4O3W A;  2CM9 A;  1IFC A;  4HPD A;  5H8T A;  1D3S A;  3B2L A;  4MIR A;  2L9C A;  2WEW A;  1A57 A;  3VE1 A;  4RUN A;  4QQ1 A;  1R0U A;  4MVE A;  3BY0 A;  3ZW2 A;  3P6C A;  3SAO A;  4TKB A;  2F73 A;  5DPQ A;  4QRL A;  2KTS A;  1JIW I;  3OJY C;  4ORY A;  5F6B A;  4U8U O;  2MHD A;  3JQO A;  5L8I A;  5LJC A;  3B2H A;  1A2D A;  3U03 A;  1KT4 A;  4I9S A;  1TOU A;  3FEL A;  4ZGU A;  1T8V A;  5FAZ A;  4A1Y A;  1S44 A;  2YG2 A;  3KFG A;  2FS6 A;  3EBW A;  4YBU A;  3TF6 A;  5C0N A;  1DZP A;  1GT4 A;  3ZW0 A;  2K23 A;  2JW1 A;  2XST A;  4AZQ A;  3ZW0 B;  4YGG A;  3WJD A;  2KW1 A;  1ICN A;  4XMG A;  1YWB A;  4ORR A;  5KID A;  4EDE A;  2FS7 A;  4BVM A;  5LJB A;  2RCT A;  4HFO A;  4NLI A;  1XCA A;  4YGZ A;  3P6D A;  1QG5 A;  1T68 X;  4ZR2 A;  1DZK A;  3D96 A;  1X89 A;  4GKC A;  4MVL A;  3S60 A;  3VG2 A;  4WFU A;  5BYP A;  1OEE A;  5FEN A;  4LZV A;  3UEV A;  2BS6 A;  2JU3 A;  1DZM A;  2Z4I A;  3KFH A;  4UU2 A;  5LJD A;  4HPB A;  4CK4 A;  1YWD A;  1ADL A;  1SXU A;  2JOZ A;  4TQ2 A;  2WUT A;  4GNY A;  1YWA A;  2FWV A;  4QGV A;  1QAB E;  3VG7 A;  4BQU A;  2OZQ A;  4DQ3 A;  4XMD A;  4BOE A;  1AB0 A;  2WQA E;  2L5P A;  4TKH A;  1OPA A;  3PED A;  1CJ5 A;  5HZ8 A;  2CM4 A;  4I3D A;  1EII A;  5D8J A;  1KZX A;  1OEK A;  2AT5 X;  1U18 A;  1OPB A;  2X8F A;  1PBO A;  1GGL A;  4GK9 A;  1FEM A;  2OFR X;  1S2P A;  4TLJ A;  1DC9 A;  3O19 A;  2YMS A;  4O9S A;  4RUU A;  4IB6 A;  2LB6 A;  1FDQ A;  3NQ9 A;  3STK A;  3CWK A;  4QZT A;  1KQW A;  3EBK A;  5EPQ A;  1I4U A;  1GXA A;  1ML7 A;  1PMP A;  4GDZ A;  1JZU A;  1Y9T A;  2LKK A;  2GC9 A;  1HN2 A;  1Z24 A;  4IMN A;  1JBH A;  3F6Z B;  4YH0 A;  3DTQ A;  4ZGF A;  3I0A A;  1MUP A;  4NW4 A;  1ACD A;  4A60 A;  2R56 A;  3BLG A;  3MBT A;  3ZUO A;  3CQN A;  3N91 A;  4ZCB A;  1TXL A;  3FMZ A;  4Y0P A;  4CSB A;  3FA8 A;  4EQA C;  5AJC A;  5IO5 A;  1GX9 A;  2KT4 B;  1MVG A;  4XMC A;  1ALB A;  2KTD A;  4HPC A;  4YBP A;  3E3C A;  1JYJ A;  1QFT A;  5CYB A;  5BVT A;  5LJE A;  3HOL A;  2HYS A;  2CZT A;  4KH8 A;  1E00 A;  2OVA A;  5JR8 A;  1FE3 A;  1GKA A;  1RLB E;  2W2F A;  2JU7 A;  2G78 A;  1GT1 A;  2JN3 A;  2O62 A;  1X8N A;  2OVS A;  3NAD A;  1D2U A;  3KQ0 A;  1GKA B;  4QYN A;  1IKJ A;  4IB8 A;  5D4A A;  5FQ6 E;  4ML7 B;  1BSY A;  4KT5 A;  2WEX A;  3ZW1 A;  1BLR A;  3PPT A;  4ZFX A;  1SXY A;  3BS2 A;  1GX8 A;  4MVK A;  3ZW1 B;  4FGI B;  3Q6L A;  3APU A;  4JGL A;  1ZNK A;  2NNE A;  4I3B A;  4ZH6 A;  2FR2 A;  3RSW A;  3WBG A;  2LFO A;  1FEN A;  4ZJ0 A;  2BHV A;  3ZWE A;  2L68 A;  2BLG A;  3L4R A;  4OS3 A;  2MWH A;  4EXZ A;  4UU3 A;  4ODD A;  1KT3 A;  1DFV A;  3BU9 A;  5IO7 A;  3ELX A;  1EAL A;  2CBS A;  1HMS A;  3APV A;  2Q9S A;  3UEW A;  4LKT A;  1QY0 A;  4QYP A;  4XMH A;  4ID2 A;  1FEL A;  3PP6 A;  3HWF A;  3C77 X;  5D45 A;  1LIB A;  1KT5 A;  1MX8 A;  3AKM A;  1JJX A;  4PSQ A;  4LZU A;  3T1D A;  1CBS A;  1U0X A;  2LBA A;  3CQR A;  4QZU A;  2AT6 X;  4ZHF A;  1GM6 A;  4IMO A;  4ZHD A;  1TW4 A;  4O3Z A;  5H9N A;  4NNS A;  2QOS C;  1I06 A;  1NGL A;  4ZHG A;  5B27 A;  3U0D A;  4EFG A;  5LJK A;  5HA0 A;  2NNQ A;  1LIC A;  5D48 A;  1KT6 A;  2JU8 A;  3IA8 A;  2GTL M;  3P6F A;  2AH7 X;  1DV9 A;  4IB7 A;  2A2G A;  2IFB A;  4HPA A;  4EEJ A;  2MM3 A;  2GTF X;  2X8S A;  4TNN A;  2N93 A;  3PQS A;  4L1N A;  1IW2 A;  2K62 A;  4KC8 A;  4XMF A;  4U9C A;  1HBP A;  2MJI A;  1ZNL A;  2HNX A;  5HZ9 A;  4O49 A;  2AL0 X;  2ALL X;  4YKM A;  3BDR A;  5CE4 A;  3ELZ A;  4I3C A;  1BBP A;  4ZHC A;  1MDC A;  3APW A;  3FW5 A;  5AJB A;  3O22 A;  3PH6 A;  5F1E A;  5HWZ A;  5HCD C;  1B8E A;  2AKQ A;  3HTY A;  3VU1 A;  1YUP A;  1QQS A;  5HCC C;  1HBQ A;  4AZM A;  5H9K A;  3ZQ3 A;  1SY2 A;  4ORU A;  1ZRY A;  4WFV A;  1P6P A;  1BEB A;  5EEE A;  1IFB A;  4R0B A;  1KT7 A;  1G5W A;  1KOI A;  3BU1 A;  2NND A;  3VG3 A;  1HMT A;  5FQ8 E;  1EQD A;  1SMP I;  3WJB A;  4ON1 A;  3U9P C;  1LID A;  1G74 A;  1MX7 A;  2KD2 A;  3NP1 A;  3NX2 A;  1FTP A;  3B2J A;  1LKE A;  2RCQ A;  1I04 A;  2A3F X;  3CBC A;  3FA6 A;  3RKG A;  3JS1 A;  3H3I A;  1I05 A;  3FIQ A;  3C76 X;  3NPO A;  5EED A;  4AYH A;  4N7C A;  2FLJ A;  1SXW A;  1ERB A;  2HMB A;  5H9L A;  3GE2 A;  3FR4 A;  2FT9 A;  4O4S A;  1BRQ A;  4XME A;  1EPB A;  1CBQ A;  1Y9L A;  5LKE A;  5F6Z A;  1G7N A;  1B4M A;  2QO5 A;  3TGC A;  3P24 A;  4O3X B;  3NBX X;  3WXQ A;  2WSJ A;  1EI5 A;  2AMM X;  2CZU A;  3C78 X;  3FA7 A;  2G7B A;  4INN A;  1EPA A;  1A18 A;  5LJH A;  1EW3 A;  1OBU A;  3GAQ A;  4KCA A;  5AQ6 A;  3UAQ A;  3EM0 A;  4TKJ A;  1LPJ A;  4CV7 A;  3VG4 A;  4QNI A;  5K06 A;  3TZS A;  3P6H A;  4LKP A;  3QKG A;  2POA A;  3OBL A;  3UEX A;  3MVF A;  5HBS A;  3FYF A;  3CMP A;  1B56 A;  2OVE A;  4YFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...