1JZUA

Cell transformation by the myc oncogene activates expression of a lipocalin: analysis of the gene (q83) and solution structure of its protein product
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
157
structure length
157
Chain Sequence
MTVPDRSEIAGKWYVVALASNTEFFLREKDKMKMAMARISFLGEDELKVSYAVPKPNGCRKWETTFKKTSDDGEVYYSEEAKKKVEVLDTDYKSYAVIYATRVKDGRTLHMMRLYSRSPEVSPAATAIFRKLAGERNYTDEMVAMLPRQEECTVDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords lipocalin Q83
publication title Cell Transformation by the v-myc Oncogene Abrogates c-Myc/Max-mediated Suppression of a C/EBPbeta-dependent Lipocalin Gene.
pubmed doi rcsb
source organism Coturnix coturnix
total genus 25
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2001-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1jzuA00
1NP4A 1X8QA 3BU9A 2G79A 2JOZA 5HCCC 1GT5A 3STKA 2QM9A 2AT5X 4GRJA 1JV4A 3FR5A 2Q4NA 1OBUA 1A18A 4TJZA 1AVGI 1LIFA 4O9SA 1FENA 2HYSA 1FELA 1JBHA 4CK4A 3EBWA 5K06A 1R0UA 2X46A 4YGHA 5D8JA 1QY0A 5HAEA 3ZUOA 1LNMA 5L8IA 3VG2A 3O2YA 3AKNA 2WSJA 2AT6X 1GKAA 4YDAA 2Q2PA 1GKAB 1AQBA 3APXA 4ZHDA 1JYJA 2A2UA 3PEDA 1JJJA 3BU1A 3D95A 3EM0A 3BDRA 1G7NA 3NADA 4XMHA 1X8UA 3KZAA 2FR2A 3NQ3A 3ELZA 4N7CA 1KZWA 3APUA 3P6EA 2FR3A 4IB6A 4A60A 2F73A 1S44A 3OJYC 1LICA 4QZUA 2LBVA 1B4MA 2G78A 5HTDA 2AMMX 2GTFX 4ZHFA 4TNNA 4YCEA 3P6GA 4IAXA 2R56A 1SXWA 1G5WA 3FR2A 2CM4A 2CZUA 1ZNEA 4IB7A 1EQDA 4QGXA 5BVSA 5HZQA 2RCTA 1UREA 2HMBA 4IAWA 1EIIA 1DC9A 1O1VA 1IFBA 4AZRA 1U0XA 2W2FA 4BOEA 3RZYA 3QKGA 1OPBA 1ALBA 3TGBA 2O62A 5EPQA 5KICA 2K62A 3TGCA 5LJHA 2WUTA 4GETA 3CBSA 1QFTA 1E02A 2FS7A 3CBCA 4EDEA 4I3CA 4MVIA 4ORWA 1I05A 4HPCA 4QAEA 5HTEA 1MUPA 3CQNA 3ZQ3A 2FWVA 2AKQA 4ORYA 1SXUA 3WJBA 2JU8A 4UU3A 4NP1A 1SXXA 2FLJA 4YFRA 3FMZA 1KT7A 3PPTA 5BVTA 3G7XA 1ADLA 2OVAA 3CWKA 1KT5A 3WJFA 4YMYA 1LKEA 4IBAA 4OMWA 2FTBA 1ACDA 4WBKA 1ZNLA 4YH0A 2CBRA 4AZQA 1N0SA 2AT0X 4YFQA 3F9DA 3P6HA 1CRBA 5B27A 3FELA 4YGGA 1AB0A 3PH5A 1LFOA 1KOIA 4EEJA 3CQRA 1HMSA 1ML7A 3NPOA 1HBPA 4NYQA 4QGWA 5EDCA 4RUUA 4TKJA 2XSTA 5IO7A 1SY0A 1BBPA 2OZQA 1BWYA 4PSQA 3EYCA 5HZ6A 2R73A 2Q39A 4GNYA 1SY1A 2L67A 4XMDA 5EEDA 4D6AA 4YDBA 1DV9A 4YBPA 4XMEA 3ZUIA 1HMTA 1QY1A 4N7DA 3FA9A 2MM3A 5HA0A 3HK1A 3TF6A 1CBRA 2FRSA 3FA8A 1BSOA 4NNTA 4OS3A 3STMX 3FW5A 2MO5A 3C77X 3JS1A 1YUPA 1GT1A 3HWFA 2WEWA 3PECA 2LFOA 2K23A 4ZH9A 1L6MA 3B2KA 5EDBA 4BVMA 1BSQA 4DQ4A 2BLGA 2G7BA 3PP6A 1LIBA 2QOSC 1E00A 4AZOA 3ELXA 1SXYA 4LZUA 1HN2A 3O19A 1DF3A 2XKLA 4AYHA 1FDQA 3NR3A 1MVGA 1TOUA 2ACPX 5EEEA 4D6BA 1VPRA 4M7MA 1LIDA 1YWAA 2NP1A 3DTQA 4OS8A 4Y0QA 4AW8A 5HWZA 3VG3A 1B0OA 1HMRA 4IB9A 1GT3A 1GM6A 4NNSA 1G85A 3HWGA 3FW4A 1ZNGA 3HWDA 3C76X 1EALA 2L68A 3FENA 1JJXA 3HWEA 2LBAA 2R74A 1DZPA 4A8ZA 4EXZA 5C0NA 5IO5A 4TQ2A 2X45A 3FA6A 4YKMA 4Y0SA 1S2PA 4ZHCA 4ODDA 2ASNX 4WFUA 2GJ5A 4BQUA 4ZGUA 5LKEA 4ZFXA 3KFIA 4XMCA 4YFPA 2NNQA 4NLJA 4IB8A 3FR4A 3P6DA 1ZNDA 4K19A 1DZJA 3BSZE 2JU7A 1X8OA 1D2UA 4HPAA 3CMPA 3P6FA 3VG6A 1AELA 1LIEA 4I3BA 1BJ7A 1KT6A 1YP7A 2RA6A 5CE4A 1CBSA 4LKPA 3RSWA 3WJEA 1QY2A 3C78X 1RBPA 2P8GA 1FE3A 2OVDA 4OMXA 5HBSA 1CBQA 1BRQA 4HPBA 3UEVA 5F1EA 4AZPA 1VYGA 5DG4A 1H91A 1A3YA 3NQ9A 1ERXA 4QGVA 1MX7A 1NGLA 4OS0A 4ORSA 4GKCA 5JR8A 2JU3A 1YP6A 3BX7A 3B2JA 4ZR2A 2Q2MA 5HZ9A 1CBIA 1BEBA 1BM5A 2A0AA 5HCDC 4TKBA 3TZSA 1CJ5A 4ZHGA 3FEPA 1IKEA 2ALLX 3BRNA 5HCEC 1UZ2X 1YWCA 1A2DA 1JZUA 1HQPA 2N93A 3NP1A 5H9AA 2QO5A 2GC9A 3KQ0A 2RD7C 4MVLA 3NX1A 3U03A 4M6SA 5D48A 4QZTA 4MVKA 4DQ3A 2OVEA 1SA8A 3AKMA 1GT4A 3D97A 1RLBE 3IA8A 2EU7X 1KGLA 1B8EA 3VG4A 1T68X 5D45A 1ZRYA 1GXAA 4ALBA 1GX8A 5BVQA 5FFHA 1MDCA 4A1HA 2WR6A 2A3FX 3F8AA 1BLRA 2RCQA 1MX8A 3Q6LA 1KT3A 5F7GA 5H8TA 4ALOA 5LJCA 5FENA 4ZJ0A 2PY1A 1ICMA 2IFBA 1TW4A 1ERBA 1PEEA 2A13A 3U9PC 1T8VA 5H9LA 2L5PA 3T1DA 1SY2A 3KFFA 4ZCBA 2E4JA 1HBQA 4LKTA 3APWA 3FEKA 5LJBA 4TLJA 5LJGA 5LJDA 3KFHA 5F6ZA 2AL0X 3UEXA 4I3DA 2WEXA 4ORXA 3I0AA 1PMPA 1BRPA 4WFVA 4AZMA 3WXQA 1GGLA 1X8NA 4UU2A 3BX8A 1XCAA 3EBKA 4ZH6A 3PH6A 1U17A 2W2AA 1I4UA 1GX9A 3B2HA 4QYNA 4NYRA 4ZHHA 1I04A 3BY0A 2NNDA 1O8VA 3B2IA 1DZMA 3TGAA 5L8NA 2CM9A 5AQ6A 4XMFA 3U0DA 2POAA 3DSZA 5D47A 4IMNA 1IKJA 2W2BA 3JSQA 2AT8X 5EZ2A 1QQSA 1A57A 1YIVA 2OFRX 3UEWA 5B29A 5LKFA 2RQ0A 1NP1A 3FIQA 1OBQA 4A1YA 4HFOA 2KTDA 1QFVA 1IIUA 2HLVA 3UEUA 1P6PA 3BS2A 3WJCA 4ARHA 1S7DA 2LKKA 1ZNHA 1X8PA 5H9NA 1IFCA 1B56A 1TVQA 2Q9SA 2QO4A 1X89A 3L4RA 1YWBA 3VG5A 5D4AA 1XKIA 1E5PA 3STNA 1EUOA 1KT4A 2CBSA 3MVFA 2QO6A 3K3LA 1QG5A 2A2GA 3APVA 3WJGA 5KIDA 4KIIA 2ACOA 2ANSA 2HZQA 5LJKA 3BLGA 1EIOA 3SAOA 1EXSA 4EFGA 2FT9A 1OEEA 1TXLA 4HPDA 4LZVA 1JYDA 2CZTA 4GE1A 3GAQA 3NX2A 1VYFA 1FTPA 1BSYA 1QABE 1EW3A 4R0BA 1EPAA 1LF7A 3S26A 2WWPA 1X71A 1KQXA 3WVMA 1T0VA 5F58A 1OBPA 1U18A 3MBTA 1IW2A 5HA1A 1OPAA 1OEKA 2WQAE 2MJIA 4ORRA 4TKHA 4ORUA 1DZKA 1KZXA 5FAZA 3CR6A 2AH7X 5DPQA 2YG2A 2LB6A 3D96A 3IFBA 4Y0PA 5H9KA 2JN3A 2L9CA 1I06A 1E06A 1KQWA 5LJEA 3KFGA 5HZ5A 4XMGA 3VG7A 4IMOA 4GNWA 3O22A 4YGZA 5F6BA 2DM5A 1DFVA 4QYPA 4Y0RA 5IO6A 1ICNA 1OEJA 1FEMA 2HZRA 1KXOA 4NLIA 2AT3X 5KHPA 3B2LA 1SY3A 4RUNA 4ES7A 1PM1X 5L8OA 4YCHA 4GH7A 4I9SA 1QWDA 3FLLA 5HZ8A 1EPBA 4I9RA 3FA7A 3WJDA 1LPJA 2KT4B 1O1UA 2HNXA 1TOWA 3I17A 2WQ9A 2NNEA 2FS6A 2OFMX 4YBUA 1D3SA 1ZNKA 3WBGA 1Z24A 3EMMA 4YKOA 1PBOA 3P6CA 1YWDA 4AZNA 1G74A
chains in the Genus database with same CATH superfamily
1NP4A 1NDJA 1X8QA 2BT9A 3BU9A 2G79A 2JOZA 5HCCC 1VWBB 3RDUA 1GT5A 1SRJA 3STKA 2QM9A 2QMIA 2AT5X 3LTWA 1JV4A 3FR5A 2Q4NA 1OBUA 4GRJA 4I60A 2M4LA 1A18A 4TJZA 4FBVA 1AVGI 1LIFA 4O9SA 1FENA 1FJ1E 2RTLA 2HYSA 1FELA 1JBHA 4KC7A 4CK4A 3EBWA 4Z2PA 5K06A 3GE2A 1R0UA 2X46A 4YGHA 4NV7A 1QY0A 5D8JA 5HAEA 3ZUOA 1AVDA 1LNMA 4O49A 5L8IA 3VG2A 3O2YA 3VHHA 3AKNA 1Y53X 2WSJA 2AT6X 1GKAA 4YDAA 5B5FA 2OL8O 2Q2PA 1GKAB 1AQBA 2I5VO 3APXA 4ZHDA 1JYJA 3PK2A 3OBLA 2A2UA 3PEDA 4GDAA 1JJJA 3SOTA 3BU1A 3D95A 3EM0A 3BDRA 1G7NA 3NADA 4XMHA 1X8UA 4BJ8A 2HKDA 3KZAA 2FR2A 4CDEA 1PBYA 3NQ3A 2VFCA 3ELZA 4N7CA 3APUA 1KZWA 3P6EA 2FR3A 4IB6A 3WOVA 2F73A 1S44A 3OJYC 1LICA 4QZUA 1VWMB 2LBVA 1B4MA 2G78A 5HTDA 2AMMX 2GTFX 3H3IA 2G5LA 4ZHFA 2RTFB 4TNNA 4YCEA 2RTGB 3P6GA 4IAXA 2OY8A 2R56A 5FQ8E 1SXWA 2RTOB 1G5WA 3FR2A 2CM4A 3SLOA 2CZUA 1ZNEA 4IB7A 1EQDA 4QGXA 5BVSA 5HZQA 2RCTA 3VU1A 1UREA 2RTPB 1YWDA 2HMBA 4IAWA 1EIIA 1DC9A 4O4SA 1O1VA 1IFBA 2MWHA 4AZRA 1U0XA 2W2FA 4INNA 4BOEA 5AEOA 3RZYA 1WUBA 1JMXA 3QKGA 1OPBA 1ALBA 4EQAC 1VWIB 3TGBA 3RE6A 3D4RA 2O62A 4O3WA 5EPQA 5KICA 1VWEB 2K62A 1VWPB 1NQNA 4JGLA 4U8UN 3TGCA 3RDQA 5LJHA 2WUTA 4GETA 3CBSA 2A5CA 1QFTA 2CAMA 1IJ8A 1E02A 2FS7A 2IZCB 1RXJA 3CBCA 1UYNX 4I3CA 4MVIA 2YMSA 4COTA 4ORWA 1VWJB 2OVSA 4Y59A 1I05A 4HPCA 4QAEA 1SWSA 1VWLB 5HTEA 1MUPA 4ON1A 3CQNA 4QRLA 3ZQ3A 2FWVA 4U8UO 2AKQA 2UZ2A 4ORYA 1SXUA 2KD2A 3WJBA 2JU8A 4Z6JA 4UU3A 4NP1A 1SXXA 2FLJA 4YFRA 3FMZA 1KT7A 2RTKA 1MK5A 3PPTA 2BSZA 5BVTA 3G7XA 1ADLA 4PJ2A 2OVAA 3CWKA 4MVEA 5HZ6A 1KT5A 1RXHA 1WBIA 2OFBA 3WJFA 4YMYA 1LKEA 3RDXA 4IBAA 4OMWA 2FTBA 1ACDA 3FYFA 3LHNA 4WBKA 4BX5A 1ZNLA 4OKAA 4YH0A 2CBRA 1I9HA 4AZQA 3KVNA 3ZW2A 1N0SA 2AT0X 4YFQA 3WZQA 3F9DA 3P6HA 4GK9A 1DV9A 1CRBA 3NQKA 5B27A 3FELA 2X8TA 4YGGA 3VE2A 1AB0A 3PH5A 1LFOA 1KOIA 4EEJA 3CQRA 1HMSA 1ML7A 2JW1A 1HBPA 3NPOA 1SWGA 4NYQA 2Z4HA 4QGWA 5EDCA 5B11O 4RUUA 4TKJA 2XSTA 4CV7A 2X34A 3RDMA 5IO7A 3T6FA 4BBOA 1SY0A 1BBPA 1SLEB 1N4JA 3AUMO 5B10O 2OZQA 5BYPA 4L3RA 2JMBA 1SWAA 1BWYA 4I6SA 4ID2A 4PSQA 2Y32A 3EYCA 2R73A 3ZZVA 2Q39A 4GNYA 1SY1A 2L67A 4XMDA 5EEDA 4D6AA 1VWDB 2X4MA 2BC3A 4YDBA 4CSBA 4DNEA 4XMEA 3ZUIA 4YBPA 1HMTA 1QY1A 4N7DA 3FA9A 4MEEA 2MM3A 5HA0A 3HK1A 3TF6A 1CBRA 2FRSA 3FA8A 1BSOA 4NNTA 4OS3A 3STMX 2OL6O 3WYQA 3FW5A 2MO5A 3C77X 3JS1A 1YUPA 1GT1A 1SWUA 3HWFA 2WEWA 1E2TA 3PECA 2LFOA 4U8UM 4FBOA 3VPJE 2K23A 1VWRB 4IRWA 1SWKA 1L6MA 3B2KA 5EDBA 4ZH9A 4BVMA 1BSQA 4DQ4A 2BLGA 2G7BA 3PP6A 1LIBA 3SZHA 4ZGFA 2QOSC 1E00A 1NBXA 4AZOA 3ELXA 1SXYA 4LZUA 1SLFB 3S5VA 1HN2A 3O19A 3S5XA 2XKLA 4AYHA 1FDQA 1DF3A 3NR3A 1MVGA 1TOUA 2ACPX 2RTAA 5EEEA 4D6BA 1VPRA 1STPA 4M7MA 1LIDA 1YWAA 2NP1A 3DTQA 4OS8A 4Y0QA 3RWXA 5AJCA 3T6LA 1B0OA 1HMRA 4IB9A 3VG3A 4AW8A 5HWZA 1GT3A 1GM6A 4NNSA 4Y5DA 3SLJA 5CHKA 2C1SA 1G85A 1VWKB 3HWGA 3FW4A 1Y9LA 1ZNGA 3HWDA 3C76X 3WYPA 1EALA 1KL3A 1SMPI 2L68A 3AEHA 3FENA 4O4XA 1JJXA 5L3YA 3HWEA 2LBAA 2R74A 1DZPA 4A8ZA 4EKVA 4EXZA 5C0NA 5IO5A 4TQ2A 2X45A 3PQUA 1SRIA 3FA6A 4YKMA 1SWFA 4Y0SA 1S2PA 4ZHCA 4ODDA 2ASNX 1KL4A 1DF8A 2GJ5A 1EI5A 4WFUA 4BQUA 4ZGUA 5LKEA 4ZFXA 3KFIA 4XMCA 2ZSCA 2NNQA 4YFPA 4NLJA 1LDQA 1SWHA 4IB8A 3EW2A 3FR4A 1PTSA 3P6DA 1ZNDA 4K19A 1DZJA 3BSZE 4EDEA 1VWGB 2JU7A 4U3QA 1X8OA 1D2UA 3WZPA 1SRFA 4HPAA 3CMPA 3P6FA 1UYOX 2JGSA 3S60A 3NBXX 2QCBA 3VG6A 3LV4A 1AELA 4OELA 1LIEA 4I3BA 2MF6A 3V8UA 1BJ7A 1KT6A 1YP7A 2RA6A 2X56A 2ZAGA 1CBSA 4LKPA 5CE4A 3RSWA 4Z27A 3WJEA 3QQ2A 4MIRA 1QY2A 2IZIA 2UYWA 1GX3A 2X55A 2GTLN 1RBPA 3C78X 2RTQB 1SWTA 3WZOA 2P8GA 1FE3A 2OVDA 4OMXA 5HBSA 3SZIA 1CBQA 2Y3FA 5CSEA 1BRQA 4HPBA 3UEVA 5F1EA 1LCZA 1VYGA 2FKGA 1RXKA 4AZPA 5DG4A 1H91A 1A3YA 3NQ9A 3T2WA 1ERXA 4IABA 4MISA 4QGVA 1MX7A 3E3CA 1NGLA 4OS0A 4ORSA 4GKCA 2OY7A 5JR8A 2JU3A 1Y9TA 1YP6A 3BX7A 3B2JA 4ZR2A 1KL5A 1SRGA 2Q2MA 5HZ9A 1N7YA 1CBIA 4KH8A 1VWFB 2BS6A 2ZAIA 2RTHB 1HQQA 2IZKA 4WHIA 1BEBA 5AJBA 2A0AA 3P24A 4B55A 4YVBA 4TKBA 5HCDC 3TZSA 1BM5A 4JHQA 4ZHGA 1CJ5A 3FEPA 1IKEA 2ALLX 3BRNA 4U46A 5HCEC 1UZ2X 1VWHB 4BX7B 1YWCA 2MHDA 1A2DA 2IZGB 1JZUA 3RY2A 1HQPA 2N93A 2QOMA 3NP1A 5H9AA 1SWNA 2QO5A 4O4OA 2GC9A 4CDCA 3KQ0A 2RD7C 4MVLA 3NX1A 3U03A 1OSPO 4M6SA 5D48A 4QZTA 4GGRA 4MVKA 4DQ3A 2RTMA 2OVEA 3CKFA 5CYBA 1SA8A 3AKMA 1SWPA 1GT4A 1SWOA 3D97A 4GU8A 1RLBE 3IA8A 4KCAA 2FHNX 1NQMA 3PQSA 2EU7X 4NV8A 1B8EA 1KGLA 1SLDB 3VG4A 1T68X 5D45A 2WPUA 1ZRYA 2RTBB 2X32A 1GXAA 4ALBA 4DCBA 1N43A 4JNJA 4FBRA 1GX8A 2OL7A 5FFHA 1MDCA 5FQ6E 5BVQA 3OD9A 4A1HA 2WR6A 1VYOA 2A3FX 2IZEB 3F8AA 1BLRA 1MX8A 2RCQA 3Q6LA 1KT3A 5F7GA 1SWRA 5H8TA 3ZWEA 5K68A 4ALOA 5LJCA 2A5BA 5FENA 4ZJ0A 2LA7A 2PY1A 1ICMA 2IFBA 1TW4A 1ERBA 2OF8A 1PEEA 2A13A 3U9PC 1T8VA 5H9LA 2L5PA 3T1DA 1SY2A 2IZAA 3KFFA 4ZCBA 2E4JA 1HBQA 3MG5A 4LKTA 1W4TA 3APWA 1MEPA 3FEKA 5LJBA 4TLJA 5LJGA 5LJDA 3RKGA 3KFHA 2VDFA 5F6ZA 2AL0X 3WZNA 3UEXA 4I3DA 2WEXA 1VWNB 4ORXA 3I0AA 2IZHB 1PMPA 1SREA 1RAVA 5JD2A 1STSB 3HTYA 4GZVA 1BRPA 4WFVA 4AZMA 4QQ1A 3WXQA 4C5PA 1X8NA 3MM0A 3BX8A 1XCAA 2G8CO 3EBKA 4UU2A 5B2AO 4ZH6A 3PH6A 3T2XA 4FGIB 5IRWA 1SWCA 1U17A 2W2AA 1I4UA 3ZW0A 4GJVA 1KFFA 1GX9A 2IZJA 1N9MA 3B2HA 3VGWA 4QYNA 3ZW0B 1SWLA 4BGFA 3FDCA 4NYRA 1LELA 4ZHHA 3X00A 2OY1O 1Y0GA 1I04A 1AVEA 1HXLA 1O8VA 2NNDA 3B2IA 1DZMA 1SWBA 3BY0A 4GGTA 3TGAA 2OY5O 5L8NA 5K67A 2CM9A 5AQ6A 1N9YA 2X8SA 4XMFA 3U0DA 2POAA 2AVIA 1JIWI 2IZBA 3DSZA 4BCSA 2IZDB 5D47A 2Y3EA 4IMNA 4Z28A 1IKJA 2W2BA 3JSQA 2AT8X 5EZ2A 1QQSA 1A57A 1YIVA 1K24A 2OFRX 1VWAB 5F2BA 3UEWA 1HXZA 5B3MO 4O3ZA 4O4UA 5B29A 5LKFA 3RY1A 1K3BA 2RQ0A 1VWQB 1NP1A 3FIQA 3SZJA 1OBQA 4A1YA 3N91A 4HFOA 1LCVA 2KTSA 2PI3O 4FQBB 4CDDA 2KTDA 1QFVA 1IIUA 2F01A 2HLVA 3HOEA 4GGZA 1LCWA 1P6PA 2C4IA 1SWEA 3BS2A 4L1NA 3UEUA 3RBYA 3WJCA 1S7DA 4ARHA 2LKKA 5IXGA 3VHIA 2BHVA 1ZNHA 4JO6A 1X8PA 1W5RA 5H9NA 5IRUA 1IFCA 1B56A 1TVQA 2Q9SA 2QO4A 1X89A 3L4RA 4Z2OA 1YWBA 2GH7A 5B5GA 1HY2A 5D4AA 3VG5A 1MOYA 1XKIA 1E5PA 4GD9A 2OYBO 4Z2VA 3STNA 3JQOA 1EUOA 1KT4A 4LQZA 2CBSA 1RSTB 3MVFA 3OE3A 3UAQA 2QO6A 4O3YA 4KC8A 3K3LA 1QG5A 2A2GA 5FQ7E 3APVA 1JJUA 4GJSA 3WJGA 3VHMA 5KIDA 4KIIA 2ACOA 3EW1A 2GTLO 2ANSA 4GDZA 2HZQA 5LJKA 3BLGA 1SWQA 2OF9A 1EIOA 4NW4A 2IZFB 3SAOA 1EXSA 1SRHA 4EFGA 2FT9A 1OEEA 1TXLA 2FGSA 4HPDA 4LZVA 1JYDA 2FKJA 2CZTA 4GE1A 4BX7A 3GAQA 3NX2A 1VYFA 1FTPA 1BSYA 1LDOA 1QABE 2RTIB 1EW3A 4R0BA 4KT5A 1EPAA 1LF7A 3PDFA 1VWOB 2A8GA 3S26A 2WWPA 1X71A 1KQXA 3WVMA 1T0VA 5F58A 1OBPA 1U18A 3MBTA 1VWCB 1IW2A 2IZLB 4U9CA 5HA1A 3EC5A 1OPAA 4BX6A 1OEKA 2WQAE 1JMZA 2DJGA 2MJIA 3MX7A 4ORRA 1RSUB 5IRAA 4BX6B 1SWJA 2BS5A 2KW1A 4ORUA 4TKHA 1DZKA 1JQPA 4CPFA 2VFBA 5FAZA 1KZXA 3CKGA 3CR6A 2AH7X 4A60A 5DPQA 2YG2A 2LB6A 3D96A 3IFBA 2DJFA 4Y0PA 5H9KA 4CPEA 3SLTA 2JN3A 4HWMA 4CDFA 4CPIA 2L9CA 1I06A 1SWDA 1E06A 1KQWA 2OFAA 4QNIA 3ZW1A 3KFGA 5LJEA 5HZ5A 1STRB 2AF5A 3ZW1B 3HOLA 2RTJA 4XMGA 3VG7A 4IMOA 2X8FA 2C1QA 3O22A 4GNWA 4YGZA 4BX5B 2GTLM 1MM9A 2DM5A 1DFVA 5F6BA 4QYPA 1Y55X 4Y0RA 5IO6A 1ICNA 1LUQA 2FHLA 1OEJA 1FEMA 2HZRA 1KXOA 2I5ZO 2AT3X 4NLIA 2Z4IA 3VE1A 5KHPA 3B2LA 3P02A 1SY3A 4RUNA 4ES7A 1PM1X 3D9WA 5L8OA 4YCHA 4GH7A 4I9SA 1I78A 2F09A 1Y52X 2RTEB 1QWDA 3FLLA 5HZ8A 2RTCB 2RTNB 1EPBA 1SLGB 4I9RA 4OEMA 3FA7A 3RDSA 3WJDA 2RTRB 1LPJA 2KT4B 1W6FA 3FIDA 3HPEA 1O1UA 4ML7B 2HNXA 1TOWA 1NC9A 4O3XB 2RN4A 3I17A 2WQ9A 2NNEA 3RDOA 4CPHA 2FS6A 4I95A 3RE5A 3F6ZB 2RTDB 2OFMX 4YBUA 1D3SA 4CPHB 4GUZA 1ZNKA 3WBGA 1Z24A 3EMMA 3Q34A 4YKOA 1PBOA 3P6CA 1GGLA 4AZNA 3ZI8A 1G74A
chains in the Genus database with same CATH topology
1NP4A 1X8QA 2BT9A 3BU9A 2G79A 2JOZA 5HCCC 1GT5A 3STKA 2QM9A 2QMIA 2AT5X 4GRJA 1JV4A 3FR5A 2Q4NA 1OBUA 2M4LA 1A18A 4TJZA 4FBVA 1AVGI 1LIFA 4O9SA 1FENA 2HYSA 1FELA 1JBHA 4KC7A 4CK4A 3EBWA 5K06A 3GE2A 1R0UA 2X46A 4YGHA 5D8JA 1QY0A 5HAEA 3ZUOA 1LNMA 4O49A 5L8IA 3VG2A 3O2YA 3AKNA 2WSJA 2AT6X 1GKAA 4YDAA 2Q2PA 1GKAB 1AQBA 3APXA 4ZHDA 1JYJA 3OBLA 2A2UA 3PEDA 1JJJA 3SOTA 3BU1A 3D95A 3EM0A 3BDRA 1G7NA 3NADA 4XMHA 1X8UA 3KZAA 2FR2A 3NQ3A 3ELZA 4N7CA 1KZWA 3APUA 3P6EA 2FR3A 4IB6A 3WOVA 2F73A 1S44A 3OJYC 1LICA 4QZUA 2LBVA 4A60A 1B4MA 2G78A 5HTDA 2AMMX 2GTFX 3H3IA 4ZHFA 4TNNA 4YCEA 3P6GA 4IAXA 2R56A 5FQ8E 1SXWA 1G5WA 3FR2A 2CM4A 2CZUA 1ZNEA 4IB7A 1EQDA 4QGXA 5BVSA 5HZQA 2RCTA 3VU1A 1UREA 2HMBA 4IAWA 1EIIA 1DC9A 4O4SA 1O1VA 1IFBA 2MWHA 4AZRA 1U0XA 2W2FA 4INNA 4BOEA 5AEOA 3RZYA 3QKGA 1OPBA 1ALBA 4EQAC 3TGBA 3D4RA 2O62A 4O3WA 5EPQA 5KICA 2K62A 4U8UN 4JGLA 3TGCA 5LJHA 2WUTA 4GETA 3CBSA 1QFTA 1E02A 2FS7A 3CBCA 4EDEA 4I3CA 4MVIA 2YMSA 4COTA 4ORWA 2OVSA 1I05A 4HPCA 4QAEA 5HTEA 1MUPA 4ON1A 3CQNA 4QRLA 3ZQ3A 2FWVA 4U8UO 2AKQA 4ORYA 1SXUA 2KD2A 3WJBA 2JU8A 4UU3A 4NP1A 1SXXA 2FLJA 4YFRA 3FMZA 1KT7A 3PPTA 5BVTA 3G7XA 1ADLA 4PJ2A 2OVAA 3CWKA 4MVEA 1KT5A 3WJFA 4YMYA 1LKEA 4IBAA 4OMWA 2FTBA 1ACDA 3FYFA 3LHNA 4WBKA 1ZNLA 4YH0A 2CBRA 4AZQA 3ZW2A 1N0SA 2AT0X 4YFQA 3F9DA 3P6HA 4GK9A 1CRBA 3NQKA 5B27A 3FELA 2X8TA 4YGGA 3VE2A 1AB0A 3PH5A 1LFOA 1KOIA 4EEJA 3CQRA 1HMSA 1ML7A 2JW1A 1HBPA 3NPOA 4NYQA 4QGWA 2Z4HA 5EDCA 4RUUA 4TKJA 2XSTA 4CV7A 5IO7A 1SY0A 1BBPA 2OZQA 5BYPA 4L3RA 2JMBA 1BWYA 4I6SA 4ID2A 4PSQA 3EYCA 5HZ6A 2R73A 3ZZVA 2Q39A 4GNYA 1SY1A 2L67A 4XMDA 5EEDA 4D6AA 4YDBA 1DV9A 4CSBA 4YBPA 4XMEA 3ZUIA 1HMTA 1QY1A 4N7DA 3FA9A 2MM3A 5HA0A 3HK1A 3TF6A 1CBRA 2FRSA 3FA8A 1BSOA 4NNTA 4OS3A 3STMX 3FW5A 2MO5A 3C77X 3JS1A 1YUPA 1GT1A 3HWFA 2WEWA 3PECA 3VPJE 2LFOA 4U8UM 4FBOA 2K23A 4ZH9A 1L6MA 3B2KA 5EDBA 4BVMA 1BSQA 4DQ4A 2BLGA 2G7BA 3PP6A 1LIBA 4ZGFA 2QOSC 1E00A 4AZOA 3ELXA 1SXYA 4LZUA 3S5VA 1HN2A 3O19A 3S5XA 2XKLA 4AYHA 1FDQA 1DF3A 3NR3A 1MVGA 1TOUA 2ACPX 5EEEA 4D6BA 1VPRA 4M7MA 1LIDA 1YWAA 2NP1A 3DTQA 4OS8A 4Y0QA 3RWXA 5AJCA 3VG3A 1B0OA 1HMRA 4IB9A 4AW8A 5HWZA 1GT3A 1GM6A 4NNSA 1G85A 3HWGA 3FW4A 1Y9LA 1ZNGA 3HWDA 3C76X 1EALA 1SMPI 2L68A 3FENA 4O4XA 1JJXA 3HWEA 2LBAA 2R74A 1DZPA 4A8ZA 4EXZA 5C0NA 5IO5A 4TQ2A 2X45A 3PQUA 3FA6A 4YKMA 4Y0SA 1S2PA 4ZHCA 4ODDA 2ASNX 4WFUA 2GJ5A 1EI5A 4BQUA 4ZGUA 5LKEA 4ZFXA 3KFIA 4XMCA 4YFPA 2NNQA 4NLJA 4IB8A 3FR4A 3P6DA 1ZNDA 4K19A 1DZJA 3BSZE 2JU7A 4U3QA 1X8OA 1D2UA 4HPAA 3CMPA 3P6FA 3S60A 3NBXX 3VG6A 1AELA 3LV4A 1LIEA 4I3BA 3V8UA 1BJ7A 1KT6A 1YP7A 2RA6A 2ZAGA 5CE4A 1CBSA 4LKPA 3RSWA 3WJEA 4MIRA 1QY2A 2GTLN 1RBPA 3C78X 2P8GA 1FE3A 2OVDA 4OMXA 5HBSA 1CBQA 1BRQA 4HPBA 3UEVA 5F1EA 4AZPA 1VYGA 5DG4A 1H91A 1A3YA 3NQ9A 1ERXA 4IABA 4MISA 4QGVA 1MX7A 3E3CA 1NGLA 4OS0A 4ORSA 4GKCA 5JR8A 2JU3A 1Y9TA 1YP6A 3BX7A 3B2JA 4ZR2A 2Q2MA 5HZ9A 1CBIA 4KH8A 2ZAIA 2BS6A 4WHIA 5AJBA 1BEBA 1BM5A 2A0AA 3P24A 5HCDC 4TKBA 3TZSA 1CJ5A 4ZHGA 3FEPA 1IKEA 2ALLX 3BRNA 5HCEC 1UZ2X 1YWCA 2MHDA 1A2DA 1JZUA 1HQPA 2N93A 3NP1A 5H9AA 4O4OA 2QO5A 2GC9A 3KQ0A 2RD7C 4MVLA 3NX1A 3U03A 4M6SA 5D48A 4QZTA 4MVKA 4DQ3A 2OVEA 5CYBA 1SA8A 3AKMA 1GT4A 4GU8A 3D97A 1RLBE 3IA8A 4KCAA 3PQSA 2EU7X 1KGLA 1B8EA 3VG4A 1T68X 5D45A 1ZRYA 1GXAA 4ALBA 4FBRA 1GX8A 5FQ6E 5FFHA 1MDCA 5BVQA 3OD9A 4A1HA 2WR6A 2A3FX 3F8AA 1BLRA 1MX8A 2RCQA 3Q6LA 1KT3A 5F7GA 3ZWEA 5H8TA 4ALOA 5LJCA 5FENA 4ZJ0A 2LA7A 2PY1A 1ICMA 2IFBA 1TW4A 1ERBA 1PEEA 2A13A 3U9PC 1T8VA 5H9LA 2L5PA 3T1DA 1SY2A 3KFFA 4ZCBA 2E4JA 1HBQA 4LKTA 3APWA 3FEKA 5LJBA 4TLJA 5LJGA 5LJDA 3RKGA 3KFHA 5F6ZA 2AL0X 3UEXA 4I3DA 2WEXA 4ORXA 3I0AA 1PMPA 3HTYA 4GZVA 1BRPA 4WFVA 4AZMA 4QQ1A 3WXQA 1GGLA 1X8NA 4UU2A 3BX8A 1XCAA 3EBKA 4ZH6A 3PH6A 4FGIB 1U17A 2W2AA 1I4UA 3ZW0A 1GX9A 3B2HA 4QYNA 3ZW0B 4NYRA 4ZHHA 1I04A 3BY0A 2NNDA 1O8VA 3B2IA 1DZMA 3TGAA 5L8NA 2CM9A 5AQ6A 4XMFA 2X8SA 3U0DA 2POAA 1JIWI 3DSZA 5D47A 4IMNA 1IKJA 2W2BA 3JSQA 2AT8X 5EZ2A 1QQSA 1A57A 1YIVA 2OFRX 3UEWA 4O3ZA 4O4UA 5B29A 5LKFA 2RQ0A 1NP1A 3FIQA 1OBQA 4A1YA 3N91A 4HFOA 2KTSA 4FQBB 2KTDA 1QFVA 1IIUA 2HLVA 3HOEA 4L1NA 1P6PA 3UEUA 3BS2A 3WJCA 4ARHA 3RBYA 1S7DA 2LKKA 2BHVA 1ZNHA 1X8PA 5H9NA 1IFCA 1B56A 1TVQA 2Q9SA 2QO4A 1X89A 3L4RA 1YWBA 3VG5A 5D4AA 1XKIA 1E5PA 3STNA 3JQOA 1EUOA 1KT4A 4LQZA 2CBSA 3OE3A 3MVFA 3UAQA 2QO6A 4O3YA 4KC8A 3K3LA 1QG5A 2A2GA 5FQ7E 3APVA 3WJGA 5KIDA 4KIIA 2ACOA 2GTLO 2ANSA 4GDZA 2HZQA 5LJKA 3BLGA 1EIOA 4NW4A 3SAOA 1EXSA 4EFGA 2FT9A 1OEEA 1TXLA 4HPDA 4LZVA 1JYDA 2CZTA 4GE1A 3GAQA 3NX2A 1VYFA 1FTPA 1BSYA 1QABE 1EW3A 4R0BA 4KT5A 1EPAA 1LF7A 3S26A 2WWPA 1X71A 1KQXA 3WVMA 1T0VA 5F58A 1OBPA 1U18A 3MBTA 1IW2A 4U9CA 5HA1A 1OPAA 1OEKA 2WQAE 2MJIA 3MX7A 4ORRA 2BS5A 2KW1A 4ORUA 4TKHA 1DZKA 1KZXA 5FAZA 3CR6A 2AH7X 5DPQA 2YG2A 2LB6A 3D96A 3IFBA 4Y0PA 5H9KA 2JN3A 4HWMA 2L9CA 1I06A 1E06A 1KQWA 4QNIA 3ZW1A 5LJEA 3KFGA 5HZ5A 3ZW1B 3HOLA 4XMGA 3VG7A 4IMOA 2X8FA 3O22A 4GNWA 4YGZA 2GTLM 5F6BA 2DM5A 1DFVA 4QYPA 4Y0RA 5IO6A 1ICNA 1OEJA 1FEMA 2HZRA 1KXOA 4NLIA 2AT3X 3VE1A 2Z4IA 5KHPA 3B2LA 3P02A 1SY3A 4RUNA 4ES7A 1PM1X 5L8OA 4YCHA 4GH7A 4I9SA 2F09A 1QWDA 3FLLA 5HZ8A 1EPBA 4I9RA 3FA7A 3WJDA 1LPJA 2KT4B 1O1UA 4ML7B 2HNXA 1TOWA 4O3XB 2RN4A 3I17A 2WQ9A 2NNEA 2FS6A 4I95A 3F6ZB 2OFMX 4YBUA 1D3SA 1ZNKA 3WBGA 1Z24A 3EMMA 4YKOA 1PBOA 3P6CA 1YWDA 4AZNA 3ZI8A 1G74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NP4 A;  1X8Q A;  3BU9 A;  2G79 A;  2JOZ A;  5HCC C;  1GT5 A;  3STK A;  2QM9 A;  2AT5 X;  4GRJ A;  1JV4 A;  3FR5 A;  2Q4N A;  1OBU A;  1A18 A;  4TJZ A;  1AVG I;  1LIF A;  4O9S A;  1FEN A;  2HYS A;  1FEL A;  1JBH A;  4CK4 A;  3EBW A;  5K06 A;  1R0U A;  2X46 A;  4YGH A;  5D8J A;  1QY0 A;  5HAE A;  3ZUO A;  1LNM A;  5L8I A;  3VG2 A;  3O2Y A;  3AKN A;  2WSJ A;  2AT6 X;  1GKA A;  4YDA A;  2Q2P A;  1GKA B;  1AQB A;  3APX A;  4ZHD A;  1JYJ A;  2A2U A;  3PED A;  1JJJ A;  3BU1 A;  3D95 A;  3EM0 A;  3BDR A;  1G7N A;  3NAD A;  4XMH A;  1X8U A;  3KZA A;  2FR2 A;  3NQ3 A;  3ELZ A;  4N7C A;  1KZW A;  3APU A;  3P6E A;  2FR3 A;  4IB6 A;  4A60 A;  2F73 A;  1S44 A;  3OJY C;  1LIC A;  4QZU A;  2LBV A;  1B4M A;  2G78 A;  5HTD A;  2AMM X;  2GTF X;  4ZHF A;  4TNN A;  4YCE A;  3P6G A;  4IAX A;  2R56 A;  1SXW A;  1G5W A;  3FR2 A;  2CM4 A;  2CZU A;  1ZNE A;  4IB7 A;  1EQD A;  4QGX A;  5BVS A;  5HZQ A;  2RCT A;  1URE A;  2HMB A;  4IAW A;  1EII A;  1DC9 A;  1O1V A;  1IFB A;  4AZR A;  1U0X A;  2W2F A;  4BOE A;  3RZY A;  3QKG A;  1OPB A;  1ALB A;  3TGB A;  2O62 A;  5EPQ A;  5KIC A;  2K62 A;  3TGC A;  5LJH A;  2WUT A;  4GET A;  3CBS A;  1QFT A;  1E02 A;  2FS7 A;  3CBC A;  4EDE A;  4I3C A;  4MVI A;  4ORW A;  1I05 A;  4HPC A;  4QAE A;  5HTE A;  1MUP A;  3CQN A;  3ZQ3 A;  2FWV A;  2AKQ A;  4ORY A;  1SXU A;  3WJB A;  2JU8 A;  4UU3 A;  4NP1 A;  1SXX A;  2FLJ A;  4YFR A;  3FMZ A;  1KT7 A;  3PPT A;  5BVT A;  3G7X A;  1ADL A;  2OVA A;  3CWK A;  1KT5 A;  3WJF A;  4YMY A;  1LKE A;  4IBA A;  4OMW A;  2FTB A;  1ACD A;  4WBK A;  1ZNL A;  4YH0 A;  2CBR A;  4AZQ A;  1N0S A;  2AT0 X;  4YFQ A;  3F9D A;  3P6H A;  1CRB A;  5B27 A;  3FEL A;  4YGG A;  1AB0 A;  3PH5 A;  1LFO A;  1KOI A;  4EEJ A;  3CQR A;  1HMS A;  1ML7 A;  3NPO A;  1HBP A;  4NYQ A;  4QGW A;  5EDC A;  4RUU A;  4TKJ A;  2XST A;  5IO7 A;  1SY0 A;  1BBP A;  2OZQ A;  1BWY A;  4PSQ A;  3EYC A;  5HZ6 A;  2R73 A;  2Q39 A;  4GNY A;  1SY1 A;  2L67 A;  4XMD A;  5EED A;  4D6A A;  4YDB A;  1DV9 A;  4YBP A;  4XME A;  3ZUI A;  1HMT A;  1QY1 A;  4N7D A;  3FA9 A;  2MM3 A;  5HA0 A;  3HK1 A;  3TF6 A;  1CBR A;  2FRS A;  3FA8 A;  1BSO A;  4NNT A;  4OS3 A;  3STM X;  3FW5 A;  2MO5 A;  3C77 X;  3JS1 A;  1YUP A;  1GT1 A;  3HWF A;  2WEW A;  3PEC A;  2LFO A;  2K23 A;  4ZH9 A;  1L6M A;  3B2K A;  5EDB A;  4BVM A;  1BSQ A;  4DQ4 A;  2BLG A;  2G7B A;  3PP6 A;  1LIB A;  2QOS C;  1E00 A;  4AZO A;  3ELX A;  1SXY A;  4LZU A;  1HN2 A;  3O19 A;  1DF3 A;  2XKL A;  4AYH A;  1FDQ A;  3NR3 A;  1MVG A;  1TOU A;  2ACP X;  5EEE A;  4D6B A;  1VPR A;  4M7M A;  1LID A;  1YWA A;  2NP1 A;  3DTQ A;  4OS8 A;  4Y0Q A;  4AW8 A;  5HWZ A;  3VG3 A;  1B0O A;  1HMR A;  4IB9 A;  1GT3 A;  1GM6 A;  4NNS A;  1G85 A;  3HWG A;  3FW4 A;  1ZNG A;  3HWD A;  3C76 X;  1EAL A;  2L68 A;  3FEN A;  1JJX A;  3HWE A;  2LBA A;  2R74 A;  1DZP A;  4A8Z A;  4EXZ A;  5C0N A;  5IO5 A;  4TQ2 A;  2X45 A;  3FA6 A;  4YKM A;  4Y0S A;  1S2P A;  4ZHC A;  4ODD A;  2ASN X;  4WFU A;  2GJ5 A;  4BQU A;  4ZGU A;  5LKE A;  4ZFX A;  3KFI A;  4XMC A;  4YFP A;  2NNQ A;  4NLJ A;  4IB8 A;  3FR4 A;  3P6D A;  1ZND A;  4K19 A;  1DZJ A;  3BSZ E;  2JU7 A;  1X8O A;  1D2U A;  4HPA A;  3CMP A;  3P6F A;  3VG6 A;  1AEL A;  1LIE A;  4I3B A;  1BJ7 A;  1KT6 A;  1YP7 A;  2RA6 A;  5CE4 A;  1CBS A;  4LKP A;  3RSW A;  3WJE A;  1QY2 A;  3C78 X;  1RBP A;  2P8G A;  1FE3 A;  2OVD A;  4OMX A;  5HBS A;  1CBQ A;  1BRQ A;  4HPB A;  3UEV A;  5F1E A;  4AZP A;  1VYG A;  5DG4 A;  1H91 A;  1A3Y A;  3NQ9 A;  1ERX A;  4QGV A;  1MX7 A;  1NGL A;  4OS0 A;  4ORS A;  4GKC A;  5JR8 A;  2JU3 A;  1YP6 A;  3BX7 A;  3B2J A;  4ZR2 A;  2Q2M A;  5HZ9 A;  1CBI A;  1BEB A;  1BM5 A;  2A0A A;  5HCD C;  4TKB A;  3TZS A;  1CJ5 A;  4ZHG A;  3FEP A;  1IKE A;  2ALL X;  3BRN A;  5HCE C;  1UZ2 X;  1YWC A;  1A2D A;  1JZU A;  1HQP A;  2N93 A;  3NP1 A;  5H9A A;  2QO5 A;  2GC9 A;  3KQ0 A;  2RD7 C;  4MVL A;  3NX1 A;  3U03 A;  4M6S A;  5D48 A;  4QZT A;  4MVK A;  4DQ3 A;  2OVE A;  1SA8 A;  3AKM A;  1GT4 A;  3D97 A;  1RLB E;  3IA8 A;  2EU7 X;  1KGL A;  1B8E A;  3VG4 A;  1T68 X;  5D45 A;  1ZRY A;  1GXA A;  4ALB A;  1GX8 A;  5BVQ A;  5FFH A;  1MDC A;  4A1H A;  2WR6 A;  2A3F X;  3F8A A;  1BLR A;  2RCQ A;  1MX8 A;  3Q6L A;  1KT3 A;  5F7G A;  5H8T A;  4ALO A;  5LJC A;  5FEN A;  4ZJ0 A;  2PY1 A;  1ICM A;  2IFB A;  1TW4 A;  1ERB A;  1PEE A;  2A13 A;  3U9P C;  1T8V A;  5H9L A;  2L5P A;  3T1D A;  1SY2 A;  3KFF A;  4ZCB A;  2E4J A;  1HBQ A;  4LKT A;  3APW A;  3FEK A;  5LJB A;  4TLJ A;  5LJG A;  5LJD A;  3KFH A;  5F6Z A;  2AL0 X;  3UEX A;  4I3D A;  2WEX A;  4ORX A;  3I0A A;  1PMP A;  1BRP A;  4WFV A;  4AZM A;  3WXQ A;  1GGL A;  1X8N A;  4UU2 A;  3BX8 A;  1XCA A;  3EBK A;  4ZH6 A;  3PH6 A;  1U17 A;  2W2A A;  1I4U A;  1GX9 A;  3B2H A;  4QYN A;  4NYR A;  4ZHH A;  1I04 A;  3BY0 A;  2NND A;  1O8V A;  3B2I A;  1DZM A;  3TGA A;  5L8N A;  2CM9 A;  5AQ6 A;  4XMF A;  3U0D A;  2POA A;  3DSZ A;  5D47 A;  4IMN A;  1IKJ A;  2W2B A;  3JSQ A;  2AT8 X;  5EZ2 A;  1QQS A;  1A57 A;  1YIV A;  2OFR X;  3UEW A;  5B29 A;  5LKF A;  2RQ0 A;  1NP1 A;  3FIQ A;  1OBQ A;  4A1Y A;  4HFO A;  2KTD A;  1QFV A;  1IIU A;  2HLV A;  3UEU A;  1P6P A;  3BS2 A;  3WJC A;  4ARH A;  1S7D A;  2LKK A;  1ZNH A;  1X8P A;  5H9N A;  1IFC A;  1B56 A;  1TVQ A;  2Q9S A;  2QO4 A;  1X89 A;  3L4R A;  1YWB A;  3VG5 A;  5D4A A;  1XKI A;  1E5P A;  3STN A;  1EUO A;  1KT4 A;  2CBS A;  3MVF A;  2QO6 A;  3K3L A;  1QG5 A;  2A2G A;  3APV A;  3WJG A;  5KID A;  4KII A;  2ACO A;  2ANS A;  2HZQ A;  5LJK A;  3BLG A;  1EIO A;  3SAO A;  1EXS A;  4EFG A;  2FT9 A;  1OEE A;  1TXL A;  4HPD A;  4LZV A;  1JYD A;  2CZT A;  4GE1 A;  3GAQ A;  3NX2 A;  1VYF A;  1FTP A;  1BSY A;  1QAB E;  1EW3 A;  4R0B A;  1EPA A;  1LF7 A;  3S26 A;  2WWP A;  1X71 A;  1KQX A;  3WVM A;  1T0V A;  5F58 A;  1OBP A;  1U18 A;  3MBT A;  1IW2 A;  5HA1 A;  1OPA A;  1OEK A;  2WQA E;  2MJI A;  4ORR A;  4TKH A;  4ORU A;  1DZK A;  1KZX A;  5FAZ A;  3CR6 A;  2AH7 X;  5DPQ A;  2YG2 A;  2LB6 A;  3D96 A;  3IFB A;  4Y0P A;  5H9K A;  2JN3 A;  2L9C A;  1I06 A;  1E06 A;  1KQW A;  5LJE A;  3KFG A;  5HZ5 A;  4XMG A;  3VG7 A;  4IMO A;  4GNW A;  3O22 A;  4YGZ A;  5F6B A;  2DM5 A;  1DFV A;  4QYP A;  4Y0R A;  5IO6 A;  1ICN A;  1OEJ A;  1FEM A;  2HZR A;  1KXO A;  4NLI A;  2AT3 X;  5KHP A;  3B2L A;  1SY3 A;  4RUN A;  4ES7 A;  1PM1 X;  5L8O A;  4YCH A;  4GH7 A;  4I9S A;  1QWD A;  3FLL A;  5HZ8 A;  1EPB A;  4I9R A;  3FA7 A;  3WJD A;  1LPJ A;  2KT4 B;  1O1U A;  2HNX A;  1TOW A;  3I17 A;  2WQ9 A;  2NNE A;  2FS6 A;  2OFM X;  4YBU A;  1D3S A;  1ZNK A;  3WBG A;  1Z24 A;  3EMM A;  4YKO A;  1PBO A;  3P6C A;  1YWD A;  4AZN A;  1G74 A; 
#chains in the Genus database with same CATH topology
 1NP4 A;  1NDJ A;  1X8Q A;  2BT9 A;  3BU9 A;  2G79 A;  2JOZ A;  5HCC C;  1VWB B;  3RDU A;  1GT5 A;  1SRJ A;  3STK A;  2QM9 A;  2QMI A;  2AT5 X;  3LTW A;  1JV4 A;  3FR5 A;  2Q4N A;  1OBU A;  4GRJ A;  4I60 A;  2M4L A;  1A18 A;  4TJZ A;  4FBV A;  1AVG I;  1LIF A;  4O9S A;  1FEN A;  1FJ1 E;  2RTL A;  2HYS A;  1FEL A;  1JBH A;  4KC7 A;  4CK4 A;  3EBW A;  4Z2P A;  5K06 A;  3GE2 A;  1R0U A;  2X46 A;  4YGH A;  4NV7 A;  1QY0 A;  5D8J A;  5HAE A;  3ZUO A;  1AVD A;  1LNM A;  4O49 A;  5L8I A;  3VG2 A;  3O2Y A;  3VHH A;  3AKN A;  1Y53 X;  2WSJ A;  2AT6 X;  1GKA A;  4YDA A;  5B5F A;  2OL8 O;  2Q2P A;  1GKA B;  1AQB A;  2I5V O;  3APX A;  4ZHD A;  1JYJ A;  3PK2 A;  3OBL A;  2A2U A;  3PED A;  4GDA A;  1JJJ A;  3SOT A;  3BU1 A;  3D95 A;  3EM0 A;  3BDR A;  1G7N A;  3NAD A;  4XMH A;  1X8U A;  4BJ8 A;  2HKD A;  3KZA A;  2FR2 A;  4CDE A;  1PBY A;  3NQ3 A;  2VFC A;  3ELZ A;  4N7C A;  3APU A;  1KZW A;  3P6E A;  2FR3 A;  4IB6 A;  3WOV A;  2F73 A;  1S44 A;  3OJY C;  1LIC A;  4QZU A;  1VWM B;  2LBV A;  1B4M A;  2G78 A;  5HTD A;  2AMM X;  2GTF X;  3H3I A;  2G5L A;  4ZHF A;  2RTF B;  4TNN A;  4YCE A;  2RTG B;  3P6G A;  4IAX A;  2OY8 A;  2R56 A;  5FQ8 E;  1SXW A;  2RTO B;  1G5W A;  3FR2 A;  2CM4 A;  3SLO A;  2CZU A;  1ZNE A;  4IB7 A;  1EQD A;  4QGX A;  5BVS A;  5HZQ A;  2RCT A;  3VU1 A;  1URE A;  2RTP B;  1YWD A;  2HMB A;  4IAW A;  1EII A;  1DC9 A;  4O4S A;  1O1V A;  1IFB A;  2MWH A;  4AZR A;  1U0X A;  2W2F A;  4INN A;  4BOE A;  5AEO A;  3RZY A;  1WUB A;  1JMX A;  3QKG A;  1OPB A;  1ALB A;  4EQA C;  1VWI B;  3TGB A;  3RE6 A;  3D4R A;  2O62 A;  4O3W A;  5EPQ A;  5KIC A;  1VWE B;  2K62 A;  1VWP B;  1NQN A;  4JGL A;  4U8U N;  3TGC A;  3RDQ A;  5LJH A;  2WUT A;  4GET A;  3CBS A;  2A5C A;  1QFT A;  2CAM A;  1IJ8 A;  1E02 A;  2FS7 A;  2IZC B;  1RXJ A;  3CBC A;  1UYN X;  4I3C A;  4MVI A;  2YMS A;  4COT A;  4ORW A;  1VWJ B;  2OVS A;  4Y59 A;  1I05 A;  4HPC A;  4QAE A;  1SWS A;  1VWL B;  5HTE A;  1MUP A;  4ON1 A;  3CQN A;  4QRL A;  3ZQ3 A;  2FWV A;  4U8U O;  2AKQ A;  2UZ2 A;  4ORY A;  1SXU A;  2KD2 A;  3WJB A;  2JU8 A;  4Z6J A;  4UU3 A;  4NP1 A;  1SXX A;  2FLJ A;  4YFR A;  3FMZ A;  1KT7 A;  2RTK A;  1MK5 A;  3PPT A;  2BSZ A;  5BVT A;  3G7X A;  1ADL A;  4PJ2 A;  2OVA A;  3CWK A;  4MVE A;  5HZ6 A;  1KT5 A;  1RXH A;  1WBI A;  2OFB A;  3WJF A;  4YMY A;  1LKE A;  3RDX A;  4IBA A;  4OMW A;  2FTB A;  1ACD A;  3FYF A;  3LHN A;  4WBK A;  4BX5 A;  1ZNL A;  4OKA A;  4YH0 A;  2CBR A;  1I9H A;  4AZQ A;  3KVN A;  3ZW2 A;  1N0S A;  2AT0 X;  4YFQ A;  3WZQ A;  3F9D A;  3P6H A;  4GK9 A;  1DV9 A;  1CRB A;  3NQK A;  5B27 A;  3FEL A;  2X8T A;  4YGG A;  3VE2 A;  1AB0 A;  3PH5 A;  1LFO A;  1KOI A;  4EEJ A;  3CQR A;  1HMS A;  1ML7 A;  2JW1 A;  1HBP A;  3NPO A;  1SWG A;  4NYQ A;  2Z4H A;  4QGW A;  5EDC A;  5B11 O;  4RUU A;  4TKJ A;  2XST A;  4CV7 A;  2X34 A;  3RDM A;  5IO7 A;  3T6F A;  4BBO A;  1SY0 A;  1BBP A;  1SLE B;  1N4J A;  3AUM O;  5B10 O;  2OZQ A;  5BYP A;  4L3R A;  2JMB A;  1SWA A;  1BWY A;  4I6S A;  4ID2 A;  4PSQ A;  2Y32 A;  3EYC A;  2R73 A;  3ZZV A;  2Q39 A;  4GNY A;  1SY1 A;  2L67 A;  4XMD A;  5EED A;  4D6A A;  1VWD B;  2X4M A;  2BC3 A;  4YDB A;  4CSB A;  4DNE A;  4XME A;  3ZUI A;  4YBP A;  1HMT A;  1QY1 A;  4N7D A;  3FA9 A;  4MEE A;  2MM3 A;  5HA0 A;  3HK1 A;  3TF6 A;  1CBR A;  2FRS A;  3FA8 A;  1BSO A;  4NNT A;  4OS3 A;  3STM X;  2OL6 O;  3WYQ A;  3FW5 A;  2MO5 A;  3C77 X;  3JS1 A;  1YUP A;  1GT1 A;  1SWU A;  3HWF A;  2WEW A;  1E2T A;  3PEC A;  2LFO A;  4U8U M;  4FBO A;  3VPJ E;  2K23 A;  1VWR B;  4IRW A;  1SWK A;  1L6M A;  3B2K A;  5EDB A;  4ZH9 A;  4BVM A;  1BSQ A;  4DQ4 A;  2BLG A;  2G7B A;  3PP6 A;  1LIB A;  3SZH A;  4ZGF A;  2QOS C;  1E00 A;  1NBX A;  4AZO A;  3ELX A;  1SXY A;  4LZU A;  1SLF B;  3S5V A;  1HN2 A;  3O19 A;  3S5X A;  2XKL A;  4AYH A;  1FDQ A;  1DF3 A;  3NR3 A;  1MVG A;  1TOU A;  2ACP X;  2RTA A;  5EEE A;  4D6B A;  1VPR A;  1STP A;  4M7M A;  1LID A;  1YWA A;  2NP1 A;  3DTQ A;  4OS8 A;  4Y0Q A;  3RWX A;  5AJC A;  3T6L A;  1B0O A;  1HMR A;  4IB9 A;  3VG3 A;  4AW8 A;  5HWZ A;  1GT3 A;  1GM6 A;  4NNS A;  4Y5D A;  3SLJ A;  5CHK A;  2C1S A;  1G85 A;  1VWK B;  3HWG A;  3FW4 A;  1Y9L A;  1ZNG A;  3HWD A;  3C76 X;  3WYP A;  1EAL A;  1KL3 A;  1SMP I;  2L68 A;  3AEH A;  3FEN A;  4O4X A;  1JJX A;  5L3Y A;  3HWE A;  2LBA A;  2R74 A;  1DZP A;  4A8Z A;  4EKV A;  4EXZ A;  5C0N A;  5IO5 A;  4TQ2 A;  2X45 A;  3PQU A;  1SRI A;  3FA6 A;  4YKM A;  1SWF A;  4Y0S A;  1S2P A;  4ZHC A;  4ODD A;  2ASN X;  1KL4 A;  1DF8 A;  2GJ5 A;  1EI5 A;  4WFU A;  4BQU A;  4ZGU A;  5LKE A;  4ZFX A;  3KFI A;  4XMC A;  2ZSC A;  2NNQ A;  4YFP A;  4NLJ A;  1LDQ A;  1SWH A;  4IB8 A;  3EW2 A;  3FR4 A;  1PTS A;  3P6D A;  1ZND A;  4K19 A;  1DZJ A;  3BSZ E;  4EDE A;  1VWG B;  2JU7 A;  4U3Q A;  1X8O A;  1D2U A;  3WZP A;  1SRF A;  4HPA A;  3CMP A;  3P6F A;  1UYO X;  2JGS A;  3S60 A;  3NBX X;  2QCB A;  3VG6 A;  3LV4 A;  1AEL A;  4OEL A;  1LIE A;  4I3B A;  2MF6 A;  3V8U A;  1BJ7 A;  1KT6 A;  1YP7 A;  2RA6 A;  2X56 A;  2ZAG A;  1CBS A;  4LKP A;  5CE4 A;  3RSW A;  4Z27 A;  3WJE A;  3QQ2 A;  4MIR A;  1QY2 A;  2IZI A;  2UYW A;  1GX3 A;  2X55 A;  2GTL N;  1RBP A;  3C78 X;  2RTQ B;  1SWT A;  3WZO A;  2P8G A;  1FE3 A;  2OVD A;  4OMX A;  5HBS A;  3SZI A;  1CBQ A;  2Y3F A;  5CSE A;  1BRQ A;  4HPB A;  3UEV A;  5F1E A;  1LCZ A;  1VYG A;  2FKG A;  1RXK A;  4AZP A;  5DG4 A;  1H91 A;  1A3Y A;  3NQ9 A;  3T2W A;  1ERX A;  4IAB A;  4MIS A;  4QGV A;  1MX7 A;  3E3C A;  1NGL A;  4OS0 A;  4ORS A;  4GKC A;  2OY7 A;  5JR8 A;  2JU3 A;  1Y9T A;  1YP6 A;  3BX7 A;  3B2J A;  4ZR2 A;  1KL5 A;  1SRG A;  2Q2M A;  5HZ9 A;  1N7Y A;  1CBI A;  4KH8 A;  1VWF B;  2BS6 A;  2ZAI A;  2RTH B;  1HQQ A;  2IZK A;  4WHI A;  1BEB A;  5AJB A;  2A0A A;  3P24 A;  4B55 A;  4YVB A;  4TKB A;  5HCD C;  3TZS A;  1BM5 A;  4JHQ A;  4ZHG A;  1CJ5 A;  3FEP A;  1IKE A;  2ALL X;  3BRN A;  4U46 A;  5HCE C;  1UZ2 X;  1VWH B;  4BX7 B;  1YWC A;  2MHD A;  1A2D A;  2IZG B;  1JZU A;  3RY2 A;  1HQP A;  2N93 A;  2QOM A;  3NP1 A;  5H9A A;  1SWN A;  2QO5 A;  4O4O A;  2GC9 A;  4CDC A;  3KQ0 A;  2RD7 C;  4MVL A;  3NX1 A;  3U03 A;  1OSP O;  4M6S A;  5D48 A;  4QZT A;  4GGR A;  4MVK A;  4DQ3 A;  2RTM A;  2OVE A;  3CKF A;  5CYB A;  1SA8 A;  3AKM A;  1SWP A;  1GT4 A;  1SWO A;  3D97 A;  4GU8 A;  1RLB E;  3IA8 A;  4KCA A;  2FHN X;  1NQM A;  3PQS A;  2EU7 X;  4NV8 A;  1B8E A;  1KGL A;  1SLD B;  3VG4 A;  1T68 X;  5D45 A;  2WPU A;  1ZRY A;  2RTB B;  2X32 A;  1GXA A;  4ALB A;  4DCB A;  1N43 A;  4JNJ A;  4FBR A;  1GX8 A;  2OL7 A;  5FFH A;  1MDC A;  5FQ6 E;  5BVQ A;  3OD9 A;  4A1H A;  2WR6 A;  1VYO A;  2A3F X;  2IZE B;  3F8A A;  1BLR A;  1MX8 A;  2RCQ A;  3Q6L A;  1KT3 A;  5F7G A;  1SWR A;  5H8T A;  3ZWE A;  5K68 A;  4ALO A;  5LJC A;  2A5B A;  5FEN A;  4ZJ0 A;  2LA7 A;  2PY1 A;  1ICM A;  2IFB A;  1TW4 A;  1ERB A;  2OF8 A;  1PEE A;  2A13 A;  3U9P C;  1T8V A;  5H9L A;  2L5P A;  3T1D A;  1SY2 A;  2IZA A;  3KFF A;  4ZCB A;  2E4J A;  1HBQ A;  3MG5 A;  4LKT A;  1W4T A;  3APW A;  1MEP A;  3FEK A;  5LJB A;  4TLJ A;  5LJG A;  5LJD A;  3RKG A;  3KFH A;  2VDF A;  5F6Z A;  2AL0 X;  3WZN A;  3UEX A;  4I3D A;  2WEX A;  1VWN B;  4ORX A;  3I0A A;  2IZH B;  1PMP A;  1SRE A;  1RAV A;  5JD2 A;  1STS B;  3HTY A;  4GZV A;  1BRP A;  4WFV A;  4AZM A;  4QQ1 A;  3WXQ A;  4C5P A;  1X8N A;  3MM0 A;  3BX8 A;  1XCA A;  2G8C O;  3EBK A;  4UU2 A;  5B2A O;  4ZH6 A;  3PH6 A;  3T2X A;  4FGI B;  5IRW A;  1SWC A;  1U17 A;  2W2A A;  1I4U A;  3ZW0 A;  4GJV A;  1KFF A;  1GX9 A;  2IZJ A;  1N9M A;  3B2H A;  3VGW A;  4QYN A;  3ZW0 B;  1SWL A;  4BGF A;  3FDC A;  4NYR A;  1LEL A;  4ZHH A;  3X00 A;  2OY1 O;  1Y0G A;  1I04 A;  1AVE A;  1HXL A;  1O8V A;  2NND A;  3B2I A;  1DZM A;  1SWB A;  3BY0 A;  4GGT A;  3TGA A;  2OY5 O;  5L8N A;  5K67 A;  2CM9 A;  5AQ6 A;  1N9Y A;  2X8S A;  4XMF A;  3U0D A;  2POA A;  2AVI A;  1JIW I;  2IZB A;  3DSZ A;  4BCS A;  2IZD B;  5D47 A;  2Y3E A;  4IMN A;  4Z28 A;  1IKJ A;  2W2B A;  3JSQ A;  2AT8 X;  5EZ2 A;  1QQS A;  1A57 A;  1YIV A;  1K24 A;  2OFR X;  1VWA B;  5F2B A;  3UEW A;  1HXZ A;  5B3M O;  4O3Z A;  4O4U A;  5B29 A;  5LKF A;  3RY1 A;  1K3B A;  2RQ0 A;  1VWQ B;  1NP1 A;  3FIQ A;  3SZJ A;  1OBQ A;  4A1Y A;  3N91 A;  4HFO A;  1LCV A;  2KTS A;  2PI3 O;  4FQB B;  4CDD A;  2KTD A;  1QFV A;  1IIU A;  2F01 A;  2HLV A;  3HOE A;  4GGZ A;  1LCW A;  1P6P A;  2C4I A;  1SWE A;  3BS2 A;  4L1N A;  3UEU A;  3RBY A;  3WJC A;  1S7D A;  4ARH A;  2LKK A;  5IXG A;  3VHI A;  2BHV A;  1ZNH A;  4JO6 A;  1X8P A;  1W5R A;  5H9N A;  5IRU A;  1IFC A;  1B56 A;  1TVQ A;  2Q9S A;  2QO4 A;  1X89 A;  3L4R A;  4Z2O A;  1YWB A;  2GH7 A;  5B5G A;  1HY2 A;  5D4A A;  3VG5 A;  1MOY A;  1XKI A;  1E5P A;  4GD9 A;  2OYB O;  4Z2V A;  3STN A;  3JQO A;  1EUO A;  1KT4 A;  4LQZ A;  2CBS A;  1RST B;  3MVF A;  3OE3 A;  3UAQ A;  2QO6 A;  4O3Y A;  4KC8 A;  3K3L A;  1QG5 A;  2A2G A;  5FQ7 E;  3APV A;  1JJU A;  4GJS A;  3WJG A;  3VHM A;  5KID A;  4KII A;  2ACO A;  3EW1 A;  2GTL O;  2ANS A;  4GDZ A;  2HZQ A;  5LJK A;  3BLG A;  1SWQ A;  2OF9 A;  1EIO A;  4NW4 A;  2IZF B;  3SAO A;  1EXS A;  1SRH A;  4EFG A;  2FT9 A;  1OEE A;  1TXL A;  2FGS A;  4HPD A;  4LZV A;  1JYD A;  2FKJ A;  2CZT A;  4GE1 A;  4BX7 A;  3GAQ A;  3NX2 A;  1VYF A;  1FTP A;  1BSY A;  1LDO A;  1QAB E;  2RTI B;  1EW3 A;  4R0B A;  4KT5 A;  1EPA A;  1LF7 A;  3PDF A;  1VWO B;  2A8G A;  3S26 A;  2WWP A;  1X71 A;  1KQX A;  3WVM A;  1T0V A;  5F58 A;  1OBP A;  1U18 A;  3MBT A;  1VWC B;  1IW2 A;  2IZL B;  4U9C A;  5HA1 A;  3EC5 A;  1OPA A;  4BX6 A;  1OEK A;  2WQA E;  1JMZ A;  2DJG A;  2MJI A;  3MX7 A;  4ORR A;  1RSU B;  5IRA A;  4BX6 B;  1SWJ A;  2BS5 A;  2KW1 A;  4ORU A;  4TKH A;  1DZK A;  1JQP A;  4CPF A;  2VFB A;  5FAZ A;  1KZX A;  3CKG A;  3CR6 A;  2AH7 X;  4A60 A;  5DPQ A;  2YG2 A;  2LB6 A;  3D96 A;  3IFB A;  2DJF A;  4Y0P A;  5H9K A;  4CPE A;  3SLT A;  2JN3 A;  4HWM A;  4CDF A;  4CPI A;  2L9C A;  1I06 A;  1SWD A;  1E06 A;  1KQW A;  2OFA A;  4QNI A;  3ZW1 A;  3KFG A;  5LJE A;  5HZ5 A;  1STR B;  2AF5 A;  3ZW1 B;  3HOL A;  2RTJ A;  4XMG A;  3VG7 A;  4IMO A;  2X8F A;  2C1Q A;  3O22 A;  4GNW A;  4YGZ A;  4BX5 B;  2GTL M;  1MM9 A;  2DM5 A;  1DFV A;  5F6B A;  4QYP A;  1Y55 X;  4Y0R A;  5IO6 A;  1ICN A;  1LUQ A;  2FHL A;  1OEJ A;  1FEM A;  2HZR A;  1KXO A;  2I5Z O;  2AT3 X;  4NLI A;  2Z4I A;  3VE1 A;  5KHP A;  3B2L A;  3P02 A;  1SY3 A;  4RUN A;  4ES7 A;  1PM1 X;  3D9W A;  5L8O A;  4YCH A;  4GH7 A;  4I9S A;  1I78 A;  2F09 A;  1Y52 X;  2RTE B;  1QWD A;  3FLL A;  5HZ8 A;  2RTC B;  2RTN B;  1EPB A;  1SLG B;  4I9R A;  4OEM A;  3FA7 A;  3RDS A;  3WJD A;  2RTR B;  1LPJ A;  2KT4 B;  1W6F A;  3FID A;  3HPE A;  1O1U A;  4ML7 B;  2HNX A;  1TOW A;  1NC9 A;  4O3X B;  2RN4 A;  3I17 A;  2WQ9 A;  2NNE A;  3RDO A;  4CPH A;  2FS6 A;  4I95 A;  3RE5 A;  3F6Z B;  2RTD B;  2OFM X;  4YBU A;  1D3S A;  4CPH B;  4GUZ A;  1ZNK A;  3WBG A;  1Z24 A;  3EMM A;  3Q34 A;  4YKO A;  1PBO A;  3P6C A;  1GGL A;  4AZN A;  3ZI8 A;  1G74 A; 
#chains in the Genus database with same CATH homology
 1NP4 A;  1X8Q A;  2BT9 A;  3BU9 A;  2G79 A;  2JOZ A;  5HCC C;  1GT5 A;  3STK A;  2QM9 A;  2QMI A;  2AT5 X;  4GRJ A;  1JV4 A;  3FR5 A;  2Q4N A;  1OBU A;  2M4L A;  1A18 A;  4TJZ A;  4FBV A;  1AVG I;  1LIF A;  4O9S A;  1FEN A;  2HYS A;  1FEL A;  1JBH A;  4KC7 A;  4CK4 A;  3EBW A;  5K06 A;  3GE2 A;  1R0U A;  2X46 A;  4YGH A;  5D8J A;  1QY0 A;  5HAE A;  3ZUO A;  1LNM A;  4O49 A;  5L8I A;  3VG2 A;  3O2Y A;  3AKN A;  2WSJ A;  2AT6 X;  1GKA A;  4YDA A;  2Q2P A;  1GKA B;  1AQB A;  3APX A;  4ZHD A;  1JYJ A;  3OBL A;  2A2U A;  3PED A;  1JJJ A;  3SOT A;  3BU1 A;  3D95 A;  3EM0 A;  3BDR A;  1G7N A;  3NAD A;  4XMH A;  1X8U A;  3KZA A;  2FR2 A;  3NQ3 A;  3ELZ A;  4N7C A;  1KZW A;  3APU A;  3P6E A;  2FR3 A;  4IB6 A;  3WOV A;  2F73 A;  1S44 A;  3OJY C;  1LIC A;  4QZU A;  2LBV A;  4A60 A;  1B4M A;  2G78 A;  5HTD A;  2AMM X;  2GTF X;  3H3I A;  4ZHF A;  4TNN A;  4YCE A;  3P6G A;  4IAX A;  2R56 A;  5FQ8 E;  1SXW A;  1G5W A;  3FR2 A;  2CM4 A;  2CZU A;  1ZNE A;  4IB7 A;  1EQD A;  4QGX A;  5BVS A;  5HZQ A;  2RCT A;  3VU1 A;  1URE A;  2HMB A;  4IAW A;  1EII A;  1DC9 A;  4O4S A;  1O1V A;  1IFB A;  2MWH A;  4AZR A;  1U0X A;  2W2F A;  4INN A;  4BOE A;  5AEO A;  3RZY A;  3QKG A;  1OPB A;  1ALB A;  4EQA C;  3TGB A;  3D4R A;  2O62 A;  4O3W A;  5EPQ A;  5KIC A;  2K62 A;  4U8U N;  4JGL A;  3TGC A;  5LJH A;  2WUT A;  4GET A;  3CBS A;  1QFT A;  1E02 A;  2FS7 A;  3CBC A;  4EDE A;  4I3C A;  4MVI A;  2YMS A;  4COT A;  4ORW A;  2OVS A;  1I05 A;  4HPC A;  4QAE A;  5HTE A;  1MUP A;  4ON1 A;  3CQN A;  4QRL A;  3ZQ3 A;  2FWV A;  4U8U O;  2AKQ A;  4ORY A;  1SXU A;  2KD2 A;  3WJB A;  2JU8 A;  4UU3 A;  4NP1 A;  1SXX A;  2FLJ A;  4YFR A;  3FMZ A;  1KT7 A;  3PPT A;  5BVT A;  3G7X A;  1ADL A;  4PJ2 A;  2OVA A;  3CWK A;  4MVE A;  1KT5 A;  3WJF A;  4YMY A;  1LKE A;  4IBA A;  4OMW A;  2FTB A;  1ACD A;  3FYF A;  3LHN A;  4WBK A;  1ZNL A;  4YH0 A;  2CBR A;  4AZQ A;  3ZW2 A;  1N0S A;  2AT0 X;  4YFQ A;  3F9D A;  3P6H A;  4GK9 A;  1CRB A;  3NQK A;  5B27 A;  3FEL A;  2X8T A;  4YGG A;  3VE2 A;  1AB0 A;  3PH5 A;  1LFO A;  1KOI A;  4EEJ A;  3CQR A;  1HMS A;  1ML7 A;  2JW1 A;  1HBP A;  3NPO A;  4NYQ A;  4QGW A;  2Z4H A;  5EDC A;  4RUU A;  4TKJ A;  2XST A;  4CV7 A;  5IO7 A;  1SY0 A;  1BBP A;  2OZQ A;  5BYP A;  4L3R A;  2JMB A;  1BWY A;  4I6S A;  4ID2 A;  4PSQ A;  3EYC A;  5HZ6 A;  2R73 A;  3ZZV A;  2Q39 A;  4GNY A;  1SY1 A;  2L67 A;  4XMD A;  5EED A;  4D6A A;  4YDB A;  1DV9 A;  4CSB A;  4YBP A;  4XME A;  3ZUI A;  1HMT A;  1QY1 A;  4N7D A;  3FA9 A;  2MM3 A;  5HA0 A;  3HK1 A;  3TF6 A;  1CBR A;  2FRS A;  3FA8 A;  1BSO A;  4NNT A;  4OS3 A;  3STM X;  3FW5 A;  2MO5 A;  3C77 X;  3JS1 A;  1YUP A;  1GT1 A;  3HWF A;  2WEW A;  3PEC A;  3VPJ E;  2LFO A;  4U8U M;  4FBO A;  2K23 A;  4ZH9 A;  1L6M A;  3B2K A;  5EDB A;  4BVM A;  1BSQ A;  4DQ4 A;  2BLG A;  2G7B A;  3PP6 A;  1LIB A;  4ZGF A;  2QOS C;  1E00 A;  4AZO A;  3ELX A;  1SXY A;  4LZU A;  3S5V A;  1HN2 A;  3O19 A;  3S5X A;  2XKL A;  4AYH A;  1FDQ A;  1DF3 A;  3NR3 A;  1MVG A;  1TOU A;  2ACP X;  5EEE A;  4D6B A;  1VPR A;  4M7M A;  1LID A;  1YWA A;  2NP1 A;  3DTQ A;  4OS8 A;  4Y0Q A;  3RWX A;  5AJC A;  3VG3 A;  1B0O A;  1HMR A;  4IB9 A;  4AW8 A;  5HWZ A;  1GT3 A;  1GM6 A;  4NNS A;  1G85 A;  3HWG A;  3FW4 A;  1Y9L A;  1ZNG A;  3HWD A;  3C76 X;  1EAL A;  1SMP I;  2L68 A;  3FEN A;  4O4X A;  1JJX A;  3HWE A;  2LBA A;  2R74 A;  1DZP A;  4A8Z A;  4EXZ A;  5C0N A;  5IO5 A;  4TQ2 A;  2X45 A;  3PQU A;  3FA6 A;  4YKM A;  4Y0S A;  1S2P A;  4ZHC A;  4ODD A;  2ASN X;  4WFU A;  2GJ5 A;  1EI5 A;  4BQU A;  4ZGU A;  5LKE A;  4ZFX A;  3KFI A;  4XMC A;  4YFP A;  2NNQ A;  4NLJ A;  4IB8 A;  3FR4 A;  3P6D A;  1ZND A;  4K19 A;  1DZJ A;  3BSZ E;  2JU7 A;  4U3Q A;  1X8O A;  1D2U A;  4HPA A;  3CMP A;  3P6F A;  3S60 A;  3NBX X;  3VG6 A;  1AEL A;  3LV4 A;  1LIE A;  4I3B A;  3V8U A;  1BJ7 A;  1KT6 A;  1YP7 A;  2RA6 A;  2ZAG A;  5CE4 A;  1CBS A;  4LKP A;  3RSW A;  3WJE A;  4MIR A;  1QY2 A;  2GTL N;  1RBP A;  3C78 X;  2P8G A;  1FE3 A;  2OVD A;  4OMX A;  5HBS A;  1CBQ A;  1BRQ A;  4HPB A;  3UEV A;  5F1E A;  4AZP A;  1VYG A;  5DG4 A;  1H91 A;  1A3Y A;  3NQ9 A;  1ERX A;  4IAB A;  4MIS A;  4QGV A;  1MX7 A;  3E3C A;  1NGL A;  4OS0 A;  4ORS A;  4GKC A;  5JR8 A;  2JU3 A;  1Y9T A;  1YP6 A;  3BX7 A;  3B2J A;  4ZR2 A;  2Q2M A;  5HZ9 A;  1CBI A;  4KH8 A;  2ZAI A;  2BS6 A;  4WHI A;  5AJB A;  1BEB A;  1BM5 A;  2A0A A;  3P24 A;  5HCD C;  4TKB A;  3TZS A;  1CJ5 A;  4ZHG A;  3FEP A;  1IKE A;  2ALL X;  3BRN A;  5HCE C;  1UZ2 X;  1YWC A;  2MHD A;  1A2D A;  1JZU A;  1HQP A;  2N93 A;  3NP1 A;  5H9A A;  4O4O A;  2QO5 A;  2GC9 A;  3KQ0 A;  2RD7 C;  4MVL A;  3NX1 A;  3U03 A;  4M6S A;  5D48 A;  4QZT A;  4MVK A;  4DQ3 A;  2OVE A;  5CYB A;  1SA8 A;  3AKM A;  1GT4 A;  4GU8 A;  3D97 A;  1RLB E;  3IA8 A;  4KCA A;  3PQS A;  2EU7 X;  1KGL A;  1B8E A;  3VG4 A;  1T68 X;  5D45 A;  1ZRY A;  1GXA A;  4ALB A;  4FBR A;  1GX8 A;  5FQ6 E;  5FFH A;  1MDC A;  5BVQ A;  3OD9 A;  4A1H A;  2WR6 A;  2A3F X;  3F8A A;  1BLR A;  1MX8 A;  2RCQ A;  3Q6L A;  1KT3 A;  5F7G A;  3ZWE A;  5H8T A;  4ALO A;  5LJC A;  5FEN A;  4ZJ0 A;  2LA7 A;  2PY1 A;  1ICM A;  2IFB A;  1TW4 A;  1ERB A;  1PEE A;  2A13 A;  3U9P C;  1T8V A;  5H9L A;  2L5P A;  3T1D A;  1SY2 A;  3KFF A;  4ZCB A;  2E4J A;  1HBQ A;  4LKT A;  3APW A;  3FEK A;  5LJB A;  4TLJ A;  5LJG A;  5LJD A;  3RKG A;  3KFH A;  5F6Z A;  2AL0 X;  3UEX A;  4I3D A;  2WEX A;  4ORX A;  3I0A A;  1PMP A;  3HTY A;  4GZV A;  1BRP A;  4WFV A;  4AZM A;  4QQ1 A;  3WXQ A;  1GGL A;  1X8N A;  4UU2 A;  3BX8 A;  1XCA A;  3EBK A;  4ZH6 A;  3PH6 A;  4FGI B;  1U17 A;  2W2A A;  1I4U A;  3ZW0 A;  1GX9 A;  3B2H A;  4QYN A;  3ZW0 B;  4NYR A;  4ZHH A;  1I04 A;  3BY0 A;  2NND A;  1O8V A;  3B2I A;  1DZM A;  3TGA A;  5L8N A;  2CM9 A;  5AQ6 A;  4XMF A;  2X8S A;  3U0D A;  2POA A;  1JIW I;  3DSZ A;  5D47 A;  4IMN A;  1IKJ A;  2W2B A;  3JSQ A;  2AT8 X;  5EZ2 A;  1QQS A;  1A57 A;  1YIV A;  2OFR X;  3UEW A;  4O3Z A;  4O4U A;  5B29 A;  5LKF A;  2RQ0 A;  1NP1 A;  3FIQ A;  1OBQ A;  4A1Y A;  3N91 A;  4HFO A;  2KTS A;  4FQB B;  2KTD A;  1QFV A;  1IIU A;  2HLV A;  3HOE A;  4L1N A;  1P6P A;  3UEU A;  3BS2 A;  3WJC A;  4ARH A;  3RBY A;  1S7D A;  2LKK A;  2BHV A;  1ZNH A;  1X8P A;  5H9N A;  1IFC A;  1B56 A;  1TVQ A;  2Q9S A;  2QO4 A;  1X89 A;  3L4R A;  1YWB A;  3VG5 A;  5D4A A;  1XKI A;  1E5P A;  3STN A;  3JQO A;  1EUO A;  1KT4 A;  4LQZ A;  2CBS A;  3OE3 A;  3MVF A;  3UAQ A;  2QO6 A;  4O3Y A;  4KC8 A;  3K3L A;  1QG5 A;  2A2G A;  5FQ7 E;  3APV A;  3WJG A;  5KID A;  4KII A;  2ACO A;  2GTL O;  2ANS A;  4GDZ A;  2HZQ A;  5LJK A;  3BLG A;  1EIO A;  4NW4 A;  3SAO A;  1EXS A;  4EFG A;  2FT9 A;  1OEE A;  1TXL A;  4HPD A;  4LZV A;  1JYD A;  2CZT A;  4GE1 A;  3GAQ A;  3NX2 A;  1VYF A;  1FTP A;  1BSY A;  1QAB E;  1EW3 A;  4R0B A;  4KT5 A;  1EPA A;  1LF7 A;  3S26 A;  2WWP A;  1X71 A;  1KQX A;  3WVM A;  1T0V A;  5F58 A;  1OBP A;  1U18 A;  3MBT A;  1IW2 A;  4U9C A;  5HA1 A;  1OPA A;  1OEK A;  2WQA E;  2MJI A;  3MX7 A;  4ORR A;  2BS5 A;  2KW1 A;  4ORU A;  4TKH A;  1DZK A;  1KZX A;  5FAZ A;  3CR6 A;  2AH7 X;  5DPQ A;  2YG2 A;  2LB6 A;  3D96 A;  3IFB A;  4Y0P A;  5H9K A;  2JN3 A;  4HWM A;  2L9C A;  1I06 A;  1E06 A;  1KQW A;  4QNI A;  3ZW1 A;  5LJE A;  3KFG A;  5HZ5 A;  3ZW1 B;  3HOL A;  4XMG A;  3VG7 A;  4IMO A;  2X8F A;  3O22 A;  4GNW A;  4YGZ A;  2GTL M;  5F6B A;  2DM5 A;  1DFV A;  4QYP A;  4Y0R A;  5IO6 A;  1ICN A;  1OEJ A;  1FEM A;  2HZR A;  1KXO A;  4NLI A;  2AT3 X;  3VE1 A;  2Z4I A;  5KHP A;  3B2L A;  3P02 A;  1SY3 A;  4RUN A;  4ES7 A;  1PM1 X;  5L8O A;  4YCH A;  4GH7 A;  4I9S A;  2F09 A;  1QWD A;  3FLL A;  5HZ8 A;  1EPB A;  4I9R A;  3FA7 A;  3WJD A;  1LPJ A;  2KT4 B;  1O1U A;  4ML7 B;  2HNX A;  1TOW A;  4O3X B;  2RN4 A;  3I17 A;  2WQ9 A;  2NNE A;  2FS6 A;  4I95 A;  3F6Z B;  2OFM X;  4YBU A;  1D3S A;  1ZNK A;  3WBG A;  1Z24 A;  3EMM A;  4YKO A;  1PBO A;  3P6C A;  1YWD A;  4AZN A;  3ZI8 A;  1G74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...