1KGLA

Solution structure of cellular retinol binding protein type-i in complex with all-trans-retinol
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
MPVDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRAEGVTCKQVFKKVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords CELLULAR RETINOL-BINDING PROTEIN TYPE I
publication title Structure and Backbone Dynamics of Apo- and Holo-cellular Retinol-binding Protein in Solution.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 38
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2001-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1kglA00
1ZNDA 3U9PC 3SAOA 3F9DA 4IB9A 5LJHA 5LJKA 1GXAA 2CZTA 1YP7A 3DSZA 4MVIA 2JOZA 3QKGA 4WFVA 4GRJA 3P6EA 1B0OA 5HBSA 3WJBA 3BX7A 1DZJA 5F6ZA 3PECA 3WJDA 2JU3A 1I05A 4AZOA 4NP1A 4DQ3A 1MVGA 4NYRA 2Q39A 3FA7A 4I3BA 2R56A 1FEMA 1EALA 5H8TA 5D47A 2OFMX 2WWPA 1TOWA 4TQ2A 2AL0X 2N93A 3O2YA 1E06A 5B29A 4I9SA 4YFPA 1KGLA 2WEXA 2WEWA 1B56A 2L9CA 4RUUA 4UU3A 1E00A 1CRBA 1LIFA 1QABE 3B2LA 3U0DA 5HA1A 3JSQA 3MBTA 3NR3A 4LZUA 3TGBA 3C76X 4OS3A 5HAEA 4QGWA 1EUOA 1MDCA 1LKEA 3C78X 2JU8A 1OBQA 2RCTA 1X8QA 1BSOA 1HQPA 2MM3A 1A3YA 3BY0A 5LJCA 2LFOA 1B4MA 3FW5A 4ORYA 1IKEA 3P6CA 5HWZA 4GKCA 4IAXA 4YGZA 1AQBA 2FTBA 4ORUA 4TLJA 1N0SA 2CM9A 4CK4A 1ICMA 4A8ZA 1PMPA 1D3SA 3ZUOA 3VG3A 4Y0PA 5EEDA 2Q4NA 3B2JA 1ALBA 2QOSC 1SA8A 1SXYA 2WUTA 1IIUA 2F73A 3ELZA 3HK1A 2ASNX 1IKJA 4XMDA 1LPJA 2CBSA 2AT3X 4YDBA 1KT6A 5KICA 3VG5A 3PPTA 1OEJA 1JJJA 1G85A 3KFIA 4QGVA 1SXUA 1QFTA 5DG4A 4QAEA 4BVMA 1OBUA 4OS0A 1U0XA 1VPRA 4NLJA 2KTDA 3STMX 2Q2MA 5D4AA 2CBRA 2W2AA 1I4UA 1KT4A 2RA6A 3WJEA 3FR4A 1FDQA 1YWDA 1EIOA 4ORRA 2OFRX 1AB0A 3UEVA 3P6HA 4MVLA 3F8AA 1KQXA 4ZHGA 1D2UA 2DM5A 3U03A 1ZNGA 4YCHA 3K3LA 4NNSA 4ARHA 3EBKA 4O9SA 1CBQA 4HFOA 4KIIA 1SY0A 2ANSA 5EDBA 4EFGA 5HA0A 5HCCC 3BDRA 3RSWA 3IA8A 2ACPX 1LIEA 1AVGI 4M6SA 1RBPA 5EEEA 2MO5A 3FEKA 1IFCA 3OJYC 1LICA 1GKAB 5D45A 4GH7A 3TGCA 3CQRA 2ACOA 4ODDA 5FFHA 5L8OA 1CJ5A 3VG6A 1A18A 1L6MA 2G79A 5HZQA 1A2DA 4I3DA 4PSQA 3FMZA 1VYGA 3HWDA 5C0NA 1BM5A 4TNNA 2WR6A 3EMMA 2WQ9A 1DC9A 2POAA 1DFVA 3PH6A 3PEDA 3HWEA 4GE1A 4EEJA 2NNDA 3NP1A 3KFFA 2HNXA 4LKPA 1QY2A 1OEEA 4GETA 4ZFXA 1HN2A 3APUA 5CE4A 5LJBA 2IFBA 2QM9A 4AZPA 2O62A 4N7DA 1SY3A 4YKOA 1X71A 1O1VA 2LB6A 1OPAA 4OMWA 2HMBA 1I04A 1HMSA 2FWVA 4ORSA 2PY1A 3NPOA 3KZAA 2A13A 1NP1A 2E4JA 4XMHA 1EPBA 2AT6X 1HBQA 4YBPA 4QYPA 5LJGA 4EXZA 2HYSA 5HZ8A 1QG5A 4ES7A 3B2HA 4ZHDA 1GX9A 1QQSA 1BLRA 2OZQA 2CZUA 5EDCA 3FR2A 4OS8A 4TJZA 4XMEA 4YMYA 3CBSA 1A57A 1EW3A 5H9AA 5LJDA 1PM1X 2NP1A 3AKNA 4QZTA 3NX1A 5D48A 3MVFA 1HBPA 2EU7X 4ZCBA 4ZGUA 2K23A 1GT5A 1SXWA 2A2GA 3DTQA 1ZNLA 2AKQA 3UEXA 4WBKA 1T8VA 1LNMA 4HPCA 1O8VA 1RLBE 1TOUA 4Y0SA 4RUNA 4Y0RA 1MX7A 2AH7X 3UEUA 1SXXA 4LKTA 2CM4A 2AT5X 1G7NA 4I9RA 5F6BA 5BVSA 4I3CA 1JYJA 1BRQA 1ZNKA 1X89A 3TGAA 1IW2A 1ZRYA 2A3FX 2GC9A 1U18A 2OVAA 5AQ6A 2G78A 2KT4B 3JS1A 4YBUA 1DZKA 1HMRA 2FS6A 1G74A 2L5PA 2Q2PA 3O19A 4GNWA 1R0UA 5JR8A 3VG7A 3BLGA 1BSYA 1I06A 5H9KA 2QO5A 5H9LA 3FA8A 3FW4A 3O22A 4QZUA 4ALOA 4YH0A 1GM6A 1FTPA 3NQ9A 1OPBA 2L67A 2AT0X 4ALBA 3KFHA 1OEKA 1E02A 1EIIA 3VG4A 2RQ0A 3KFGA 1ADLA 1QY0A 4MVKA 1NGLA 5BVTA 2K62A 1DZPA 4YGGA 1DZMA 5BVQA 3I0AA 3WJGA 1TXLA 1E5PA 1S7DA 3B2KA 4Y0QA 4AW8A 1GGLA 4K19A 1X8NA 1KT3A 4HPDA 5DPQA 4ORXA 1YWCA 4BOEA 4ZH6A 2R74A 3B2IA 1CBRA 1LIBA 3BX8A 2FR2A 2W2BA 1H91A 2NNQA 1FE3A 3T1DA 3FA9A 1BWYA 4GNYA 4M7MA 3STKA 2X45A 1KZWA 2WSJA 4YKMA 2ALLX 2FR3A 1G5WA 1Z24A 2W2FA 4A1HA 3D97A 4EDEA 1XCAA 1TW4A 3APXA 1KQWA 1ZNHA 5KHPA 3FEPA 3EYCA 2R73A 3FA6A 2FRSA 5IO7A 5K06A 1QWDA 4TKBA 3AKMA 2RD7C 4AZQA 2BLGA 5IO6A 1LFOA 1PEEA 1DV9A 5EZ2A 4AZRA 4IB7A 2MJIA 2Q9SA 2NNEA 3TF6A 1HMTA 4YCEA 2LKKA 1O1UA 1JZUA 1ACDA 3ZUIA 1ZNEA 4IAWA 1EQDA 4NLIA 2WQAE 3WXQA 1IFBA 3TZSA 1KT7A 3FR5A 2FLJA 4WFUA 1MX8A 2X46A 4TKHA 1JBHA 2HLVA 1UREA 4XMFA 4A1YA 5HZ6A 3GAQA 5HZ5A 2HZRA 3P6DA 1EXSA 3CQNA 3NADA 3P6GA 4ORWA 2OVDA 4HPBA 4QGXA 3G7XA 2GTFX 4OMXA 4DQ4A 1SY1A 5D8JA 1JV4A 3NX2A 1KZXA 4YGHA 4TKJA 2A2UA 1ICNA 1QFVA 1VYFA 4NNTA 3FELA 4IBAA 3I17A 1EPAA 3ELXA 1GKAA 3PH5A 1YUPA 3KQ0A 5HTDA 5L8IA 2FS7A 1OBPA 2A0AA 5FAZA 1BJ7A 3HWGA 5HCDC 1KT5A 1SY2A 5KIDA 3FLLA 3STNA 2RCQA 3BRNA 4YFRA 1BEBA 1BBPA 4D6BA 5F58A 5H9NA 2FT9A 1ERBA 3D95A 4D6AA 1GX8A 2JU7A 4ZHHA 4ZR2A 4NYQA 1U17A 3EM0A 3NQ3A 5EPQA 3ZQ3A 1YWAA 3WJCA 4ZH9A 3CR6A 4IB8A 4UU2A 4IMOA 1P6PA 3VG2A 2YG2A 4A60A 2P8GA 4LZVA 4ZJ0A 2AMMX 1YIVA 1QY1A 3APVA 3APWA 1MUPA 1X8OA 4BQUA 3BU9A 3WBGA 1ML7A 1LF7A 2LBAA 2XSTA 4XMCA 3IFBA 1T68X 3HWFA 3CMPA 4N7CA 5F7GA 2AT8X 4IMNA 1T0VA 2HZQA 2OVEA 1KXOA 3BSZE 4YFQA 4IB6A 2G7BA 4QYNA 1DF3A 3CBCA 2GJ5A 5L8NA 3FIQA 3RZYA 1NP4A 2XKLA 5IO5A 3P6FA 4HPAA 3C77X 5HTEA 4AZMA 1ERXA 1JJXA 1FENA 2QO4A 3UEWA 3S26A 1LIDA 3WVMA 1KOIA 1TVQA 3L4RA 5LKFA 1X8UA 1BSQA 2JN3A 3BS2A 4AZNA 4AYHA 2L68A 5LKEA 4YDAA 1BRPA 3WJFA 1GT4A 1YWBA 3PP6A 2QO6A 1AELA 5B27A 1FELA 1CBSA 2LBVA 5LJEA 3BU1A 4ZHCA 1GT1A 1CBIA 4XMGA 4R0BA 3CWKA 1YP6A 5HZ9A 1S2PA 1GT3A 5FENA 1UZ2X 3D96A 3FENA 1XKIA 1JYDA 3EBWA 4ZHFA 1B8EA 1X8PA 1PBOA 5F1EA 3Q6LA 5HCEC 1S44A
chains in the Genus database with same CATH superfamily
2IZAA 2I5VO 1ZNDA 4JHQA 3U9PC 3SAOA 3F9DA 1VWLB 4U3QA 4IB9A 3ZZVA 5LJHA 5LJKA 1GXAA 2CZTA 1YP7A 3DSZA 3PK2A 5JD2A 2OYBO 2IZJA 4MVIA 2JOZA 3QKGA 4WFVA 4GRJA 3RE6A 3VE1A 3P6EA 1SMPI 1B0OA 5HBSA 3WJBA 3BX7A 1DZJA 5F6ZA 3PECA 3WJDA 4GJVA 2JU3A 1I05A 4AZOA 4NP1A 4BCSA 3KVNA 4DQ3A 1MVGA 4NYRA 2Q39A 3FA7A 4GJSA 5B5GA 2AF5A 4I3BA 2R56A 1FEMA 1JJUA 2DJGA 1EALA 1SWEA 2OL7A 2RTHB 1JMZA 5H8TA 3N91A 1JMXA 3D4RA 5D47A 3SOTA 1RXHA 5CSEA 2BC3A 2OFMX 2WWPA 1AVEA 1TOWA 2RTIB 2X56A 4CPFA 4EQAC 4TQ2A 5BYPA 2AL0X 2VFBA 1VWNB 2N93A 3O2YA 1E06A 3AEHA 3HOEA 4I9SA 5B29A 1W6FA 1I9HA 4CSBA 4YFPA 5AEOA 1KGLA 2WEXA 2WEWA 1B56A 2L9CA 4RUUA 4UU3A 1E00A 1CRBA 2BS5A 3MG5A 1LIFA 1QABE 3B2LA 3U0DA 5IXGA 4DNEA 2OY5O 5HA1A 3JSQA 3MBTA 3PQSA 3NR3A 4LZUA 3RDXA 1UYNX 3TGBA 3C76X 4OS3A 5HAEA 1KL3A 4QGWA 1EUOA 1MDCA 1NDJA 4BX5A 1LKEA 3C78X 2JU8A 2X32A 3SLOA 1OBQA 2RCTA 4HWMA 1X8QA 1BSOA 1HQPA 2MM3A 1NBXA 1A3YA 2OL6O 3BY0A 3JQOA 4U8UM 5B5FA 2LFOA 4Y59A 5FQ6E 4Z2VA 5LJCA 1B4MA 3FW5A 4ORYA 1IKEA 3P6CA 5HWZA 1SRFA 2X8SA 4GKCA 4IAXA 1AQBA 4YGZA 1MK5A 4U9CA 2FTBA 2KW1A 4ORUA 4TLJA 1N0SA 2CM9A 4CK4A 1ICMA 4A8ZA 1PMPA 1D3SA 3SLJA 3ZUOA 3VG3A 4Y0PA 4IRWA 5EEDA 2Q4NA 3B2JA 4NV8A 1ALBA 2QOSC 1SA8A 4OEMA 1DF8A 1SXYA 2WUTA 1IIUA 2F73A 3ELZA 3HK1A 2ASNX 2JMBA 2YMSA 4FBRA 2BHVA 1IKJA 4XMDA 1VWKB 2ZAGA 5IRUA 1LPJA 2CBSA 4CPEA 2AT3X 4YDBA 1KT6A 2MF6A 5KICA 4QQ1A 3VG5A 1SWHA 3PPTA 1OEJA 1JJJA 4GDAA 1G85A 3KFIA 4QGVA 1SXUA 4QRLA 3RE5A 2GTLN 1QFTA 3LHNA 1RXJA 2FKGA 4QAEA 1OBUA 4OS0A 5DG4A 4BVMA 1U0XA 1SWGA 1VPRA 4NLJA 2KTDA 2MWHA 3STMX 2Q2MA 5D4AA 2CBRA 2W2AA 2X55A 1VWRB 3V8UA 2A5CA 1I4UA 2IZBA 1KT4A 2BSZA 2RA6A 3H3IA 1SWJA 3WJEA 3FR4A 1FDQA 1YWDA 2IZDB 1EIOA 4ORRA 1LCVA 2OFRX 4L3RA 4LQZA 1VYOA 1AB0A 3UEVA 3P6HA 4MVLA 4FBOA 4CPHA 1SWAA 1SWDA 1UYOX 3F8AA 1KQXA 4ZGFA 4ZHGA 1D2UA 2DM5A 3VHMA 4BJ8A 3U03A 2LA7A 1ZNGA 4YCHA 1HXZA 3K3LA 1STSB 4NNSA 4ARHA 3EBKA 4O9SA 1CBQA 4HFOA 4KIIA 1SY0A 2ANSA 5EDBA 4EFGA 5HA0A 5HCCC 3BDRA 3RSWA 3IA8A 4MIRA 2ACPX 1LIEA 1AVGI 2C1SA 4M6SA 1RBPA 4KC8A 5EEEA 3HTYA 2MO5A 1KFFA 3FEKA 4JO6A 1IFCA 3OJYC 2WPUA 1LICA 1K24A 1GKAB 2RTQB 5D45A 4GH7A 3TGCA 1LCZA 3CQRA 2ACOA 4ODDA 4BX5B 4I6SA 5FFHA 5L8OA 1CJ5A 3VG6A 1A18A 1L6MA 1SWRA 2G79A 1A2DA 4I3DA 1Y53X 4PSQA 5HZQA 3FMZA 1VYGA 3HWDA 5C0NA 2KD2A 1JQPA 1VWIB 3ZI8A 1BM5A 4TNNA 2WR6A 3EMMA 1RSTB 2WQ9A 1DC9A 2POAA 1DFVA 3PH6A 3PEDA 3HWEA 2Z4IA 4GE1A 3RY2A 2NNDA 3ZW1B 4EEJA 3NP1A 2JW1A 3KFFA 2HNXA 4FGIB 4LKPA 3RDQA 2M4LA 2Y3FA 3HPEA 1QY2A 1OEEA 4GETA 4BX7A 2G8CO 2OF9A 5CYBA 5IRAA 3UAQA 2PI3O 4ZFXA 1I78A 1HN2A 2UZ2A 5FQ7E 3APUA 4DCBA 5CE4A 3PQUA 5LJBA 2IFBA 2QM9A 2RTMA 4AZPA 1N9YA 2O62A 4N7DA 3VGWA 1SY3A 2ZAIA 4GU8A 4YKOA 4INNA 1X71A 1O1VA 2LB6A 2OFBA 3P02A 4I60A 5B3MO 3EW1A 1OPAA 3CKFA 4GZVA 4GGRA 4OMWA 4YVBA 2G5LA 4O4UA 2HMBA 1I04A 1HMSA 2FWVA 1SWTA 4ON1A 4ORSA 2PY1A 3NPOA 3KZAA 1SRJA 2A13A 1NP1A 4MVEA 5IRWA 2E4JA 4XMHA 1EPBA 2AT6X 2FKJA 1HBQA 4YBPA 4QYPA 5LJGA 3GE2A 4GK9A 4EXZA 1NC9A 2HYSA 3S60A 5HZ8A 1QG5A 4ES7A 2OVSA 3B2HA 4Z27A 1LELA 4KCAA 2HKDA 4ZHDA 1GX9A 1RSUB 3EW2A 1QQSA 2A5BA 1BLRA 2OZQA 2CZUA 5AJCA 5EDCA 3FR2A 3MX7A 4OS8A 4TJZA 4XMEA 3OD9A 2GH7A 4YMYA 3CBSA 1A57A 3S5XA 1EW3A 3LV4A 5H9AA 5LJDA 4O3XB 4B55A 1PM1X 1RXKA 2NP1A 3AKNA 4QZTA 3NX1A 5D48A 3AUMO 4WHIA 3MVFA 1Y9LA 1HBPA 2EU7X 4ZCBA 4KC7A 4BX6B 4ZGUA 3ZW0B 2K23A 1GT5A 1SXWA 2A2GA 3HOLA 1RAVA 3DTQA 2QMIA 1ZNLA 2AKQA 3UEXA 2RTDB 4U8UO 4GGZA 4WBKA 1N43A 5CHKA 5B2AO 1T8VA 2GTLM 1LNMA 3T6LA 4GUZA 4HPCA 3ZWEA 1O8VA 1RLBE 1TOUA 4Y0SA 2OY7A 4RUNA 4Y0RA 1MX7A 2AH7X 3UEUA 1SXXA 4LKTA 2CM4A 1Y9TA 4Z28A 3WZNA 4CDEA 2AT5X 1G7NA 2QCBA 3P24A 2C4IA 4I9RA 3VHIA 5F6BA 5BVSA 2F01A 4I3CA 1JYJA 2I5ZO 3QQ2A 1BRQA 1VWAB 1ZNKA 1X89A 2IZHB 1IW2A 3TGAA 1ZRYA 2A3FX 2DJFA 2GC9A 2IZEB 1U18A 2OVAA 4BBOA 2C1QA 5AQ6A 1HXLA 1VWDB 4YFRA 2RTRB 2G78A 1N4JA 1SRHA 3T2WA 2KT4B 3JS1A 4YBUA 2VDFA 4U8UN 1DZKA 1HMRA 2FS6A 1G74A 2L5PA 2Q2PA 1K3BA 3O19A 1R0UA 4GNWA 4IABA 3BLGA 3VG7A 5JR8A 1BSYA 1I06A 2FHNX 1VWMB 2IZLB 2QO5A 5H9LA 5H9KA 3VPJE 3FA8A 3FW4A 3O22A 3OE3A 4QZUA 4Y5DA 4YH0A 1GM6A 1MOYA 1FTPA 3NQ9A 1OPBA 1VWHB 2JGSA 2L67A 2AT0X 4ALBA 3KFHA 1OEKA 1E02A 3WZQA 1GX3A 4O3WA 1EIIA 2BT9A 3VG4A 2RQ0A 3KFGA 1ADLA 1QY0A 4MVKA 1SWKA 3D9WA 1PTSA 2RTOB 4KT5A 1NGLA 3ZW2A 5BVTA 2K62A 1DZPA 4YGGA 1DZMA 1W5RA 5BVQA 4CDFA 3I0AA 3WJGA 3WYPA 1TXLA 1E5PA 1SRIA 1STRB 1IJ8A 1S7DA 3B2KA 2X34A 4Y0QA 4AW8A 1GGLA 2IZFB 4K19A 1X8NA 2F09A 3RBYA 1SREA 2OFAA 1KT3A 4HPDA 5DPQA 1SWUA 4ORXA 1YWCA 4ML7B 4BOEA 4ZH6A 2RTEB 2R74A 3B2IA 1CBRA 1LIBA 3BX8A 2FR2A 4NW4A 2RTNB 2W2BA 1H91A 2NNQA 1MM9A 1FE3A 3T1DA 3FA9A 1BWYA 4GNYA 4M7MA 3STKA 3RKGA 2X45A 1KZWA 5F2BA 2WSJA 3FDCA 2X8TA 4YKMA 2ALLX 2FR3A 2RTBB 1G5WA 1Z24A 2W2FA 3RWXA 1LCWA 4A1HA 3D97A 2FHLA 3LTWA 3NQKA 1E2TA 4EDEA 3VE2A 1XCAA 1TW4A 1Y52X 2RTPB 3APXA 1JIWI 2OF8A 1KQWA 1ZNHA 5KHPA 1VWEB 3FEPA 2RTCB 1MEPA 3EYCA 3T2XA 5FQ8E 2R73A 3T6FA 2X8FA 2RTAA 3FA6A 2FRSA 5IO7A 1STPA 1QWDA 5K06A 4TKBA 1SLFB 3AKMA 2RD7C 4O49A 4CDDA 4AZQA 2BLGA 5IO6A 1HY2A 4CDCA 1LFOA 4FBVA 1PEEA 1DV9A 5EZ2A 4AZRA 2IZKA 4IB7A 2MJIA 2Q9SA 2NNEA 3TF6A 1HMTA 1Y0GA 4YCEA 1O1UA 2LKKA 2RTGB 1JZUA 1ACDA 4MISA 1Y55X 1VWPB 1KL4A 3ZUIA 1SWFA 1ZNEA 2CAMA 2OL8O 2OY1O 4IAWA 4GGTA 4O4OA 1EQDA 4NLIA 2WQAE 3WXQA 1IFBA 1PBYA 4QNIA 1SWPA 3TZSA 1KT7A 3FR5A 2FLJA 4WFUA 1MX8A 2X46A 2Z4HA 4TKHA 4CPHB 2HLVA 1JBHA 4L1NA 1UREA 4XMFA 2RTFB 3X00A 2ZSCA 3GAQA 4A1YA 5HZ6A 5HZ5A 1AVDA 2HZRA 4ALOA 4Z2OA 3P6DA 1EXSA 4GD9A 3CQNA 3NADA 1VWQB 2OY8A 3P6GA 2OVDA 4HPBA 4ORWA 3G7XA 4QGXA 2GTFX 1KL5A 4MEEA 4OMXA 3RDOA 2RTLA 3Q34A 1SY1A 5D8JA 4DQ4A 4CV7A 1JV4A 3RDSA 3NX2A 1KZXA 4YGHA 1LUQA 2BS6A 4TKJA 1NQMA 1NQNA 2A2UA 1ICNA 1QFVA 1VYFA 4NNTA 1SWNA 3FELA 4IBAA 3I17A 2RTJA 1WUBA 1EPAA 3SLTA 2QOMA 4GDZA 3ELXA 1GKAA 4O3YA 1SWBA 2IZGB 3PH5A 4OELA 1YUPA 3KQ0A 1VWFB 2X4MA 4Z2PA 5HTDA 5L8IA 2FS7A 2RN4A 1OBPA 2A0AA 2VFCA 5B11O 5FAZA 1BJ7A 3HWGA 5HCDC 2GTLO 1KT5A 1SY2A 5KIDA 3FLLA 3F6ZB 1VWOB 2RCQA 3BRNA 2AVIA 1BEBA 1LDOA 1SLDB 4OKAA 3STNA 1BBPA 4D6BA 5F58A 5H9NA 1SWCA 2FT9A 1ERBA 2IZIA 3CKGA 3D95A 4D6AA 1GX8A 2JU7A 4ZHHA 4ZR2A 4NYQA 1U17A 3EM0A 3ZW1A 1SLEB 4BX7B 3S5VA 1WBIA 3NQ3A 5EPQA 3ZQ3A 1YWAA 3VHHA 4ZH9A 3CR6A 4IB8A 3WJCA 4UU2A 4IMOA 1P6PA 3VG2A 2YG2A 4O3ZA 3RDUA 4PJ2A 4JNJA 4I95A 4A60A 2P8GA 4LZVA 4ZJ0A 1HQQA 2AMMX 2Y3EA 3FIDA 4EKVA 1YIVA 1QY1A 3APVA 3APWA 3PDFA 3MM0A 1MUPA 1N9MA 1X8OA 4Z6JA 4BQUA 3BU9A 3WBGA 1ML7A 4BGFA 1LF7A 5AJBA 2LBAA 2XSTA 3SZHA 4XMCA 3EC5A 1T68X 3IFBA 4C5PA 1W4TA 3HWFA 3CMPA 4O4SA 3WOVA 4N7CA 5F7GA 2AT8X 4IMNA 2A8GA 1T0VA 2HZQA 2OVEA 1KXOA 3BSZE 4O4XA 4YFQA 4IB6A 1LDQA 2G7BA 1SRGA 5B10O 4QYNA 1DF3A 3CBCA 2GJ5A 1SWSA 2IZCB 5L8NA 3FIQA 3RZYA 4U46A 1NP4A 1VWBB 2XKLA 5IO5A 3P6FA 4HPAA 3WYQA 3C77X 5HTEA 4AZMA 1ERXA 1JJXA 1SWOA 1FENA 2QO4A 3UEWA 3S26A 1EI5A 1LIDA 3NBXX 3WVMA 1KOIA 1TVQA 3L4RA 5LKFA 3SZIA 2UYWA 3E3CA 2FGSA 4COTA 3WZOA 1X8UA 3RDMA 1BSQA 2JN3A 3BS2A 4AZNA 4AYHA 5K67A 2L68A 5LKEA 4YDAA 1BRPA 3OBLA 3WJFA 1GT4A 1YWBA 3PP6A 1FJ1E 2QO6A 3RY1A 4BX6A 3ZW0A 1N7YA 5B27A 1AELA 1FELA 1CBSA 2KTSA 2LBVA 5LJEA 3BU1A 3FYFA 4ZHCA 4FQBB 1GT1A 1CBIA 3SZJA 4XMGA 4R0BA 2RTKA 3CWKA 1YP6A 5HZ9A 1S2PA 1GT3A 1VWGB 4JGLA 5FENA 2MHDA 1SWLA 1SWQA 5L3YA 1UZ2X 1VWJB 1VWCB 4NV7A 3D96A 3FENA 1OSPO 1XKIA 4ID2A 1JYDA 3EBWA 4CPIA 4ZHFA 1B8EA 1X8PA 3WZPA 1PBOA 1SLGB 5F1EA 2Y32A 5K68A 3Q6LA 4KH8A 3VU1A 5HCEC 1S44A
chains in the Genus database with same CATH topology
1ZNDA 3U9PC 3SAOA 3F9DA 4U3QA 3ZZVA 4IB9A 5LJHA 5LJKA 1GXAA 2CZTA 1YP7A 3DSZA 4MVIA 2JOZA 3QKGA 4WFVA 4GRJA 3VE1A 3P6EA 1SMPI 1B0OA 5HBSA 3WJBA 3BX7A 1DZJA 5F6ZA 3PECA 3WJDA 2JU3A 1I05A 4AZOA 4NP1A 4DQ3A 1MVGA 4NYRA 2Q39A 3FA7A 4I3BA 2R56A 1FEMA 1EALA 5H8TA 3N91A 3D4RA 5D47A 3SOTA 2OFMX 2WWPA 1TOWA 4EQAC 4TQ2A 5BYPA 2AL0X 2N93A 3O2YA 1E06A 3HOEA 5B29A 4I9SA 4CSBA 5AEOA 4YFPA 1KGLA 2WEXA 2WEWA 1B56A 2L9CA 4RUUA 4UU3A 1E00A 1CRBA 2BS5A 1LIFA 1QABE 3B2LA 3U0DA 5HA1A 3JSQA 3MBTA 3PQSA 3NR3A 4LZUA 3TGBA 3C76X 4OS3A 5HAEA 4QGWA 1EUOA 1MDCA 1LKEA 3C78X 2JU8A 1OBQA 2RCTA 4HWMA 1X8QA 1BSOA 1HQPA 2MM3A 1A3YA 3BY0A 3JQOA 4U8UM 5LJCA 2LFOA 1B4MA 5FQ6E 3FW5A 4ORYA 1IKEA 3P6CA 5HWZA 2X8SA 4GKCA 4IAXA 1AQBA 4YGZA 4U9CA 2FTBA 2KW1A 4ORUA 4TLJA 1N0SA 2CM9A 4CK4A 1ICMA 4A8ZA 1PMPA 1D3SA 3ZUOA 3VG3A 4Y0PA 5EEDA 2Q4NA 3B2JA 1ALBA 2QOSC 1SA8A 1SXYA 2WUTA 4FBRA 1IIUA 2F73A 3ELZA 3HK1A 2ASNX 2JMBA 2YMSA 2BHVA 1IKJA 4XMDA 2ZAGA 1LPJA 2CBSA 2AT3X 4YDBA 1KT6A 5KICA 4QQ1A 3VG5A 3PPTA 1OEJA 1JJJA 1G85A 3KFIA 4QGVA 1SXUA 4QRLA 2GTLN 1QFTA 3LHNA 4QAEA 5DG4A 4BVMA 1OBUA 4OS0A 1U0XA 1VPRA 4NLJA 2KTDA 2MWHA 3STMX 2Q2MA 5D4AA 2CBRA 2W2AA 3V8UA 1I4UA 1KT4A 2RA6A 3H3IA 3WJEA 3FR4A 1FDQA 1YWDA 1EIOA 4ORRA 2OFRX 4L3RA 4LQZA 1AB0A 3UEVA 3P6HA 4MVLA 4FBOA 3F8AA 1KQXA 4ZGFA 4ZHGA 1D2UA 2DM5A 3U03A 2LA7A 1ZNGA 4YCHA 3K3LA 4NNSA 4ARHA 3EBKA 4O9SA 1CBQA 4HFOA 4KIIA 1SY0A 2ANSA 5EDBA 4EFGA 5HA0A 5HCCC 3BDRA 3RSWA 3IA8A 4MIRA 2ACPX 1LIEA 1AVGI 4M6SA 1RBPA 4KC8A 5EEEA 3HTYA 2MO5A 3FEKA 1IFCA 3OJYC 1LICA 1GKAB 5D45A 4GH7A 3TGCA 3CQRA 2ACOA 4ODDA 4I6SA 5FFHA 5L8OA 1CJ5A 3VG6A 1A18A 1L6MA 2G79A 5HZQA 1A2DA 4I3DA 4PSQA 3FMZA 1VYGA 3HWDA 5C0NA 2KD2A 3ZI8A 1BM5A 4TNNA 2WR6A 3EMMA 2WQ9A 1DC9A 2POAA 1DFVA 3PH6A 3PEDA 3HWEA 2Z4IA 4GE1A 4EEJA 2NNDA 3ZW1B 3NP1A 2JW1A 3KFFA 2HNXA 4FGIB 4LKPA 2M4LA 1QY2A 1OEEA 4GETA 5CYBA 3UAQA 4ZFXA 1HN2A 5FQ7E 3APUA 5CE4A 3PQUA 5LJBA 2IFBA 2QM9A 4AZPA 2O62A 4N7DA 1SY3A 2ZAIA 4GU8A 4YKOA 4INNA 1X71A 1O1VA 2LB6A 3P02A 1OPAA 4OMWA 4GZVA 4O4UA 2HMBA 1I04A 1HMSA 2FWVA 4ORSA 4ON1A 2PY1A 3NPOA 3KZAA 2A13A 1NP1A 4MVEA 2E4JA 4XMHA 1EPBA 2AT6X 1HBQA 4YBPA 4QYPA 5LJGA 3GE2A 4GK9A 4EXZA 2HYSA 3S60A 5HZ8A 1QG5A 4ES7A 2OVSA 3B2HA 4KCAA 4ZHDA 1GX9A 1QQSA 1BLRA 2OZQA 2CZUA 5AJCA 5EDCA 3FR2A 3MX7A 4OS8A 4TJZA 4XMEA 3OD9A 4YMYA 3CBSA 1A57A 3S5XA 1EW3A 3LV4A 5H9AA 5LJDA 4O3XB 1PM1X 2NP1A 3AKNA 4QZTA 3NX1A 5D48A 4WHIA 3MVFA 1Y9LA 1HBPA 2EU7X 4ZCBA 4KC7A 4ZGUA 3ZW0B 2K23A 1GT5A 1SXWA 2A2GA 3HOLA 3DTQA 2QMIA 1ZNLA 2AKQA 3UEXA 4U8UO 4WBKA 1T8VA 2GTLM 1LNMA 4HPCA 3ZWEA 1O8VA 1RLBE 1TOUA 4Y0SA 4RUNA 4Y0RA 1MX7A 2AH7X 3UEUA 1SXXA 4LKTA 2CM4A 1Y9TA 2AT5X 1G7NA 4I9RA 3P24A 5F6BA 5BVSA 4I3CA 1JYJA 1BRQA 1ZNKA 1X89A 3TGAA 1IW2A 1ZRYA 2A3FX 2GC9A 1U18A 2OVAA 5AQ6A 2G78A 2KT4B 3JS1A 4YBUA 4U8UN 1DZKA 1HMRA 2FS6A 1G74A 2L5PA 2Q2PA 3O19A 4GNWA 1R0UA 4IABA 3VG7A 3BLGA 5JR8A 1BSYA 1I06A 5H9KA 2QO5A 3VPJE 5H9LA 3FA8A 3FW4A 3O22A 3OE3A 4QZUA 4YH0A 4ALOA 1GM6A 1FTPA 3NQ9A 1OPBA 2L67A 2AT0X 4ALBA 3KFHA 1OEKA 1E02A 4O3WA 1EIIA 2BT9A 3VG4A 2RQ0A 3KFGA 1ADLA 1QY0A 4MVKA 4KT5A 1NGLA 3ZW2A 5BVTA 2K62A 1DZPA 4YGGA 1DZMA 5BVQA 3I0AA 3WJGA 1TXLA 1E5PA 1S7DA 3B2KA 4Y0QA 4AW8A 1GGLA 4K19A 3RBYA 1X8NA 2F09A 1KT3A 4HPDA 5DPQA 4ORXA 1YWCA 4ML7B 4BOEA 4ZH6A 2R74A 3B2IA 1CBRA 1LIBA 3BX8A 2FR2A 4NW4A 2W2BA 1H91A 2NNQA 1FE3A 3T1DA 3FA9A 1BWYA 4GNYA 4M7MA 3STKA 3RKGA 2X45A 1KZWA 2WSJA 4YKMA 2X8TA 2ALLX 2FR3A 1G5WA 1Z24A 2W2FA 3RWXA 4A1HA 3D97A 3NQKA 4EDEA 3VE2A 1XCAA 1TW4A 3APXA 1JIWI 1KQWA 1ZNHA 5KHPA 3FEPA 3EYCA 5FQ8E 2R73A 2X8FA 3FA6A 2FRSA 5IO7A 5K06A 1QWDA 4TKBA 3AKMA 2RD7C 4O49A 4AZQA 2BLGA 5IO6A 1LFOA 4FBVA 1PEEA 1DV9A 5EZ2A 4AZRA 4IB7A 2MJIA 2Q9SA 2NNEA 3TF6A 1HMTA 4YCEA 2LKKA 1O1UA 1JZUA 1ACDA 4MISA 3ZUIA 4O4OA 1ZNEA 4IAWA 1EQDA 4NLIA 2WQAE 3WXQA 1IFBA 4QNIA 3TZSA 1KT7A 3FR5A 2FLJA 4WFUA 1MX8A 2X46A 2Z4HA 4TKHA 1JBHA 2HLVA 4L1NA 1UREA 4XMFA 4A1YA 5HZ6A 3GAQA 5HZ5A 2HZRA 3P6DA 1EXSA 3CQNA 3NADA 3P6GA 4ORWA 2OVDA 4HPBA 4QGXA 3G7XA 2GTFX 4OMXA 4CV7A 4DQ4A 1SY1A 5D8JA 1JV4A 3NX2A 1KZXA 4YGHA 2BS6A 4TKJA 2A2UA 1ICNA 1QFVA 1VYFA 4NNTA 3FELA 4IBAA 3I17A 1EPAA 4GDZA 3ELXA 1GKAA 4O3YA 3PH5A 1YUPA 3KQ0A 5HTDA 5L8IA 2FS7A 2RN4A 1OBPA 2A0AA 5FAZA 1BJ7A 3HWGA 5HCDC 2GTLO 1KT5A 1SY2A 5KIDA 3FLLA 3F6ZB 3STNA 2RCQA 3BRNA 4YFRA 1BEBA 1BBPA 4D6BA 5F58A 5H9NA 2FT9A 1ERBA 3D95A 4D6AA 1GX8A 2JU7A 4ZHHA 4ZR2A 4NYQA 1U17A 3EM0A 3ZW1A 3S5VA 3NQ3A 5EPQA 3ZQ3A 1YWAA 3WJCA 4ZH9A 3CR6A 4IB8A 4UU2A 4IMOA 1P6PA 3VG2A 2YG2A 4O3ZA 4PJ2A 4A60A 4I95A 2P8GA 4LZVA 4ZJ0A 2AMMX 1YIVA 1QY1A 3APVA 3APWA 1MUPA 1X8OA 4BQUA 3BU9A 3WBGA 1ML7A 1LF7A 5AJBA 2LBAA 2XSTA 4XMCA 3IFBA 1T68X 4O4SA 3HWFA 3CMPA 3WOVA 4N7CA 5F7GA 2AT8X 4IMNA 1T0VA 2HZQA 2OVEA 1KXOA 3BSZE 4O4XA 4YFQA 4IB6A 2G7BA 4QYNA 1DF3A 3CBCA 2GJ5A 5L8NA 3FIQA 3RZYA 1NP4A 2XKLA 5IO5A 3P6FA 4HPAA 3C77X 5HTEA 4AZMA 1ERXA 1JJXA 1FENA 2QO4A 3UEWA 3S26A 1EI5A 1LIDA 3NBXX 3WVMA 1KOIA 1TVQA 3L4RA 5LKFA 3E3CA 4COTA 1X8UA 1BSQA 2JN3A 3BS2A 4AZNA 4AYHA 2L68A 5LKEA 4YDAA 1BRPA 3OBLA 3WJFA 1GT4A 1YWBA 3PP6A 2QO6A 1AELA 3ZW0A 5B27A 1FELA 1CBSA 2KTSA 2LBVA 5LJEA 3BU1A 3FYFA 4ZHCA 4FQBB 1GT1A 1CBIA 4XMGA 4R0BA 3CWKA 1YP6A 5HZ9A 1S2PA 1GT3A 4JGLA 5FENA 2MHDA 1UZ2X 3D96A 3FENA 1XKIA 4ID2A 1JYDA 3EBWA 4ZHFA 1B8EA 1X8PA 1PBOA 5F1EA 3Q6LA 4KH8A 3VU1A 5HCEC 1S44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZND A;  3U9P C;  3SAO A;  3F9D A;  4IB9 A;  5LJH A;  5LJK A;  1GXA A;  2CZT A;  1YP7 A;  3DSZ A;  4MVI A;  2JOZ A;  3QKG A;  4WFV A;  4GRJ A;  3P6E A;  1B0O A;  5HBS A;  3WJB A;  3BX7 A;  1DZJ A;  5F6Z A;  3PEC A;  3WJD A;  2JU3 A;  1I05 A;  4AZO A;  4NP1 A;  4DQ3 A;  1MVG A;  4NYR A;  2Q39 A;  3FA7 A;  4I3B A;  2R56 A;  1FEM A;  1EAL A;  5H8T A;  5D47 A;  2OFM X;  2WWP A;  1TOW A;  4TQ2 A;  2AL0 X;  2N93 A;  3O2Y A;  1E06 A;  5B29 A;  4I9S A;  4YFP A;  1KGL A;  2WEX A;  2WEW A;  1B56 A;  2L9C A;  4RUU A;  4UU3 A;  1E00 A;  1CRB A;  1LIF A;  1QAB E;  3B2L A;  3U0D A;  5HA1 A;  3JSQ A;  3MBT A;  3NR3 A;  4LZU A;  3TGB A;  3C76 X;  4OS3 A;  5HAE A;  4QGW A;  1EUO A;  1MDC A;  1LKE A;  3C78 X;  2JU8 A;  1OBQ A;  2RCT A;  1X8Q A;  1BSO A;  1HQP A;  2MM3 A;  1A3Y A;  3BY0 A;  5LJC A;  2LFO A;  1B4M A;  3FW5 A;  4ORY A;  1IKE A;  3P6C A;  5HWZ A;  4GKC A;  4IAX A;  4YGZ A;  1AQB A;  2FTB A;  4ORU A;  4TLJ A;  1N0S A;  2CM9 A;  4CK4 A;  1ICM A;  4A8Z A;  1PMP A;  1D3S A;  3ZUO A;  3VG3 A;  4Y0P A;  5EED A;  2Q4N A;  3B2J A;  1ALB A;  2QOS C;  1SA8 A;  1SXY A;  2WUT A;  1IIU A;  2F73 A;  3ELZ A;  3HK1 A;  2ASN X;  1IKJ A;  4XMD A;  1LPJ A;  2CBS A;  2AT3 X;  4YDB A;  1KT6 A;  5KIC A;  3VG5 A;  3PPT A;  1OEJ A;  1JJJ A;  1G85 A;  3KFI A;  4QGV A;  1SXU A;  1QFT A;  5DG4 A;  4QAE A;  4BVM A;  1OBU A;  4OS0 A;  1U0X A;  1VPR A;  4NLJ A;  2KTD A;  3STM X;  2Q2M A;  5D4A A;  2CBR A;  2W2A A;  1I4U A;  1KT4 A;  2RA6 A;  3WJE A;  3FR4 A;  1FDQ A;  1YWD A;  1EIO A;  4ORR A;  2OFR X;  1AB0 A;  3UEV A;  3P6H A;  4MVL A;  3F8A A;  1KQX A;  4ZHG A;  1D2U A;  2DM5 A;  3U03 A;  1ZNG A;  4YCH A;  3K3L A;  4NNS A;  4ARH A;  3EBK A;  4O9S A;  1CBQ A;  4HFO A;  4KII A;  1SY0 A;  2ANS A;  5EDB A;  4EFG A;  5HA0 A;  5HCC C;  3BDR A;  3RSW A;  3IA8 A;  2ACP X;  1LIE A;  1AVG I;  4M6S A;  1RBP A;  5EEE A;  2MO5 A;  3FEK A;  1IFC A;  3OJY C;  1LIC A;  1GKA B;  5D45 A;  4GH7 A;  3TGC A;  3CQR A;  2ACO A;  4ODD A;  5FFH A;  5L8O A;  1CJ5 A;  3VG6 A;  1A18 A;  1L6M A;  2G79 A;  5HZQ A;  1A2D A;  4I3D A;  4PSQ A;  3FMZ A;  1VYG A;  3HWD A;  5C0N A;  1BM5 A;  4TNN A;  2WR6 A;  3EMM A;  2WQ9 A;  1DC9 A;  2POA A;  1DFV A;  3PH6 A;  3PED A;  3HWE A;  4GE1 A;  4EEJ A;  2NND A;  3NP1 A;  3KFF A;  2HNX A;  4LKP A;  1QY2 A;  1OEE A;  4GET A;  4ZFX A;  1HN2 A;  3APU A;  5CE4 A;  5LJB A;  2IFB A;  2QM9 A;  4AZP A;  2O62 A;  4N7D A;  1SY3 A;  4YKO A;  1X71 A;  1O1V A;  2LB6 A;  1OPA A;  4OMW A;  2HMB A;  1I04 A;  1HMS A;  2FWV A;  4ORS A;  2PY1 A;  3NPO A;  3KZA A;  2A13 A;  1NP1 A;  2E4J A;  4XMH A;  1EPB A;  2AT6 X;  1HBQ A;  4YBP A;  4QYP A;  5LJG A;  4EXZ A;  2HYS A;  5HZ8 A;  1QG5 A;  4ES7 A;  3B2H A;  4ZHD A;  1GX9 A;  1QQS A;  1BLR A;  2OZQ A;  2CZU A;  5EDC A;  3FR2 A;  4OS8 A;  4TJZ A;  4XME A;  4YMY A;  3CBS A;  1A57 A;  1EW3 A;  5H9A A;  5LJD A;  1PM1 X;  2NP1 A;  3AKN A;  4QZT A;  3NX1 A;  5D48 A;  3MVF A;  1HBP A;  2EU7 X;  4ZCB A;  4ZGU A;  2K23 A;  1GT5 A;  1SXW A;  2A2G A;  3DTQ A;  1ZNL A;  2AKQ A;  3UEX A;  4WBK A;  1T8V A;  1LNM A;  4HPC A;  1O8V A;  1RLB E;  1TOU A;  4Y0S A;  4RUN A;  4Y0R A;  1MX7 A;  2AH7 X;  3UEU A;  1SXX A;  4LKT A;  2CM4 A;  2AT5 X;  1G7N A;  4I9R A;  5F6B A;  5BVS A;  4I3C A;  1JYJ A;  1BRQ A;  1ZNK A;  1X89 A;  3TGA A;  1IW2 A;  1ZRY A;  2A3F X;  2GC9 A;  1U18 A;  2OVA A;  5AQ6 A;  2G78 A;  2KT4 B;  3JS1 A;  4YBU A;  1DZK A;  1HMR A;  2FS6 A;  1G74 A;  2L5P A;  2Q2P A;  3O19 A;  4GNW A;  1R0U A;  5JR8 A;  3VG7 A;  3BLG A;  1BSY A;  1I06 A;  5H9K A;  2QO5 A;  5H9L A;  3FA8 A;  3FW4 A;  3O22 A;  4QZU A;  4ALO A;  4YH0 A;  1GM6 A;  1FTP A;  3NQ9 A;  1OPB A;  2L67 A;  2AT0 X;  4ALB A;  3KFH A;  1OEK A;  1E02 A;  1EII A;  3VG4 A;  2RQ0 A;  3KFG A;  1ADL A;  1QY0 A;  4MVK A;  1NGL A;  5BVT A;  2K62 A;  1DZP A;  4YGG A;  1DZM A;  5BVQ A;  3I0A A;  3WJG A;  1TXL A;  1E5P A;  1S7D A;  3B2K A;  4Y0Q A;  4AW8 A;  1GGL A;  4K19 A;  1X8N A;  1KT3 A;  4HPD A;  5DPQ A;  4ORX A;  1YWC A;  4BOE A;  4ZH6 A;  2R74 A;  3B2I A;  1CBR A;  1LIB A;  3BX8 A;  2FR2 A;  2W2B A;  1H91 A;  2NNQ A;  1FE3 A;  3T1D A;  3FA9 A;  1BWY A;  4GNY A;  4M7M A;  3STK A;  2X45 A;  1KZW A;  2WSJ A;  4YKM A;  2ALL X;  2FR3 A;  1G5W A;  1Z24 A;  2W2F A;  4A1H A;  3D97 A;  4EDE A;  1XCA A;  1TW4 A;  3APX A;  1KQW A;  1ZNH A;  5KHP A;  3FEP A;  3EYC A;  2R73 A;  3FA6 A;  2FRS A;  5IO7 A;  5K06 A;  1QWD A;  4TKB A;  3AKM A;  2RD7 C;  4AZQ A;  2BLG A;  5IO6 A;  1LFO A;  1PEE A;  1DV9 A;  5EZ2 A;  4AZR A;  4IB7 A;  2MJI A;  2Q9S A;  2NNE A;  3TF6 A;  1HMT A;  4YCE A;  2LKK A;  1O1U A;  1JZU A;  1ACD A;  3ZUI A;  1ZNE A;  4IAW A;  1EQD A;  4NLI A;  2WQA E;  3WXQ A;  1IFB A;  3TZS A;  1KT7 A;  3FR5 A;  2FLJ A;  4WFU A;  1MX8 A;  2X46 A;  4TKH A;  1JBH A;  2HLV A;  1URE A;  4XMF A;  4A1Y A;  5HZ6 A;  3GAQ A;  5HZ5 A;  2HZR A;  3P6D A;  1EXS A;  3CQN A;  3NAD A;  3P6G A;  4ORW A;  2OVD A;  4HPB A;  4QGX A;  3G7X A;  2GTF X;  4OMX A;  4DQ4 A;  1SY1 A;  5D8J A;  1JV4 A;  3NX2 A;  1KZX A;  4YGH A;  4TKJ A;  2A2U A;  1ICN A;  1QFV A;  1VYF A;  4NNT A;  3FEL A;  4IBA A;  3I17 A;  1EPA A;  3ELX A;  1GKA A;  3PH5 A;  1YUP A;  3KQ0 A;  5HTD A;  5L8I A;  2FS7 A;  1OBP A;  2A0A A;  5FAZ A;  1BJ7 A;  3HWG A;  5HCD C;  1KT5 A;  1SY2 A;  5KID A;  3FLL A;  3STN A;  2RCQ A;  3BRN A;  4YFR A;  1BEB A;  1BBP A;  4D6B A;  5F58 A;  5H9N A;  2FT9 A;  1ERB A;  3D95 A;  4D6A A;  1GX8 A;  2JU7 A;  4ZHH A;  4ZR2 A;  4NYQ A;  1U17 A;  3EM0 A;  3NQ3 A;  5EPQ A;  3ZQ3 A;  1YWA A;  3WJC A;  4ZH9 A;  3CR6 A;  4IB8 A;  4UU2 A;  4IMO A;  1P6P A;  3VG2 A;  2YG2 A;  4A60 A;  2P8G A;  4LZV A;  4ZJ0 A;  2AMM X;  1YIV A;  1QY1 A;  3APV A;  3APW A;  1MUP A;  1X8O A;  4BQU A;  3BU9 A;  3WBG A;  1ML7 A;  1LF7 A;  2LBA A;  2XST A;  4XMC A;  3IFB A;  1T68 X;  3HWF A;  3CMP A;  4N7C A;  5F7G A;  2AT8 X;  4IMN A;  1T0V A;  2HZQ A;  2OVE A;  1KXO A;  3BSZ E;  4YFQ A;  4IB6 A;  2G7B A;  4QYN A;  1DF3 A;  3CBC A;  2GJ5 A;  5L8N A;  3FIQ A;  3RZY A;  1NP4 A;  2XKL A;  5IO5 A;  3P6F A;  4HPA A;  3C77 X;  5HTE A;  4AZM A;  1ERX A;  1JJX A;  1FEN A;  2QO4 A;  3UEW A;  3S26 A;  1LID A;  3WVM A;  1KOI A;  1TVQ A;  3L4R A;  5LKF A;  1X8U A;  1BSQ A;  2JN3 A;  3BS2 A;  4AZN A;  4AYH A;  2L68 A;  5LKE A;  4YDA A;  1BRP A;  3WJF A;  1GT4 A;  1YWB A;  3PP6 A;  2QO6 A;  1AEL A;  5B27 A;  1FEL A;  1CBS A;  2LBV A;  5LJE A;  3BU1 A;  4ZHC A;  1GT1 A;  1CBI A;  4XMG A;  4R0B A;  3CWK A;  1YP6 A;  5HZ9 A;  1S2P A;  1GT3 A;  5FEN A;  1UZ2 X;  3D96 A;  3FEN A;  1XKI A;  1JYD A;  3EBW A;  4ZHF A;  1B8E A;  1X8P A;  1PBO A;  5F1E A;  3Q6L A;  5HCE C;  1S44 A; 
#chains in the Genus database with same CATH topology
 2IZA A;  2I5V O;  1ZND A;  4JHQ A;  3U9P C;  3SAO A;  3F9D A;  1VWL B;  4U3Q A;  4IB9 A;  3ZZV A;  5LJH A;  5LJK A;  1GXA A;  2CZT A;  1YP7 A;  3DSZ A;  3PK2 A;  5JD2 A;  2OYB O;  2IZJ A;  4MVI A;  2JOZ A;  3QKG A;  4WFV A;  4GRJ A;  3RE6 A;  3VE1 A;  3P6E A;  1SMP I;  1B0O A;  5HBS A;  3WJB A;  3BX7 A;  1DZJ A;  5F6Z A;  3PEC A;  3WJD A;  4GJV A;  2JU3 A;  1I05 A;  4AZO A;  4NP1 A;  4BCS A;  3KVN A;  4DQ3 A;  1MVG A;  4NYR A;  2Q39 A;  3FA7 A;  4GJS A;  5B5G A;  2AF5 A;  4I3B A;  2R56 A;  1FEM A;  1JJU A;  2DJG A;  1EAL A;  1SWE A;  2OL7 A;  2RTH B;  1JMZ A;  5H8T A;  3N91 A;  1JMX A;  3D4R A;  5D47 A;  3SOT A;  1RXH A;  5CSE A;  2BC3 A;  2OFM X;  2WWP A;  1AVE A;  1TOW A;  2RTI B;  2X56 A;  4CPF A;  4EQA C;  4TQ2 A;  5BYP A;  2AL0 X;  2VFB A;  1VWN B;  2N93 A;  3O2Y A;  1E06 A;  3AEH A;  3HOE A;  4I9S A;  5B29 A;  1W6F A;  1I9H A;  4CSB A;  4YFP A;  5AEO A;  1KGL A;  2WEX A;  2WEW A;  1B56 A;  2L9C A;  4RUU A;  4UU3 A;  1E00 A;  1CRB A;  2BS5 A;  3MG5 A;  1LIF A;  1QAB E;  3B2L A;  3U0D A;  5IXG A;  4DNE A;  2OY5 O;  5HA1 A;  3JSQ A;  3MBT A;  3PQS A;  3NR3 A;  4LZU A;  3RDX A;  1UYN X;  3TGB A;  3C76 X;  4OS3 A;  5HAE A;  1KL3 A;  4QGW A;  1EUO A;  1MDC A;  1NDJ A;  4BX5 A;  1LKE A;  3C78 X;  2JU8 A;  2X32 A;  3SLO A;  1OBQ A;  2RCT A;  4HWM A;  1X8Q A;  1BSO A;  1HQP A;  2MM3 A;  1NBX A;  1A3Y A;  2OL6 O;  3BY0 A;  3JQO A;  4U8U M;  5B5F A;  2LFO A;  4Y59 A;  5FQ6 E;  4Z2V A;  5LJC A;  1B4M A;  3FW5 A;  4ORY A;  1IKE A;  3P6C A;  5HWZ A;  1SRF A;  2X8S A;  4GKC A;  4IAX A;  1AQB A;  4YGZ A;  1MK5 A;  4U9C A;  2FTB A;  2KW1 A;  4ORU A;  4TLJ A;  1N0S A;  2CM9 A;  4CK4 A;  1ICM A;  4A8Z A;  1PMP A;  1D3S A;  3SLJ A;  3ZUO A;  3VG3 A;  4Y0P A;  4IRW A;  5EED A;  2Q4N A;  3B2J A;  4NV8 A;  1ALB A;  2QOS C;  1SA8 A;  4OEM A;  1DF8 A;  1SXY A;  2WUT A;  1IIU A;  2F73 A;  3ELZ A;  3HK1 A;  2ASN X;  2JMB A;  2YMS A;  4FBR A;  2BHV A;  1IKJ A;  4XMD A;  1VWK B;  2ZAG A;  5IRU A;  1LPJ A;  2CBS A;  4CPE A;  2AT3 X;  4YDB A;  1KT6 A;  2MF6 A;  5KIC A;  4QQ1 A;  3VG5 A;  1SWH A;  3PPT A;  1OEJ A;  1JJJ A;  4GDA A;  1G85 A;  3KFI A;  4QGV A;  1SXU A;  4QRL A;  3RE5 A;  2GTL N;  1QFT A;  3LHN A;  1RXJ A;  2FKG A;  4QAE A;  1OBU A;  4OS0 A;  5DG4 A;  4BVM A;  1U0X A;  1SWG A;  1VPR A;  4NLJ A;  2KTD A;  2MWH A;  3STM X;  2Q2M A;  5D4A A;  2CBR A;  2W2A A;  2X55 A;  1VWR B;  3V8U A;  2A5C A;  1I4U A;  2IZB A;  1KT4 A;  2BSZ A;  2RA6 A;  3H3I A;  1SWJ A;  3WJE A;  3FR4 A;  1FDQ A;  1YWD A;  2IZD B;  1EIO A;  4ORR A;  1LCV A;  2OFR X;  4L3R A;  4LQZ A;  1VYO A;  1AB0 A;  3UEV A;  3P6H A;  4MVL A;  4FBO A;  4CPH A;  1SWA A;  1SWD A;  1UYO X;  3F8A A;  1KQX A;  4ZGF A;  4ZHG A;  1D2U A;  2DM5 A;  3VHM A;  4BJ8 A;  3U03 A;  2LA7 A;  1ZNG A;  4YCH A;  1HXZ A;  3K3L A;  1STS B;  4NNS A;  4ARH A;  3EBK A;  4O9S A;  1CBQ A;  4HFO A;  4KII A;  1SY0 A;  2ANS A;  5EDB A;  4EFG A;  5HA0 A;  5HCC C;  3BDR A;  3RSW A;  3IA8 A;  4MIR A;  2ACP X;  1LIE A;  1AVG I;  2C1S A;  4M6S A;  1RBP A;  4KC8 A;  5EEE A;  3HTY A;  2MO5 A;  1KFF A;  3FEK A;  4JO6 A;  1IFC A;  3OJY C;  2WPU A;  1LIC A;  1K24 A;  1GKA B;  2RTQ B;  5D45 A;  4GH7 A;  3TGC A;  1LCZ A;  3CQR A;  2ACO A;  4ODD A;  4BX5 B;  4I6S A;  5FFH A;  5L8O A;  1CJ5 A;  3VG6 A;  1A18 A;  1L6M A;  1SWR A;  2G79 A;  1A2D A;  4I3D A;  1Y53 X;  4PSQ A;  5HZQ A;  3FMZ A;  1VYG A;  3HWD A;  5C0N A;  2KD2 A;  1JQP A;  1VWI B;  3ZI8 A;  1BM5 A;  4TNN A;  2WR6 A;  3EMM A;  1RST B;  2WQ9 A;  1DC9 A;  2POA A;  1DFV A;  3PH6 A;  3PED A;  3HWE A;  2Z4I A;  4GE1 A;  3RY2 A;  2NND A;  3ZW1 B;  4EEJ A;  3NP1 A;  2JW1 A;  3KFF A;  2HNX A;  4FGI B;  4LKP A;  3RDQ A;  2M4L A;  2Y3F A;  3HPE A;  1QY2 A;  1OEE A;  4GET A;  4BX7 A;  2G8C O;  2OF9 A;  5CYB A;  5IRA A;  3UAQ A;  2PI3 O;  4ZFX A;  1I78 A;  1HN2 A;  2UZ2 A;  5FQ7 E;  3APU A;  4DCB A;  5CE4 A;  3PQU A;  5LJB A;  2IFB A;  2QM9 A;  2RTM A;  4AZP A;  1N9Y A;  2O62 A;  4N7D A;  3VGW A;  1SY3 A;  2ZAI A;  4GU8 A;  4YKO A;  4INN A;  1X71 A;  1O1V A;  2LB6 A;  2OFB A;  3P02 A;  4I60 A;  5B3M O;  3EW1 A;  1OPA A;  3CKF A;  4GZV A;  4GGR A;  4OMW A;  4YVB A;  2G5L A;  4O4U A;  2HMB A;  1I04 A;  1HMS A;  2FWV A;  1SWT A;  4ON1 A;  4ORS A;  2PY1 A;  3NPO A;  3KZA A;  1SRJ A;  2A13 A;  1NP1 A;  4MVE A;  5IRW A;  2E4J A;  4XMH A;  1EPB A;  2AT6 X;  2FKJ A;  1HBQ A;  4YBP A;  4QYP A;  5LJG A;  3GE2 A;  4GK9 A;  4EXZ A;  1NC9 A;  2HYS A;  3S60 A;  5HZ8 A;  1QG5 A;  4ES7 A;  2OVS A;  3B2H A;  4Z27 A;  1LEL A;  4KCA A;  2HKD A;  4ZHD A;  1GX9 A;  1RSU B;  3EW2 A;  1QQS A;  2A5B A;  1BLR A;  2OZQ A;  2CZU A;  5AJC A;  5EDC A;  3FR2 A;  3MX7 A;  4OS8 A;  4TJZ A;  4XME A;  3OD9 A;  2GH7 A;  4YMY A;  3CBS A;  1A57 A;  3S5X A;  1EW3 A;  3LV4 A;  5H9A A;  5LJD A;  4O3X B;  4B55 A;  1PM1 X;  1RXK A;  2NP1 A;  3AKN A;  4QZT A;  3NX1 A;  5D48 A;  3AUM O;  4WHI A;  3MVF A;  1Y9L A;  1HBP A;  2EU7 X;  4ZCB A;  4KC7 A;  4BX6 B;  4ZGU A;  3ZW0 B;  2K23 A;  1GT5 A;  1SXW A;  2A2G A;  3HOL A;  1RAV A;  3DTQ A;  2QMI A;  1ZNL A;  2AKQ A;  3UEX A;  2RTD B;  4U8U O;  4GGZ A;  4WBK A;  1N43 A;  5CHK A;  5B2A O;  1T8V A;  2GTL M;  1LNM A;  3T6L A;  4GUZ A;  4HPC A;  3ZWE A;  1O8V A;  1RLB E;  1TOU A;  4Y0S A;  2OY7 A;  4RUN A;  4Y0R A;  1MX7 A;  2AH7 X;  3UEU A;  1SXX A;  4LKT A;  2CM4 A;  1Y9T A;  4Z28 A;  3WZN A;  4CDE A;  2AT5 X;  1G7N A;  2QCB A;  3P24 A;  2C4I A;  4I9R A;  3VHI A;  5F6B A;  5BVS A;  2F01 A;  4I3C A;  1JYJ A;  2I5Z O;  3QQ2 A;  1BRQ A;  1VWA B;  1ZNK A;  1X89 A;  2IZH B;  1IW2 A;  3TGA A;  1ZRY A;  2A3F X;  2DJF A;  2GC9 A;  2IZE B;  1U18 A;  2OVA A;  4BBO A;  2C1Q A;  5AQ6 A;  1HXL A;  1VWD B;  4YFR A;  2RTR B;  2G78 A;  1N4J A;  1SRH A;  3T2W A;  2KT4 B;  3JS1 A;  4YBU A;  2VDF A;  4U8U N;  1DZK A;  1HMR A;  2FS6 A;  1G74 A;  2L5P A;  2Q2P A;  1K3B A;  3O19 A;  1R0U A;  4GNW A;  4IAB A;  3BLG A;  3VG7 A;  5JR8 A;  1BSY A;  1I06 A;  2FHN X;  1VWM B;  2IZL B;  2QO5 A;  5H9L A;  5H9K A;  3VPJ E;  3FA8 A;  3FW4 A;  3O22 A;  3OE3 A;  4QZU A;  4Y5D A;  4YH0 A;  1GM6 A;  1MOY A;  1FTP A;  3NQ9 A;  1OPB A;  1VWH B;  2JGS A;  2L67 A;  2AT0 X;  4ALB A;  3KFH A;  1OEK A;  1E02 A;  3WZQ A;  1GX3 A;  4O3W A;  1EII A;  2BT9 A;  3VG4 A;  2RQ0 A;  3KFG A;  1ADL A;  1QY0 A;  4MVK A;  1SWK A;  3D9W A;  1PTS A;  2RTO B;  4KT5 A;  1NGL A;  3ZW2 A;  5BVT A;  2K62 A;  1DZP A;  4YGG A;  1DZM A;  1W5R A;  5BVQ A;  4CDF A;  3I0A A;  3WJG A;  3WYP A;  1TXL A;  1E5P A;  1SRI A;  1STR B;  1IJ8 A;  1S7D A;  3B2K A;  2X34 A;  4Y0Q A;  4AW8 A;  1GGL A;  2IZF B;  4K19 A;  1X8N A;  2F09 A;  3RBY A;  1SRE A;  2OFA A;  1KT3 A;  4HPD A;  5DPQ A;  1SWU A;  4ORX A;  1YWC A;  4ML7 B;  4BOE A;  4ZH6 A;  2RTE B;  2R74 A;  3B2I A;  1CBR A;  1LIB A;  3BX8 A;  2FR2 A;  4NW4 A;  2RTN B;  2W2B A;  1H91 A;  2NNQ A;  1MM9 A;  1FE3 A;  3T1D A;  3FA9 A;  1BWY A;  4GNY A;  4M7M A;  3STK A;  3RKG A;  2X45 A;  1KZW A;  5F2B A;  2WSJ A;  3FDC A;  2X8T A;  4YKM A;  2ALL X;  2FR3 A;  2RTB B;  1G5W A;  1Z24 A;  2W2F A;  3RWX A;  1LCW A;  4A1H A;  3D97 A;  2FHL A;  3LTW A;  3NQK A;  1E2T A;  4EDE A;  3VE2 A;  1XCA A;  1TW4 A;  1Y52 X;  2RTP B;  3APX A;  1JIW I;  2OF8 A;  1KQW A;  1ZNH A;  5KHP A;  1VWE B;  3FEP A;  2RTC B;  1MEP A;  3EYC A;  3T2X A;  5FQ8 E;  2R73 A;  3T6F A;  2X8F A;  2RTA A;  3FA6 A;  2FRS A;  5IO7 A;  1STP A;  1QWD A;  5K06 A;  4TKB A;  1SLF B;  3AKM A;  2RD7 C;  4O49 A;  4CDD A;  4AZQ A;  2BLG A;  5IO6 A;  1HY2 A;  4CDC A;  1LFO A;  4FBV A;  1PEE A;  1DV9 A;  5EZ2 A;  4AZR A;  2IZK A;  4IB7 A;  2MJI A;  2Q9S A;  2NNE A;  3TF6 A;  1HMT A;  1Y0G A;  4YCE A;  1O1U A;  2LKK A;  2RTG B;  1JZU A;  1ACD A;  4MIS A;  1Y55 X;  1VWP B;  1KL4 A;  3ZUI A;  1SWF A;  1ZNE A;  2CAM A;  2OL8 O;  2OY1 O;  4IAW A;  4GGT A;  4O4O A;  1EQD A;  4NLI A;  2WQA E;  3WXQ A;  1IFB A;  1PBY A;  4QNI A;  1SWP A;  3TZS A;  1KT7 A;  3FR5 A;  2FLJ A;  4WFU A;  1MX8 A;  2X46 A;  2Z4H A;  4TKH A;  4CPH B;  2HLV A;  1JBH A;  4L1N A;  1URE A;  4XMF A;  2RTF B;  3X00 A;  2ZSC A;  3GAQ A;  4A1Y A;  5HZ6 A;  5HZ5 A;  1AVD A;  2HZR A;  4ALO A;  4Z2O A;  3P6D A;  1EXS A;  4GD9 A;  3CQN A;  3NAD A;  1VWQ B;  2OY8 A;  3P6G A;  2OVD A;  4HPB A;  4ORW A;  3G7X A;  4QGX A;  2GTF X;  1KL5 A;  4MEE A;  4OMX A;  3RDO A;  2RTL A;  3Q34 A;  1SY1 A;  5D8J A;  4DQ4 A;  4CV7 A;  1JV4 A;  3RDS A;  3NX2 A;  1KZX A;  4YGH A;  1LUQ A;  2BS6 A;  4TKJ A;  1NQM A;  1NQN A;  2A2U A;  1ICN A;  1QFV A;  1VYF A;  4NNT A;  1SWN A;  3FEL A;  4IBA A;  3I17 A;  2RTJ A;  1WUB A;  1EPA A;  3SLT A;  2QOM A;  4GDZ A;  3ELX A;  1GKA A;  4O3Y A;  1SWB A;  2IZG B;  3PH5 A;  4OEL A;  1YUP A;  3KQ0 A;  1VWF B;  2X4M A;  4Z2P A;  5HTD A;  5L8I A;  2FS7 A;  2RN4 A;  1OBP A;  2A0A A;  2VFC A;  5B11 O;  5FAZ A;  1BJ7 A;  3HWG A;  5HCD C;  2GTL O;  1KT5 A;  1SY2 A;  5KID A;  3FLL A;  3F6Z B;  1VWO B;  2RCQ A;  3BRN A;  2AVI A;  1BEB A;  1LDO A;  1SLD B;  4OKA A;  3STN A;  1BBP A;  4D6B A;  5F58 A;  5H9N A;  1SWC A;  2FT9 A;  1ERB A;  2IZI A;  3CKG A;  3D95 A;  4D6A A;  1GX8 A;  2JU7 A;  4ZHH A;  4ZR2 A;  4NYQ A;  1U17 A;  3EM0 A;  3ZW1 A;  1SLE B;  4BX7 B;  3S5V A;  1WBI A;  3NQ3 A;  5EPQ A;  3ZQ3 A;  1YWA A;  3VHH A;  4ZH9 A;  3CR6 A;  4IB8 A;  3WJC A;  4UU2 A;  4IMO A;  1P6P A;  3VG2 A;  2YG2 A;  4O3Z A;  3RDU A;  4PJ2 A;  4JNJ A;  4I95 A;  4A60 A;  2P8G A;  4LZV A;  4ZJ0 A;  1HQQ A;  2AMM X;  2Y3E A;  3FID A;  4EKV A;  1YIV A;  1QY1 A;  3APV A;  3APW A;  3PDF A;  3MM0 A;  1MUP A;  1N9M A;  1X8O A;  4Z6J A;  4BQU A;  3BU9 A;  3WBG A;  1ML7 A;  4BGF A;  1LF7 A;  5AJB A;  2LBA A;  2XST A;  3SZH A;  4XMC A;  3EC5 A;  1T68 X;  3IFB A;  4C5P A;  1W4T A;  3HWF A;  3CMP A;  4O4S A;  3WOV A;  4N7C A;  5F7G A;  2AT8 X;  4IMN A;  2A8G A;  1T0V A;  2HZQ A;  2OVE A;  1KXO A;  3BSZ E;  4O4X A;  4YFQ A;  4IB6 A;  1LDQ A;  2G7B A;  1SRG A;  5B10 O;  4QYN A;  1DF3 A;  3CBC A;  2GJ5 A;  1SWS A;  2IZC B;  5L8N A;  3FIQ A;  3RZY A;  4U46 A;  1NP4 A;  1VWB B;  2XKL A;  5IO5 A;  3P6F A;  4HPA A;  3WYQ A;  3C77 X;  5HTE A;  4AZM A;  1ERX A;  1JJX A;  1SWO A;  1FEN A;  2QO4 A;  3UEW A;  3S26 A;  1EI5 A;  1LID A;  3NBX X;  3WVM A;  1KOI A;  1TVQ A;  3L4R A;  5LKF A;  3SZI A;  2UYW A;  3E3C A;  2FGS A;  4COT A;  3WZO A;  1X8U A;  3RDM A;  1BSQ A;  2JN3 A;  3BS2 A;  4AZN A;  4AYH A;  5K67 A;  2L68 A;  5LKE A;  4YDA A;  1BRP A;  3OBL A;  3WJF A;  1GT4 A;  1YWB A;  3PP6 A;  1FJ1 E;  2QO6 A;  3RY1 A;  4BX6 A;  3ZW0 A;  1N7Y A;  5B27 A;  1AEL A;  1FEL A;  1CBS A;  2KTS A;  2LBV A;  5LJE A;  3BU1 A;  3FYF A;  4ZHC A;  4FQB B;  1GT1 A;  1CBI A;  3SZJ A;  4XMG A;  4R0B A;  2RTK A;  3CWK A;  1YP6 A;  5HZ9 A;  1S2P A;  1GT3 A;  1VWG B;  4JGL A;  5FEN A;  2MHD A;  1SWL A;  1SWQ A;  5L3Y A;  1UZ2 X;  1VWJ B;  1VWC B;  4NV7 A;  3D96 A;  3FEN A;  1OSP O;  1XKI A;  4ID2 A;  1JYD A;  3EBW A;  4CPI A;  4ZHF A;  1B8E A;  1X8P A;  3WZP A;  1PBO A;  1SLG B;  5F1E A;  2Y32 A;  5K68 A;  3Q6L A;  4KH8 A;  3VU1 A;  5HCE C;  1S44 A; 
#chains in the Genus database with same CATH homology
 1ZND A;  3U9P C;  3SAO A;  3F9D A;  4U3Q A;  3ZZV A;  4IB9 A;  5LJH A;  5LJK A;  1GXA A;  2CZT A;  1YP7 A;  3DSZ A;  4MVI A;  2JOZ A;  3QKG A;  4WFV A;  4GRJ A;  3VE1 A;  3P6E A;  1SMP I;  1B0O A;  5HBS A;  3WJB A;  3BX7 A;  1DZJ A;  5F6Z A;  3PEC A;  3WJD A;  2JU3 A;  1I05 A;  4AZO A;  4NP1 A;  4DQ3 A;  1MVG A;  4NYR A;  2Q39 A;  3FA7 A;  4I3B A;  2R56 A;  1FEM A;  1EAL A;  5H8T A;  3N91 A;  3D4R A;  5D47 A;  3SOT A;  2OFM X;  2WWP A;  1TOW A;  4EQA C;  4TQ2 A;  5BYP A;  2AL0 X;  2N93 A;  3O2Y A;  1E06 A;  3HOE A;  5B29 A;  4I9S A;  4CSB A;  5AEO A;  4YFP A;  1KGL A;  2WEX A;  2WEW A;  1B56 A;  2L9C A;  4RUU A;  4UU3 A;  1E00 A;  1CRB A;  2BS5 A;  1LIF A;  1QAB E;  3B2L A;  3U0D A;  5HA1 A;  3JSQ A;  3MBT A;  3PQS A;  3NR3 A;  4LZU A;  3TGB A;  3C76 X;  4OS3 A;  5HAE A;  4QGW A;  1EUO A;  1MDC A;  1LKE A;  3C78 X;  2JU8 A;  1OBQ A;  2RCT A;  4HWM A;  1X8Q A;  1BSO A;  1HQP A;  2MM3 A;  1A3Y A;  3BY0 A;  3JQO A;  4U8U M;  5LJC A;  2LFO A;  1B4M A;  5FQ6 E;  3FW5 A;  4ORY A;  1IKE A;  3P6C A;  5HWZ A;  2X8S A;  4GKC A;  4IAX A;  1AQB A;  4YGZ A;  4U9C A;  2FTB A;  2KW1 A;  4ORU A;  4TLJ A;  1N0S A;  2CM9 A;  4CK4 A;  1ICM A;  4A8Z A;  1PMP A;  1D3S A;  3ZUO A;  3VG3 A;  4Y0P A;  5EED A;  2Q4N A;  3B2J A;  1ALB A;  2QOS C;  1SA8 A;  1SXY A;  2WUT A;  4FBR A;  1IIU A;  2F73 A;  3ELZ A;  3HK1 A;  2ASN X;  2JMB A;  2YMS A;  2BHV A;  1IKJ A;  4XMD A;  2ZAG A;  1LPJ A;  2CBS A;  2AT3 X;  4YDB A;  1KT6 A;  5KIC A;  4QQ1 A;  3VG5 A;  3PPT A;  1OEJ A;  1JJJ A;  1G85 A;  3KFI A;  4QGV A;  1SXU A;  4QRL A;  2GTL N;  1QFT A;  3LHN A;  4QAE A;  5DG4 A;  4BVM A;  1OBU A;  4OS0 A;  1U0X A;  1VPR A;  4NLJ A;  2KTD A;  2MWH A;  3STM X;  2Q2M A;  5D4A A;  2CBR A;  2W2A A;  3V8U A;  1I4U A;  1KT4 A;  2RA6 A;  3H3I A;  3WJE A;  3FR4 A;  1FDQ A;  1YWD A;  1EIO A;  4ORR A;  2OFR X;  4L3R A;  4LQZ A;  1AB0 A;  3UEV A;  3P6H A;  4MVL A;  4FBO A;  3F8A A;  1KQX A;  4ZGF A;  4ZHG A;  1D2U A;  2DM5 A;  3U03 A;  2LA7 A;  1ZNG A;  4YCH A;  3K3L A;  4NNS A;  4ARH A;  3EBK A;  4O9S A;  1CBQ A;  4HFO A;  4KII A;  1SY0 A;  2ANS A;  5EDB A;  4EFG A;  5HA0 A;  5HCC C;  3BDR A;  3RSW A;  3IA8 A;  4MIR A;  2ACP X;  1LIE A;  1AVG I;  4M6S A;  1RBP A;  4KC8 A;  5EEE A;  3HTY A;  2MO5 A;  3FEK A;  1IFC A;  3OJY C;  1LIC A;  1GKA B;  5D45 A;  4GH7 A;  3TGC A;  3CQR A;  2ACO A;  4ODD A;  4I6S A;  5FFH A;  5L8O A;  1CJ5 A;  3VG6 A;  1A18 A;  1L6M A;  2G79 A;  5HZQ A;  1A2D A;  4I3D A;  4PSQ A;  3FMZ A;  1VYG A;  3HWD A;  5C0N A;  2KD2 A;  3ZI8 A;  1BM5 A;  4TNN A;  2WR6 A;  3EMM A;  2WQ9 A;  1DC9 A;  2POA A;  1DFV A;  3PH6 A;  3PED A;  3HWE A;  2Z4I A;  4GE1 A;  4EEJ A;  2NND A;  3ZW1 B;  3NP1 A;  2JW1 A;  3KFF A;  2HNX A;  4FGI B;  4LKP A;  2M4L A;  1QY2 A;  1OEE A;  4GET A;  5CYB A;  3UAQ A;  4ZFX A;  1HN2 A;  5FQ7 E;  3APU A;  5CE4 A;  3PQU A;  5LJB A;  2IFB A;  2QM9 A;  4AZP A;  2O62 A;  4N7D A;  1SY3 A;  2ZAI A;  4GU8 A;  4YKO A;  4INN A;  1X71 A;  1O1V A;  2LB6 A;  3P02 A;  1OPA A;  4OMW A;  4GZV A;  4O4U A;  2HMB A;  1I04 A;  1HMS A;  2FWV A;  4ORS A;  4ON1 A;  2PY1 A;  3NPO A;  3KZA A;  2A13 A;  1NP1 A;  4MVE A;  2E4J A;  4XMH A;  1EPB A;  2AT6 X;  1HBQ A;  4YBP A;  4QYP A;  5LJG A;  3GE2 A;  4GK9 A;  4EXZ A;  2HYS A;  3S60 A;  5HZ8 A;  1QG5 A;  4ES7 A;  2OVS A;  3B2H A;  4KCA A;  4ZHD A;  1GX9 A;  1QQS A;  1BLR A;  2OZQ A;  2CZU A;  5AJC A;  5EDC A;  3FR2 A;  3MX7 A;  4OS8 A;  4TJZ A;  4XME A;  3OD9 A;  4YMY A;  3CBS A;  1A57 A;  3S5X A;  1EW3 A;  3LV4 A;  5H9A A;  5LJD A;  4O3X B;  1PM1 X;  2NP1 A;  3AKN A;  4QZT A;  3NX1 A;  5D48 A;  4WHI A;  3MVF A;  1Y9L A;  1HBP A;  2EU7 X;  4ZCB A;  4KC7 A;  4ZGU A;  3ZW0 B;  2K23 A;  1GT5 A;  1SXW A;  2A2G A;  3HOL A;  3DTQ A;  2QMI A;  1ZNL A;  2AKQ A;  3UEX A;  4U8U O;  4WBK A;  1T8V A;  2GTL M;  1LNM A;  4HPC A;  3ZWE A;  1O8V A;  1RLB E;  1TOU A;  4Y0S A;  4RUN A;  4Y0R A;  1MX7 A;  2AH7 X;  3UEU A;  1SXX A;  4LKT A;  2CM4 A;  1Y9T A;  2AT5 X;  1G7N A;  4I9R A;  3P24 A;  5F6B A;  5BVS A;  4I3C A;  1JYJ A;  1BRQ A;  1ZNK A;  1X89 A;  3TGA A;  1IW2 A;  1ZRY A;  2A3F X;  2GC9 A;  1U18 A;  2OVA A;  5AQ6 A;  2G78 A;  2KT4 B;  3JS1 A;  4YBU A;  4U8U N;  1DZK A;  1HMR A;  2FS6 A;  1G74 A;  2L5P A;  2Q2P A;  3O19 A;  4GNW A;  1R0U A;  4IAB A;  3VG7 A;  3BLG A;  5JR8 A;  1BSY A;  1I06 A;  5H9K A;  2QO5 A;  3VPJ E;  5H9L A;  3FA8 A;  3FW4 A;  3O22 A;  3OE3 A;  4QZU A;  4YH0 A;  4ALO A;  1GM6 A;  1FTP A;  3NQ9 A;  1OPB A;  2L67 A;  2AT0 X;  4ALB A;  3KFH A;  1OEK A;  1E02 A;  4O3W A;  1EII A;  2BT9 A;  3VG4 A;  2RQ0 A;  3KFG A;  1ADL A;  1QY0 A;  4MVK A;  4KT5 A;  1NGL A;  3ZW2 A;  5BVT A;  2K62 A;  1DZP A;  4YGG A;  1DZM A;  5BVQ A;  3I0A A;  3WJG A;  1TXL A;  1E5P A;  1S7D A;  3B2K A;  4Y0Q A;  4AW8 A;  1GGL A;  4K19 A;  3RBY A;  1X8N A;  2F09 A;  1KT3 A;  4HPD A;  5DPQ A;  4ORX A;  1YWC A;  4ML7 B;  4BOE A;  4ZH6 A;  2R74 A;  3B2I A;  1CBR A;  1LIB A;  3BX8 A;  2FR2 A;  4NW4 A;  2W2B A;  1H91 A;  2NNQ A;  1FE3 A;  3T1D A;  3FA9 A;  1BWY A;  4GNY A;  4M7M A;  3STK A;  3RKG A;  2X45 A;  1KZW A;  2WSJ A;  4YKM A;  2X8T A;  2ALL X;  2FR3 A;  1G5W A;  1Z24 A;  2W2F A;  3RWX A;  4A1H A;  3D97 A;  3NQK A;  4EDE A;  3VE2 A;  1XCA A;  1TW4 A;  3APX A;  1JIW I;  1KQW A;  1ZNH A;  5KHP A;  3FEP A;  3EYC A;  5FQ8 E;  2R73 A;  2X8F A;  3FA6 A;  2FRS A;  5IO7 A;  5K06 A;  1QWD A;  4TKB A;  3AKM A;  2RD7 C;  4O49 A;  4AZQ A;  2BLG A;  5IO6 A;  1LFO A;  4FBV A;  1PEE A;  1DV9 A;  5EZ2 A;  4AZR A;  4IB7 A;  2MJI A;  2Q9S A;  2NNE A;  3TF6 A;  1HMT A;  4YCE A;  2LKK A;  1O1U A;  1JZU A;  1ACD A;  4MIS A;  3ZUI A;  4O4O A;  1ZNE A;  4IAW A;  1EQD A;  4NLI A;  2WQA E;  3WXQ A;  1IFB A;  4QNI A;  3TZS A;  1KT7 A;  3FR5 A;  2FLJ A;  4WFU A;  1MX8 A;  2X46 A;  2Z4H A;  4TKH A;  1JBH A;  2HLV A;  4L1N A;  1URE A;  4XMF A;  4A1Y A;  5HZ6 A;  3GAQ A;  5HZ5 A;  2HZR A;  3P6D A;  1EXS A;  3CQN A;  3NAD A;  3P6G A;  4ORW A;  2OVD A;  4HPB A;  4QGX A;  3G7X A;  2GTF X;  4OMX A;  4CV7 A;  4DQ4 A;  1SY1 A;  5D8J A;  1JV4 A;  3NX2 A;  1KZX A;  4YGH A;  2BS6 A;  4TKJ A;  2A2U A;  1ICN A;  1QFV A;  1VYF A;  4NNT A;  3FEL A;  4IBA A;  3I17 A;  1EPA A;  4GDZ A;  3ELX A;  1GKA A;  4O3Y A;  3PH5 A;  1YUP A;  3KQ0 A;  5HTD A;  5L8I A;  2FS7 A;  2RN4 A;  1OBP A;  2A0A A;  5FAZ A;  1BJ7 A;  3HWG A;  5HCD C;  2GTL O;  1KT5 A;  1SY2 A;  5KID A;  3FLL A;  3F6Z B;  3STN A;  2RCQ A;  3BRN A;  4YFR A;  1BEB A;  1BBP A;  4D6B A;  5F58 A;  5H9N A;  2FT9 A;  1ERB A;  3D95 A;  4D6A A;  1GX8 A;  2JU7 A;  4ZHH A;  4ZR2 A;  4NYQ A;  1U17 A;  3EM0 A;  3ZW1 A;  3S5V A;  3NQ3 A;  5EPQ A;  3ZQ3 A;  1YWA A;  3WJC A;  4ZH9 A;  3CR6 A;  4IB8 A;  4UU2 A;  4IMO A;  1P6P A;  3VG2 A;  2YG2 A;  4O3Z A;  4PJ2 A;  4A60 A;  4I95 A;  2P8G A;  4LZV A;  4ZJ0 A;  2AMM X;  1YIV A;  1QY1 A;  3APV A;  3APW A;  1MUP A;  1X8O A;  4BQU A;  3BU9 A;  3WBG A;  1ML7 A;  1LF7 A;  5AJB A;  2LBA A;  2XST A;  4XMC A;  3IFB A;  1T68 X;  4O4S A;  3HWF A;  3CMP A;  3WOV A;  4N7C A;  5F7G A;  2AT8 X;  4IMN A;  1T0V A;  2HZQ A;  2OVE A;  1KXO A;  3BSZ E;  4O4X A;  4YFQ A;  4IB6 A;  2G7B A;  4QYN A;  1DF3 A;  3CBC A;  2GJ5 A;  5L8N A;  3FIQ A;  3RZY A;  1NP4 A;  2XKL A;  5IO5 A;  3P6F A;  4HPA A;  3C77 X;  5HTE A;  4AZM A;  1ERX A;  1JJX A;  1FEN A;  2QO4 A;  3UEW A;  3S26 A;  1EI5 A;  1LID A;  3NBX X;  3WVM A;  1KOI A;  1TVQ A;  3L4R A;  5LKF A;  3E3C A;  4COT A;  1X8U A;  1BSQ A;  2JN3 A;  3BS2 A;  4AZN A;  4AYH A;  2L68 A;  5LKE A;  4YDA A;  1BRP A;  3OBL A;  3WJF A;  1GT4 A;  1YWB A;  3PP6 A;  2QO6 A;  1AEL A;  3ZW0 A;  5B27 A;  1FEL A;  1CBS A;  2KTS A;  2LBV A;  5LJE A;  3BU1 A;  3FYF A;  4ZHC A;  4FQB B;  1GT1 A;  1CBI A;  4XMG A;  4R0B A;  3CWK A;  1YP6 A;  5HZ9 A;  1S2P A;  1GT3 A;  4JGL A;  5FEN A;  2MHD A;  1UZ2 X;  3D96 A;  3FEN A;  1XKI A;  4ID2 A;  1JYD A;  3EBW A;  4ZHF A;  1B8E A;  1X8P A;  1PBO A;  5F1E A;  3Q6L A;  4KH8 A;  3VU1 A;  5HCE C;  1S44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...