1KZWA

Solution structure of human intestinal fatty acid binding protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
131
structure length
131
Chain Sequence
b'AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTESTINAL FATTY ACID-BINDING PROTEIN (A54)
publication title Solution structure of human intestinal fatty acid binding protein with a naturally-occurring single amino acid substitution (A54T) that is associated with altered lipid metabolism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 33
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2002-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1kzwA00
2ACPX 1EIOA 2L68A 2R74A 1YP7A 3U03A 2RQ0A 2IFBA 3WJGA 4ALOA 5L8OA 3KQ0A 1U18A 4I3BA 1A57A 3FEKA 3HWDA 1KQXA 2X45A 1X8NA 4HPDA 1EXSA 4BQUA 1B4MA 5F1EA 2HZRA 2FR3A 5EEDA 4QZTA 4MVKA 1E06A 2L67A 3UEXA 4HPCA 3BU1A 2AL0X 1KT4A 2WR6A 4OMXA 3WJDA 4AZNA 3BDRA 3EM0A 5HZ8A 1G85A 2WUTA 4QGWA 5EZ2A 3U0DA 4M6SA 4ORXA 1EPAA 1JJXA 3BY0A 3NADA 4HPAA 2ANSA 5HCEC 4OMWA 3EBWA 1GKAA 2G78A 1BRPA 1CBQA 1ZRYA 2WEWA 1D3SA 1A18A 1NGLA 1YP6A 2JU3A 3P6FA 4YGGA 1SA8A 2LB6A 1ZNDA 1KT7A 3RSWA 1MDCA 1GT1A 4QYPA 1EUOA 1HBPA 1X8UA 1QABE 1X8OA 3HWFA 1X89A 4I9SA 1S44A 4YGHA 1QY2A 5LJCA 1IW2A 2YG2A 5F58A 2RA6A 1T0VA 4ORRA 3PPTA 3PP6A 3STMX 4ZHFA 1QWDA 3C78X 3NQ3A 1GKAB 4PSQA 5DPQA 2QM9A 1CBIA 5LJHA 3P6HA 3B2LA 2FTBA 2GJ5A 1X71A 1BLRA 2WWPA 1GGLA 3CBCA 1SXWA 3WJEA 1EALA 4ZHHA 5H9AA 2LFOA 2CM9A 3KFFA 2POAA 4NYQA 3JSQA 3P6GA 1FEMA 1E5PA 1L6MA 1E02A 1BSOA 4KIIA 3CBSA 3U9PC 5HAEA 4XMEA 5B27A 1GM6A 1FDQA 1B0OA 4ORYA 4D6BA 4AYHA 1SXYA 1D2UA 3F8AA 3KZAA 4K19A 1O8VA 2AT5X 1SY2A 3CMPA 1A2DA 1SY0A 5LKFA 1PMPA 5EDBA 2HZQA 5HTEA 3KFIA 4YH0A 3JS1A 3O2YA 4ZJ0A 3ELZA 4ES7A 2QO4A 5JR8A 1QFTA 1H91A 1ICNA 1FELA 1OBQA 2JU7A 3B2JA 3I0AA 2F73A 4O9SA 2FR2A 1LNMA 4Y0RA 4ZGUA 1BSQA 2LBVA 2E4JA 5EPQA 2FS6A 3STNA 3WJFA 3L4RA 1YWDA 4NYRA 3D95A 5FENA 1ERXA 5C0NA 1LIFA 2NNEA 3AKNA 4ORWA 4LKTA 1I05A 2HLVA 3VG4A 2HYSA 1YUPA 1DFVA 4YGZA 2JN3A 1GX9A 4IB6A 2Q9SA 1GT4A 1MVGA 4RUUA 4QGVA 1LICA 3HWEA 2CZTA 3WBGA 2W2FA 4YDBA 4YKOA 1ZNEA 5F6BA 3IFBA 3BSZE 3FR2A 3EBKA 1DZJA 1S2PA 3BRNA 3RZYA 4GH7A 2HMBA 1LIEA 4I9RA 1OBPA 1I4UA 3FA9A 3P6CA 4YFPA 3APUA 1KXOA 4QGXA 3ELXA 3WJCA 2WSJA 1ERBA 3B2KA 4AZPA 3OJYC 3FW5A 4BVMA 1P6PA 4IAXA 2NNDA 3O19A 3FA6A 4XMDA 2OFRX 2FRSA 4AZOA 4A60A 1CRBA 1QFVA 3FR4A 4QAEA 5HCCC 2HNXA 4XMGA 5KIDA 1BEBA 3D96A 5HZ9A 4Y0PA 2CZUA 2ALLX 1G74A 4DQ3A 1JZUA 1N0SA 4XMFA 4ZH6A 4TKHA 1GX8A 2WEXA 2O62A 1ZNLA 3BX7A 1PBOA 1IIUA 3EMMA 4TQ2A 5BVSA 5HBSA 1KQWA 4NNTA 3QKGA 4ZFXA 5D45A 4I3DA 4TNNA 4AZMA 2MJIA 3PH5A 4LZVA 3FENA 5KICA 2LBAA 3CQNA 1AVGI 1KZXA 4WBKA 4UU2A 4HFOA 3NPOA 4M7MA 1G5WA 4CK4A 4NLIA 2OVAA 1T8VA 2XKLA 3NX2A 5FAZA 3WJBA 4ORUA 3FA7A 2MO5A 4Y0QA 5F6ZA 4WFVA 4AZRA 1YIVA 3UEUA 3TGBA 1KOIA 1KGLA 1HN2A 2R56A 3PECA 4RUNA 5HA1A 1QY1A 2W2AA 1T68X 5IO6A 1O1VA 1X8PA 3C76X 1ALBA 3FMZA 4HPBA 1JYJA 1SY1A 4TJZA 5D8JA 1OEKA 4EXZA 5D4AA 5LJKA 2KTDA 3F9DA 1U0XA 1AELA 1EQDA 3FELA 1OPBA 3CWKA 1JYDA 4NP1A 2JU8A 2L5PA 4D6AA 1ACDA 4ALBA 3C77X 1LIDA 4ORSA 1E00A 1CJ5A 2L9CA 1R0UA 1X8QA 3B2IA 1YWBA 2G7BA 1BSYA 2Q2PA 1MUPA 3Q6LA 5EDCA 2MM3A 3APXA 4XMCA 1JBHA 1XKIA 1QY0A 2A3FX 2NP1A 5H8TA 4EEJA 1TW4A 3S26A 5IO7A 1NP4A 2A2GA 3KFHA 5KHPA 2KT4B 4TKBA 3DTQA 4N7DA 2Q2MA 1RLBE 3BS2A 1S7DA 4IB7A 4YDAA 3TF6A 2AT8X 1LIBA 5H9KA 1TOUA 2DM5A 4N7CA 1BM5A 1RBPA 2K62A 4IBAA 1IFCA 1DC9A 2WQ9A 2X46A 4YCHA 3K3LA 4ZH9A 3PEDA 3FLLA 1LKEA 4R0BA 3T1DA 1MX7A 1VPRA 2LKKA 4EFGA 3TZSA 4YFQA 1LF7A 1SY3A 5HWZA 2WQAE 2PY1A 3GAQA 3D97A 1KT3A 4TKJA 3VG6A 3BX8A 3APVA 1OBUA 3FA8A 3VG5A 5HA0A 1ZNGA 4YFRA 2OVEA 1ZNKA 1DF3A 2A0AA 3HWGA 4MVIA 1SXUA 1A3YA 4QZUA 5FFHA 4ODDA 3NP1A 1TOWA 4UU3A 1HMSA 5CE4A 1OPAA 1ADLA 2Q39A 1IFBA 4IAWA 5BVTA 5HTDA 4TLJA 3P6EA 1SXXA 2OVDA 1KZWA 1BBPA 3NR3A 1U17A 3I17A 2OZQA 3CQRA 2NNQA 1BRQA 2RCTA 5H9NA 5L8NA 5IO5A 2AMMX 1EPBA 1ML7A 1EW3A 4GETA 3O22A 2GC9A 4WFUA 3NX1A 2QO6A 3STKA 1PEEA 3MVFA 4Y0SA 3CR6A 4YBUA 5LJGA 4GKCA 1UREA 4LZUA 1OEEA 2BLGA 2P8GA 4IB9A 3ZUIA 1ICMA 5EEEA 4ZR2A 1B8EA 3NQ9A 4ARHA 2QOSC 2JOZA 5D47A 1NP1A 2Q4NA 3WVMA 1CBRA 4ZCBA 5LJDA 2CBRA 1AQBA 4DQ4A 3KFGA 5BVQA 3VG2A 4NLJA 2QO5A 3AKMA 5HZQA 3WXQA 1ZNHA 1FTPA 3IA8A 4OS0A 4GNYA 1AB0A 1Z24A 4OS8A 4EDEA 5LJBA 1IKEA 1LPJA 4A8ZA 2ACOA 1FENA 5D48A 4NNSA 1UZ2X 2FS7A 4A1YA 2RCQA 2XSTA 2N93A 1IKJA 4IMOA 2A2UA 3FR5A 1TVQA 4AZQA 1VYFA 1HQPA 1CBSA 2FLJA 2ASNX 3HK1A 4A1HA 4YKMA 3BU9A 3MBTA 5DG4A 3FEPA 3SAOA 2CM4A 1DZMA 1I06A 3UEWA 4AW8A 3UEVA 1GT5A 2AT3X 1PM1X 2R73A 2W2BA 1GXAA 5AQ6A 1KT5A 1DZKA 1DZPA 1O1UA 1TXLA 3B2HA 2FT9A 3APWA 1LFOA 2G79A 4YCEA 4BOEA 1HMTA 3TGAA 2GTFX 5LJEA 1YWAA 5HCDC 4XMHA 2AH7X 2OFMX 3ZUOA 3ZQ3A 1VYGA 1B56A 2CBSA 3FW4A 5B29A 4GRJA 5LKEA 1DV9A 1JJJA 1BWYA 1YWCA 4OS3A 4IMNA 3EYCA 1MX8A 1EIIA 1G7NA 4YBPA 2EU7X 2AT6X 3VG7A 4IB8A 1JV4A 2K23A 2FWVA 2AT0X 4LKPA 5H9LA 1KT6A 4GE1A 4I3CA 2RD7C 1HMRA 1XCAA 1GT3A 1BJ7A 2A13A 4ZHDA 3BLGA 3DSZA 3P6DA 1QQSA 2AKQA 4GNWA 3FIQA 4QYNA 1OEJA 4ZHCA 5HZ6A 5L8IA 5HZ5A 3PH6A 3G7XA 4MVLA 1I04A 3TGCA 1HBQA 4ZHGA 5K06A 1FE3A 4YMYA 1QG5A 5F7GA 3VG3A
chains in the Genus database with same CATH superfamily
2ACPX 1EIOA 4CDCA 2L68A 2R74A 2JMBA 1YP7A 3U03A 2RQ0A 2OL6O 2IFBA 3WJGA 1I78A 4ALOA 5CHKA 3OBLA 3KQ0A 5L8OA 1SWRA 3MG5A 1U18A 1N9MA 4I3BA 3FEKA 3HWDA 1A57A 1KQXA 2KD2A 2X45A 1X8NA 4HPDA 1EXSA 1STRB 4BQUA 4Z2VA 1B4MA 5F1EA 4O4OA 2VFCA 2HZRA 2A8GA 4GU8A 2FR3A 5EEDA 2BS5A 2RTFB 2RTPB 4QZTA 3ZW1A 1KL5A 1LUQA 4BGFA 2RTJA 1E06A 2L67A 3Q34A 4MVKA 2I5VO 1VWDB 4HPCA 3MM0A 3BU1A 2AL0X 1KT4A 2WR6A 3RWXA 2JGSA 4OMXA 3WJDA 4AZNA 1LDOA 3BDRA 2RTOB 3EM0A 5HZ8A 1G85A 2G8CO 2WUTA 3RDMA 5B5GA 1VWCB 2X8TA 4QGWA 5EZ2A 4Z2PA 3EC5A 3U0DA 4M6SA 4ORXA 2IZLB 1EPAA 1JJXA 3BY0A 3NADA 4HPAA 2ANSA 5HCEC 5BYPA 4OMWA 3EBWA 1SLFB 1GKAA 1BM5A 2G78A 1BRPA 2OYBO 4YVBA 1CBQA 1ZRYA 2WEWA 1LCZA 1D3SA 4ZGFA 3ZW1B 1A18A 1NGLA 1YP6A 2JU3A 3P6FA 4YGGA 3T2XA 1SA8A 1MM9A 2LB6A 1ZNDA 1SMPI 1KT7A 3T6FA 3RSWA 1MDCA 1GT1A 2Y3FA 4K19A 2RTAA 3ZW0B 3ZZVA 4QYPA 1EUOA 1HBPA 1X8UA 1SREA 3UEXA 1QABE 1X8OA 2GTLO 3HWFA 1X89A 2X8SA 1S44A 2IZEB 3CKGA 4I9SA 2HKDA 4YGHA 1QY2A 4EQAC 5LJCA 1IW2A 2YG2A 5F58A 3V8UA 2RA6A 1T0VA 2LA7A 4MISA 1JJUA 4ORRA 1VYOA 3PPTA 3PP6A 3STMX 4ZHFA 2Y3EA 1QWDA 3C78X 3NQ3A 1GKAB 4PSQA 5DPQA 4CPFA 4GDAA 2QM9A 1CBIA 5LJHA 3P6HA 3B2LA 3D4RA 2FTBA 2GJ5A 3P02A 1X71A 3RKGA 2IZGB 1BLRA 2IZFB 2WWPA 1GGLA 3CBCA 1SXWA 4I60A 3WJEA 3SOTA 4ZHHA 1EALA 2RTGB 5H9AA 2RTNB 2LFOA 2CM9A 4C5PA 3KFFA 2POAA 1RSUB 4NYQA 1OSPO 2IZKA 3JSQA 1SWKA 3WYPA 3P6GA 1FEMA 3SZHA 1E5PA 1L6MA 1E02A 1BSOA 3EW1A 3CBSA 4KIIA 3U9PC 5HAEA 1SRIA 4XMEA 5B27A 1GM6A 2BHVA 1FDQA 1SWCA 4DCBA 1B0OA 4ORYA 2RTKA 4FQBB 3N91A 4D6BA 4AYHA 1SXYA 1D2UA 1PTSA 2RTBB 3F8AA 1O8VA 2AT5X 1SY2A 3CMPA 1LCWA 3KZAA 3S5XA 1A2DA 1SY0A 2X4MA 5LKFA 1PMPA 4I95A 5EDBA 4DNEA 2HZQA 1Y9LA 2M4LA 5HTEA 3KFIA 4GJSA 4YH0A 3JS1A 1SWBA 3O2YA 1RAVA 3T6LA 4ZJ0A 3ELZA 4ES7A 2QO4A 5JR8A 1QFTA 1H91A 5IO7A 5IRWA 4NV7A 3QQ2A 4O49A 3SZIA 4GK9A 1ICNA 1FELA 4BBOA 1OBQA 2JU7A 3B2JA 3I0AA 3WZNA 5K67A 4O3ZA 2F73A 4O9SA 2FR2A 1VWMB 1LNMA 4O4UA 1VWOB 4Y0RA 4CPHB 1BSQA 1JIWI 1KL3A 2LBVA 2E4JA 4BX7B 1LCVA 5EPQA 4ZGUA 2FS6A 3STNA 3WJFA 3L4RA 1YWDA 4NYRA 3D95A 5FENA 1ERXA 3NQKA 1LIFA 5C0NA 2AF5A 2NNEA 3AKNA 4ORWA 4LKTA 1I05A 2HLVA 2A5BA 3JQOA 2MWHA 2I5ZO 1K24A 3VG4A 2HYSA 2IZDB 1VWIB 1FJ1E 1YUPA 1DFVA 3FDCA 2OL7A 4YGZA 2JN3A 3RDOA 1GX9A 4IB6A 2Q9SA 1GT4A 1MVGA 4RUUA 3ZW2A 4QGVA 1LICA 3HWEA 1SWTA 2CZTA 3WBGA 2W2FA 3OE3A 1AVDA 4YDBA 2GTLM 4YKOA 1ZNEA 5L3YA 5F6BA 3ZWEA 3IFBA 2OY1O 5FQ8E 1KFFA 3BSZE 2YMSA 1DZJA 1S2PA 3BRNA 3EBKA 1GX3A 3FR2A 4U3QA 3RZYA 4Y5DA 4CSBA 3D9WA 3WYQA 4GH7A 3SLJA 2HMBA 5B3MO 1LIEA 2DJFA 4I9RA 3RDQA 3X00A 1OBPA 1I4UA 2IZHB 3FA9A 3P6CA 5F2BA 4YFPA 1W6FA 4FBRA 3APUA 1KXOA 1VWEB 4KC7A 4QGXA 3ELXA 3WJCA 2WSJA 1ERBA 3B2KA 2QCBA 4AZPA 3OJYC 1N7YA 3FW5A 4BVMA 4Z2OA 4JNJA 4QQ1A 4U8UO 1NQMA 4INNA 1P6PA 4IAXA 2BSZA 1SRFA 2NNDA 3O19A 1SLDB 3FA6A 4KH8A 4XMDA 4CDDA 2OFRX 2FRSA 3WZPA 4AZOA 4A60A 2ZAIA 1CRBA 3VHIA 1QFVA 1Y53X 3ZW0A 4FGIB 3FR4A 1JQPA 4QAEA 5HCCC 2HNXA 4XMGA 5CYBA 3VGWA 2KTSA 1BEBA 3D96A 5KIDA 3VHHA 5HZ9A 1SWAA 5JD2A 2FHNX 2GH7A 3ZI8A 4Y0PA 2RTCB 2CZUA 1PBYA 1G74A 1VWRB 2ALLX 4O3YA 1N0SA 4XMFA 4ZH6A 4DQ3A 4TKHA 1EI5A 1GX8A 2WEXA 3GE2A 4BCSA 2O62A 1ZNLA 1NBXA 3BX7A 4U46A 1VWNB 1N4JA 3HTYA 1PBOA 5AJCA 1IIUA 3EMMA 4TQ2A 5BVSA 1Y0GA 4JGLA 5HBSA 1KQWA 4NNTA 3QKGA 4GGZA 4ZFXA 5D45A 4ID2A 3WZQA 4I3DA 4TNNA 4AZMA 2MJIA 3PH5A 4GUZA 4LZVA 3FENA 5KICA 2LBAA 3CQNA 2OL8O 1AVGI 1SWSA 1JMZA 1KZXA 4WBKA 1SWLA 2FKJA 4UU2A 1VWKB 3PK2A 1SWOA 3NPOA 4HFOA 4M7MA 3P24A 3RDXA 3FYFA 1G5WA 4CK4A 1E2TA 4Y59A 4NLIA 4QRLA 2Y32A 2OVAA 1RXHA 1T8VA 2XKLA 3NX2A 5FAZA 3WJBA 4ORUA 1WUBA 3FA7A 2MO5A 4Y0QA 1UYNX 4WFVA 5F6ZA 5FQ7E 4O4SA 2PI3O 4AZRA 1DF8A 1YIVA 1VWAB 3S5VA 1SRJA 3UEUA 3TGBA 1KOIA 1KGLA 1HN2A 2R56A 3PECA 3OD9A 4RUNA 5HA1A 1QY1A 2W2AA 1T68X 3MX7A 5IO6A 4CDFA 1O1VA 3UAQA 1X8PA 3C76X 2IZAA 2OFAA 4CPHA 1ALBA 4BX7A 3FMZA 4ML7B 4HPBA 3RY2A 2X34A 1JYJA 4BX5A 1SY1A 2UZ2A 2VFBA 4TJZA 5D8JA 1OEKA 2C4IA 4EXZA 5D4AA 2OF9A 5LJKA 2KTDA 3RY1A 3F9DA 1U0XA 1AELA 1EQDA 3FELA 4PJ2A 3H3IA 1OPBA 3CWKA 4U8UM 3VE2A 1JYDA 4NP1A 1VWFB 2JU8A 2L5PA 3RBYA 1ACDA 2X56A 4ALBA 3C77X 4D6AA 1LIDA 4ORSA 1E00A 2IZBA 4CV7A 1AVEA 1CJ5A 2L9CA 4LQZA 1R0UA 2CAMA 1X8QA 3FIDA 1VWQB 3RE6A 3B2IA 1YWBA 2G7BA 1BSYA 2Q2PA 3NBXX 1MUPA 1N9YA 4KCAA 3Q6LA 5EDCA 2MM3A 1RXJA 4BX5B 5B11O 3APXA 3KVNA 2C1QA 4XMCA 1JBHA 4WHIA 1XKIA 4HWMA 1QY0A 2A3FX 2NP1A 5H8TA 4IRWA 1TW4A 1LDQA 3S26A 1NP4A 2A2GA 3KFHA 5KHPA 2KT4B 1SLEB 4TKBA 3DTQA 4N7DA 2Q2MA 5FQ6E 1RLBE 3BS2A 1S7DA 2IZIA 4FBOA 4IB7A 4YDAA 3TF6A 2AVIA 2AT8X 4OEMA 1LIBA 5H9KA 3LV4A 1TOUA 2DM5A 4N7CA 5IRAA 1RBPA 2K62A 4GDZA 4IBAA 1IFCA 1DC9A 2WQ9A 4MVEA 4JO6A 2X55A 2X46A 4YCHA 3K3LA 4ZH9A 2UYWA 2C1SA 3PEDA 4GGRA 2RTEB 3FLLA 1LKEA 2RN4A 1N43A 1I9HA 4ZHCA 1IJ8A 4R0BA 3T1DA 1MX7A 1VPRA 2F01A 2LKKA 4EFGA 3TZSA 4YFQA 1LF7A 1SY3A 4CPIA 2WQAE 1VWPB 5HWZA 2PY1A 3GAQA 3D97A 1KT3A 4TKJA 3E3CA 3VG6A 3BX8A 3APVA 1OBUA 3FA8A 2IZJA 5HA0A 1ZNGA 2OY5O 2OVEA 1ZNKA 4IABA 3VG5A 4YFRA 5AEOA 2A0AA 3HWGA 4OKAA 1DF3A 2G5LA 4OELA 4MVIA 1SXUA 1A3YA 1VWJB 4QZUA 5FFHA 2GTLN 3NP1A 4ODDA 1TOWA 5CSEA 4UU3A 1HMSA 5CE4A 1OPAA 1ADLA 2Q39A 4GGTA 1JMXA 1IFBA 4IAWA 2KW1A 5BVTA 3HPEA 4TLJA 3P6EA 5HTDA 3EW2A 1SXXA 2OVDA 1HY2A 1KZWA 1BBPA 3CKFA 1STSB 2X8FA 5HZ6A 1SWNA 3PQUA 1Y9TA 3NR3A 2X32A 1U17A 2FGSA 2OZQA 3I17A 3CQRA 2NNQA 2OVSA 1BRQA 1HQQA 4O4XA 2RCTA 5H9NA 5L8NA 5IO5A 2AMMX 1EPBA 1MOYA 4L3RA 5AJBA 1ML7A 1EW3A 4I6SA 4GETA 3O22A 2GC9A 1NDJA 4NW4A 2OFBA 4WFUA 4QNIA 3NX1A 2RTDB 2QO6A 3RDSA 3STKA 1W4TA 1PEEA 3MVFA 1VWHB 1K3BA 3CR6A 4Y0SA 4YBUA 5LJGA 4KT5A 4GKCA 1UREA 4L1NA 4LZUA 2ZSCA 1VWBB 1OEEA 2BLGA 2P8GA 4IB9A 4EKVA 2RTMA 3ZUIA 1ICMA 5EEEA 3LHNA 1B8EA 1SWDA 3NQ9A 4ZR2A 4EEJA 4ARHA 2VDFA 3HOEA 2FKGA 4JHQA 4BX6A 1JZUA 2QOSC 2JOZA 5D47A 1NP1A 2BC3A 2RTQB 2Q4NA 3VPJE 4CDEA 1SLGB 1LELA 4GZVA 2BS6A 1SWFA 1RSTB 5B10O 3WVMA 1CBRA 4ZCBA 5LJDA 2CBRA 1AQBA 4DQ4A 2OY8A 2Z4HA 3KFGA 1SRGA 5BVQA 3VG2A 3VHMA 2Z4IA 1VWLB 2QO5A 3AUMO 3AKMA 4NLJA 5HZQA 3S60A 1NC9A 3WXQA 4BJ8A 1ZNHA 4FBVA 1FTPA 3IA8A 4OS0A 1SWHA 4GNYA 1AB0A 1Z24A 2MHDA 4OS8A 3VU1A 4EDEA 5LJBA 2RTHB 1IKEA 1LPJA 1SWEA 2ACOA 4A8ZA 1KL4A 2WPUA 1FENA 2FHLA 5D48A 4NNSA 1UZ2X 2ZAGA 4GD9A 5B2AO 4KC8A 4BX6B 2FS7A 4A1YA 2RCQA 2XSTA 2N93A 1IKJA 1UYOX 3HOLA 5B5FA 4IMOA 1HXZA 2A2UA 3FR5A 1TVQA 4MIRA 4AZQA 1VYFA 4O3WA 1HQPA 1CBSA 2FLJA 2ASNX 3HK1A 4MEEA 3RE5A 3RDUA 4A1HA 3VE1A 4COTA 4YKMA 4U9CA 4B55A 3BU9A 2QOMA 3MBTA 4GJVA 5DG4A 1SWUA 3FEPA 3SAOA 2CM4A 2RTLA 3PQSA 1DZMA 1I06A 3UEWA 1MEPA 2IZCB 2OF8A 4AW8A 3UEVA 1GT5A 2AT3X 1PM1X 2F09A 1STPA 2R73A 2W2BA 1GXAA 5AQ6A 1KT5A 1DZKA 1DZPA 5IRUA 1O1UA 1TXLA 4O3XB 3B2HA 2FT9A 3APWA 1LFOA 2G79A 1Y52X 1HXLA 1NQNA 1SWGA 4YCEA 4BOEA 4CPEA 1HMTA 3TGAA 2GTFX 5IXGA 5LJEA 1YWAA 2RTIB 4Z28A 4XMHA 2AH7X 5HCDC 3SLOA 1SRHA 2OFMX 2BT9A 4U8UN 2OY7A 1RXKA 3ZQ3A 1VYGA 1SWPA 1B56A 3WZOA 2CBSA 3FW4A 3ZUOA 5B29A 4Z27A 4ON1A 1SWQA 4GRJA 5LKEA 1DV9A 1JJJA 2RTRB 1BWYA 4NV8A 1SWJA 1YWCA 2MF6A 3T2WA 5K68A 4OS3A 2A5CA 4IMNA 3EYCA 3LTWA 1MX8A 1EIIA 1G7NA 4YBPA 2EU7X 2AT6X 3VG7A 3AEHA 1JV4A 2JW1A 4IB8A 1MK5A 3F6ZB 2K23A 2FWVA 2AT0X 3PDFA 4LKPA 5H9LA 1KT6A 3SZJA 4GE1A 4I3CA 2RD7C 1HMRA 1XCAA 2DJGA 1GT3A 1BJ7A 2A13A 4ZHDA 4Z6JA 3BLGA 3DSZA 3P6DA 1QQSA 2AKQA 4GNWA 3FIQA 1Y55X 1OEJA 1WBIA 4QYNA 1VWGB 5L8IA 3PH6A 3G7XA 4MVLA 3WOVA 5HZ5A 1I04A 3TGCA 1HBQA 4ZHGA 2QMIA 3SLTA 5K06A 1FE3A 1W5RA 4YMYA 1QG5A 5F7GA 3VG3A
chains in the Genus database with same CATH topology
2ACPX 1EIOA 2L68A 2R74A 2JMBA 1YP7A 3U03A 2RQ0A 2IFBA 3WJGA 4ALOA 3OBLA 3KQ0A 5L8OA 1U18A 4I3BA 1A57A 3FEKA 3HWDA 1KQXA 2KD2A 2X45A 1X8NA 4HPDA 1EXSA 4BQUA 1B4MA 5F1EA 4O4OA 2HZRA 4GU8A 2FR3A 5EEDA 2BS5A 3ZW1A 4QZTA 4MVKA 1E06A 2L67A 3UEXA 4HPCA 3BU1A 2AL0X 1KT4A 2WR6A 3RWXA 4OMXA 3WJDA 4AZNA 3BDRA 3EM0A 5HZ8A 1G85A 2WUTA 2X8TA 4QGWA 5EZ2A 3U0DA 4M6SA 4ORXA 1EPAA 1JJXA 3BY0A 3NADA 4HPAA 2ANSA 5HCEC 5BYPA 4OMWA 3EBWA 1GKAA 2G78A 1BRPA 1CBQA 1ZRYA 2WEWA 1D3SA 4ZGFA 3ZW1B 1A18A 1NGLA 1YP6A 2JU3A 3P6FA 4YGGA 1SA8A 2LB6A 1ZNDA 1SMPI 1KT7A 3RSWA 1MDCA 1GT1A 3ZW0B 3ZZVA 4QYPA 1EUOA 1HBPA 1X8UA 1QABE 1X8OA 2GTLO 3HWFA 1X89A 2X8SA 1S44A 4I9SA 4YGHA 1QY2A 4EQAC 5LJCA 1IW2A 2YG2A 5F58A 3V8UA 2RA6A 1T0VA 2LA7A 4MISA 4ORRA 3PPTA 3PP6A 3STMX 4ZHFA 1QWDA 3C78X 3NQ3A 1GKAB 4PSQA 5DPQA 2QM9A 1CBIA 5LJHA 3P6HA 3B2LA 3D4RA 2FTBA 2GJ5A 3P02A 1X71A 3RKGA 1BLRA 2WWPA 1GGLA 3CBCA 1SXWA 3WJEA 1EALA 3SOTA 4ZHHA 5H9AA 2LFOA 2CM9A 3KFFA 2POAA 4NYQA 3JSQA 3P6GA 1FEMA 1E5PA 1L6MA 1E02A 1BSOA 4KIIA 3CBSA 3U9PC 5HAEA 4XMEA 5B27A 1GM6A 2BHVA 1FDQA 1B0OA 4ORYA 4FQBB 3N91A 4D6BA 4AYHA 1SXYA 1D2UA 3F8AA 3KZAA 4K19A 1O8VA 2AT5X 1SY2A 3CMPA 3S5XA 1A2DA 1SY0A 5LKFA 1PMPA 4I95A 5EDBA 2HZQA 1Y9LA 2M4LA 5HTEA 3KFIA 4YH0A 3JS1A 3O2YA 4ZJ0A 3ELZA 4ES7A 2QO4A 5JR8A 1QFTA 1H91A 4O49A 4GK9A 1ICNA 1FELA 1OBQA 2JU7A 3B2JA 3I0AA 4O3ZA 2F73A 4O9SA 2FR2A 1LNMA 4O4UA 4Y0RA 4ZGUA 1BSQA 1JIWI 2LBVA 2E4JA 5EPQA 2FS6A 3STNA 3WJFA 3L4RA 1YWDA 4NYRA 3D95A 5FENA 1ERXA 3NQKA 1LIFA 5C0NA 2NNEA 3AKNA 4ORWA 4LKTA 1I05A 2HLVA 3JQOA 2MWHA 3VG4A 2HYSA 1YUPA 1DFVA 4YGZA 2JN3A 1GX9A 4IB6A 2Q9SA 1GT4A 1MVGA 4RUUA 3ZW2A 4QGVA 1LICA 3HWEA 2CZTA 3WBGA 2W2FA 3OE3A 4YDBA 2GTLM 4YKOA 1ZNEA 5F6BA 3ZWEA 3IFBA 5FQ8E 3BSZE 3FR2A 2YMSA 1DZJA 1S2PA 3BRNA 3EBKA 4U3QA 3RZYA 4CSBA 4GH7A 2HMBA 1LIEA 4I9RA 1OBPA 1I4UA 3FA9A 3P6CA 4FBRA 4YFPA 3APUA 1KXOA 4KC7A 4QGXA 3ELXA 3WJCA 2WSJA 1ERBA 3B2KA 4AZPA 3OJYC 3FW5A 4BVMA 4QQ1A 4U8UO 4INNA 1P6PA 4IAXA 4KH8A 2NNDA 3O19A 3FA6A 4XMDA 2OFRX 2FRSA 4AZOA 4A60A 2ZAIA 1CRBA 1QFVA 3ZW0A 4FGIB 3FR4A 4QAEA 5HCCC 2HNXA 4XMGA 5CYBA 5KIDA 2KTSA 1BEBA 3D96A 5HZ9A 3ZI8A 4Y0PA 2CZUA 2ALLX 1G74A 4O3YA 4DQ3A 1JZUA 1N0SA 4XMFA 4ZH6A 4TKHA 1EI5A 1GX8A 2WEXA 3GE2A 2O62A 1ZNLA 3BX7A 3HTYA 1PBOA 5AJCA 1IIUA 3EMMA 4TQ2A 5BVSA 4JGLA 5HBSA 1KQWA 4NNTA 3QKGA 4ZFXA 5D45A 4ID2A 4I3DA 4TNNA 4AZMA 2MJIA 3PH5A 4LZVA 3FENA 5KICA 2LBAA 3CQNA 1AVGI 1KZXA 4WBKA 4UU2A 4HFOA 3NPOA 4M7MA 1G5WA 3P24A 3FYFA 4CK4A 4NLIA 4QRLA 2OVAA 1T8VA 2XKLA 3NX2A 5FAZA 3WJBA 4ORUA 3FA7A 2MO5A 4Y0QA 5F6ZA 4WFVA 5FQ7E 4O4SA 4AZRA 1YIVA 3UEUA 3S5VA 3TGBA 1KOIA 1KGLA 1HN2A 2R56A 3PECA 3OD9A 4RUNA 5HA1A 1QY1A 2W2AA 1T68X 3MX7A 5IO6A 1O1VA 3UAQA 1X8PA 3C76X 1ALBA 3FMZA 4ML7B 4HPBA 1JYJA 1SY1A 4TJZA 5D8JA 1OEKA 4EXZA 5D4AA 5LJKA 2KTDA 3F9DA 1U0XA 1AELA 1EQDA 3FELA 4PJ2A 3H3IA 1OPBA 3CWKA 4U8UM 3VE2A 1JYDA 4NP1A 2JU8A 2L5PA 3RBYA 1ACDA 4D6AA 4ALBA 3C77X 4CV7A 1LIDA 4ORSA 1E00A 1CJ5A 2L9CA 4LQZA 1R0UA 1X8QA 3B2IA 1YWBA 2G7BA 1BSYA 2Q2PA 3NBXX 1MUPA 4KCAA 3Q6LA 5EDCA 2MM3A 3APXA 4XMCA 1JBHA 4WHIA 1XKIA 4HWMA 1QY0A 2A3FX 2NP1A 5H8TA 4EEJA 1TW4A 3S26A 5IO7A 1NP4A 2A2GA 3KFHA 5KHPA 2KT4B 4TKBA 3DTQA 4N7DA 2Q2MA 5FQ6E 1RLBE 3BS2A 1S7DA 4FBOA 4IB7A 4YDAA 3TF6A 2AT8X 1LIBA 5H9KA 3LV4A 1TOUA 2DM5A 4N7CA 1BM5A 1RBPA 2K62A 4GDZA 4IBAA 1IFCA 1DC9A 2WQ9A 4MVEA 2X46A 4YCHA 3K3LA 4ZH9A 3PEDA 3FLLA 1LKEA 2RN4A 4R0BA 3T1DA 1MX7A 1VPRA 2LKKA 4EFGA 3TZSA 4YFQA 1LF7A 1SY3A 5HWZA 2WQAE 2PY1A 3GAQA 3D97A 1KT3A 4TKJA 3E3CA 3VG6A 3BX8A 3APVA 1OBUA 3FA8A 3VG5A 5HA0A 1ZNGA 4YFRA 2OVEA 1ZNKA 4IABA 5AEOA 1DF3A 2A0AA 3HWGA 4MVIA 1SXUA 1A3YA 4QZUA 5FFHA 2GTLN 3NP1A 4ODDA 1TOWA 4UU3A 1HMSA 5CE4A 1OPAA 1ADLA 2Q39A 1IFBA 4IAWA 5BVTA 2KW1A 5HTDA 4TLJA 3P6EA 1SXXA 2OVDA 1KZWA 1BBPA 2X8FA 3PQUA 1Y9TA 3NR3A 1U17A 3I17A 2OZQA 3CQRA 2NNQA 2OVSA 1BRQA 4O4XA 2RCTA 5H9NA 5L8NA 5IO5A 2AMMX 1EPBA 4L3RA 5AJBA 1ML7A 1EW3A 4I6SA 4GETA 3O22A 2GC9A 4WFUA 4NW4A 4QNIA 3NX1A 2QO6A 3STKA 1PEEA 3MVFA 4Y0SA 3CR6A 4YBUA 5LJGA 4KT5A 4GKCA 1UREA 4L1NA 4LZUA 1OEEA 2BLGA 2P8GA 4IB9A 3ZUIA 1ICMA 5EEEA 3LHNA 1B8EA 3NQ9A 4ZR2A 4ARHA 3HOEA 2QOSC 2JOZA 5D47A 1NP1A 2Q4NA 3VPJE 4GZVA 2BS6A 3WVMA 1CBRA 4ZCBA 5LJDA 2CBRA 1AQBA 4DQ4A 2Z4HA 3KFGA 5BVQA 3VG2A 2Z4IA 4NLJA 2QO5A 3AKMA 5HZQA 3S60A 3WXQA 1ZNHA 4FBVA 1FTPA 3IA8A 4OS0A 3VU1A 4GNYA 1AB0A 1Z24A 2MHDA 4OS8A 4EDEA 5LJBA 1IKEA 1LPJA 4A8ZA 2ACOA 1FENA 5D48A 4NNSA 1UZ2X 2ZAGA 4KC8A 2FS7A 4A1YA 2RCQA 2XSTA 2N93A 1IKJA 3HOLA 4IMOA 2A2UA 3FR5A 1TVQA 4MIRA 4AZQA 1VYFA 4O3WA 1HQPA 1CBSA 2FLJA 2ASNX 3HK1A 4A1HA 4COTA 3VE1A 4YKMA 4U9CA 3BU9A 3MBTA 5DG4A 3FEPA 3SAOA 2CM4A 3PQSA 1DZMA 1I06A 3UEWA 4AW8A 3UEVA 1GT5A 2AT3X 1PM1X 2F09A 2R73A 2W2BA 1GXAA 5AQ6A 1KT5A 1DZKA 1DZPA 1O1UA 1TXLA 4O3XB 3B2HA 2FT9A 3APWA 1LFOA 2G79A 4YCEA 4BOEA 1HMTA 3TGAA 2GTFX 5LJEA 1YWAA 5HCDC 4XMHA 2AH7X 2OFMX 2BT9A 4U8UN 3ZUOA 3ZQ3A 1VYGA 1B56A 2CBSA 3FW4A 5B29A 4ON1A 4GRJA 5LKEA 1DV9A 1JJJA 1BWYA 1YWCA 4OS3A 4IMNA 3EYCA 1MX8A 1EIIA 1G7NA 4YBPA 2EU7X 2AT6X 3VG7A 4IB8A 1JV4A 2JW1A 3F6ZB 2K23A 2FWVA 2AT0X 4LKPA 5H9LA 1KT6A 4GE1A 4I3CA 2RD7C 1HMRA 1XCAA 1GT3A 1BJ7A 2A13A 4ZHDA 3BLGA 3DSZA 3P6DA 1QQSA 2AKQA 4GNWA 3FIQA 4QYNA 1OEJA 4ZHCA 3WOVA 5L8IA 5HZ5A 3PH6A 3G7XA 4MVLA 5HZ6A 1I04A 3TGCA 1HBQA 4ZHGA 2QMIA 5K06A 1FE3A 4YMYA 1QG5A 5F7GA 3VG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ACP X;  1EIO A;  2L68 A;  2R74 A;  1YP7 A;  3U03 A;  2RQ0 A;  2IFB A;  3WJG A;  4ALO A;  5L8O A;  3KQ0 A;  1U18 A;  4I3B A;  1A57 A;  3FEK A;  3HWD A;  1KQX A;  2X45 A;  1X8N A;  4HPD A;  1EXS A;  4BQU A;  1B4M A;  5F1E A;  2HZR A;  2FR3 A;  5EED A;  4QZT A;  4MVK A;  1E06 A;  2L67 A;  3UEX A;  4HPC A;  3BU1 A;  2AL0 X;  1KT4 A;  2WR6 A;  4OMX A;  3WJD A;  4AZN A;  3BDR A;  3EM0 A;  5HZ8 A;  1G85 A;  2WUT A;  4QGW A;  5EZ2 A;  3U0D A;  4M6S A;  4ORX A;  1EPA A;  1JJX A;  3BY0 A;  3NAD A;  4HPA A;  2ANS A;  5HCE C;  4OMW A;  3EBW A;  1GKA A;  2G78 A;  1BRP A;  1CBQ A;  1ZRY A;  2WEW A;  1D3S A;  1A18 A;  1NGL A;  1YP6 A;  2JU3 A;  3P6F A;  4YGG A;  1SA8 A;  2LB6 A;  1ZND A;  1KT7 A;  3RSW A;  1MDC A;  1GT1 A;  4QYP A;  1EUO A;  1HBP A;  1X8U A;  1QAB E;  1X8O A;  3HWF A;  1X89 A;  4I9S A;  1S44 A;  4YGH A;  1QY2 A;  5LJC A;  1IW2 A;  2YG2 A;  5F58 A;  2RA6 A;  1T0V A;  4ORR A;  3PPT A;  3PP6 A;  3STM X;  4ZHF A;  1QWD A;  3C78 X;  3NQ3 A;  1GKA B;  4PSQ A;  5DPQ A;  2QM9 A;  1CBI A;  5LJH A;  3P6H A;  3B2L A;  2FTB A;  2GJ5 A;  1X71 A;  1BLR A;  2WWP A;  1GGL A;  3CBC A;  1SXW A;  3WJE A;  1EAL A;  4ZHH A;  5H9A A;  2LFO A;  2CM9 A;  3KFF A;  2POA A;  4NYQ A;  3JSQ A;  3P6G A;  1FEM A;  1E5P A;  1L6M A;  1E02 A;  1BSO A;  4KII A;  3CBS A;  3U9P C;  5HAE A;  4XME A;  5B27 A;  1GM6 A;  1FDQ A;  1B0O A;  4ORY A;  4D6B A;  4AYH A;  1SXY A;  1D2U A;  3F8A A;  3KZA A;  4K19 A;  1O8V A;  2AT5 X;  1SY2 A;  3CMP A;  1A2D A;  1SY0 A;  5LKF A;  1PMP A;  5EDB A;  2HZQ A;  5HTE A;  3KFI A;  4YH0 A;  3JS1 A;  3O2Y A;  4ZJ0 A;  3ELZ A;  4ES7 A;  2QO4 A;  5JR8 A;  1QFT A;  1H91 A;  1ICN A;  1FEL A;  1OBQ A;  2JU7 A;  3B2J A;  3I0A A;  2F73 A;  4O9S A;  2FR2 A;  1LNM A;  4Y0R A;  4ZGU A;  1BSQ A;  2LBV A;  2E4J A;  5EPQ A;  2FS6 A;  3STN A;  3WJF A;  3L4R A;  1YWD A;  4NYR A;  3D95 A;  5FEN A;  1ERX A;  5C0N A;  1LIF A;  2NNE A;  3AKN A;  4ORW A;  4LKT A;  1I05 A;  2HLV A;  3VG4 A;  2HYS A;  1YUP A;  1DFV A;  4YGZ A;  2JN3 A;  1GX9 A;  4IB6 A;  2Q9S A;  1GT4 A;  1MVG A;  4RUU A;  4QGV A;  1LIC A;  3HWE A;  2CZT A;  3WBG A;  2W2F A;  4YDB A;  4YKO A;  1ZNE A;  5F6B A;  3IFB A;  3BSZ E;  3FR2 A;  3EBK A;  1DZJ A;  1S2P A;  3BRN A;  3RZY A;  4GH7 A;  2HMB A;  1LIE A;  4I9R A;  1OBP A;  1I4U A;  3FA9 A;  3P6C A;  4YFP A;  3APU A;  1KXO A;  4QGX A;  3ELX A;  3WJC A;  2WSJ A;  1ERB A;  3B2K A;  4AZP A;  3OJY C;  3FW5 A;  4BVM A;  1P6P A;  4IAX A;  2NND A;  3O19 A;  3FA6 A;  4XMD A;  2OFR X;  2FRS A;  4AZO A;  4A60 A;  1CRB A;  1QFV A;  3FR4 A;  4QAE A;  5HCC C;  2HNX A;  4XMG A;  5KID A;  1BEB A;  3D96 A;  5HZ9 A;  4Y0P A;  2CZU A;  2ALL X;  1G74 A;  4DQ3 A;  1JZU A;  1N0S A;  4XMF A;  4ZH6 A;  4TKH A;  1GX8 A;  2WEX A;  2O62 A;  1ZNL A;  3BX7 A;  1PBO A;  1IIU A;  3EMM A;  4TQ2 A;  5BVS A;  5HBS A;  1KQW A;  4NNT A;  3QKG A;  4ZFX A;  5D45 A;  4I3D A;  4TNN A;  4AZM A;  2MJI A;  3PH5 A;  4LZV A;  3FEN A;  5KIC A;  2LBA A;  3CQN A;  1AVG I;  1KZX A;  4WBK A;  4UU2 A;  4HFO A;  3NPO A;  4M7M A;  1G5W A;  4CK4 A;  4NLI A;  2OVA A;  1T8V A;  2XKL A;  3NX2 A;  5FAZ A;  3WJB A;  4ORU A;  3FA7 A;  2MO5 A;  4Y0Q A;  5F6Z A;  4WFV A;  4AZR A;  1YIV A;  3UEU A;  3TGB A;  1KOI A;  1KGL A;  1HN2 A;  2R56 A;  3PEC A;  4RUN A;  5HA1 A;  1QY1 A;  2W2A A;  1T68 X;  5IO6 A;  1O1V A;  1X8P A;  3C76 X;  1ALB A;  3FMZ A;  4HPB A;  1JYJ A;  1SY1 A;  4TJZ A;  5D8J A;  1OEK A;  4EXZ A;  5D4A A;  5LJK A;  2KTD A;  3F9D A;  1U0X A;  1AEL A;  1EQD A;  3FEL A;  1OPB A;  3CWK A;  1JYD A;  4NP1 A;  2JU8 A;  2L5P A;  4D6A A;  1ACD A;  4ALB A;  3C77 X;  1LID A;  4ORS A;  1E00 A;  1CJ5 A;  2L9C A;  1R0U A;  1X8Q A;  3B2I A;  1YWB A;  2G7B A;  1BSY A;  2Q2P A;  1MUP A;  3Q6L A;  5EDC A;  2MM3 A;  3APX A;  4XMC A;  1JBH A;  1XKI A;  1QY0 A;  2A3F X;  2NP1 A;  5H8T A;  4EEJ A;  1TW4 A;  3S26 A;  5IO7 A;  1NP4 A;  2A2G A;  3KFH A;  5KHP A;  2KT4 B;  4TKB A;  3DTQ A;  4N7D A;  2Q2M A;  1RLB E;  3BS2 A;  1S7D A;  4IB7 A;  4YDA A;  3TF6 A;  2AT8 X;  1LIB A;  5H9K A;  1TOU A;  2DM5 A;  4N7C A;  1BM5 A;  1RBP A;  2K62 A;  4IBA A;  1IFC A;  1DC9 A;  2WQ9 A;  2X46 A;  4YCH A;  3K3L A;  4ZH9 A;  3PED A;  3FLL A;  1LKE A;  4R0B A;  3T1D A;  1MX7 A;  1VPR A;  2LKK A;  4EFG A;  3TZS A;  4YFQ A;  1LF7 A;  1SY3 A;  5HWZ A;  2WQA E;  2PY1 A;  3GAQ A;  3D97 A;  1KT3 A;  4TKJ A;  3VG6 A;  3BX8 A;  3APV A;  1OBU A;  3FA8 A;  3VG5 A;  5HA0 A;  1ZNG A;  4YFR A;  2OVE A;  1ZNK A;  1DF3 A;  2A0A A;  3HWG A;  4MVI A;  1SXU A;  1A3Y A;  4QZU A;  5FFH A;  4ODD A;  3NP1 A;  1TOW A;  4UU3 A;  1HMS A;  5CE4 A;  1OPA A;  1ADL A;  2Q39 A;  1IFB A;  4IAW A;  5BVT A;  5HTD A;  4TLJ A;  3P6E A;  1SXX A;  2OVD A;  1KZW A;  1BBP A;  3NR3 A;  1U17 A;  3I17 A;  2OZQ A;  3CQR A;  2NNQ A;  1BRQ A;  2RCT A;  5H9N A;  5L8N A;  5IO5 A;  2AMM X;  1EPB A;  1ML7 A;  1EW3 A;  4GET A;  3O22 A;  2GC9 A;  4WFU A;  3NX1 A;  2QO6 A;  3STK A;  1PEE A;  3MVF A;  4Y0S A;  3CR6 A;  4YBU A;  5LJG A;  4GKC A;  1URE A;  4LZU A;  1OEE A;  2BLG A;  2P8G A;  4IB9 A;  3ZUI A;  1ICM A;  5EEE A;  4ZR2 A;  1B8E A;  3NQ9 A;  4ARH A;  2QOS C;  2JOZ A;  5D47 A;  1NP1 A;  2Q4N A;  3WVM A;  1CBR A;  4ZCB A;  5LJD A;  2CBR A;  1AQB A;  4DQ4 A;  3KFG A;  5BVQ A;  3VG2 A;  4NLJ A;  2QO5 A;  3AKM A;  5HZQ A;  3WXQ A;  1ZNH A;  1FTP A;  3IA8 A;  4OS0 A;  4GNY A;  1AB0 A;  1Z24 A;  4OS8 A;  4EDE A;  5LJB A;  1IKE A;  1LPJ A;  4A8Z A;  2ACO A;  1FEN A;  5D48 A;  4NNS A;  1UZ2 X;  2FS7 A;  4A1Y A;  2RCQ A;  2XST A;  2N93 A;  1IKJ A;  4IMO A;  2A2U A;  3FR5 A;  1TVQ A;  4AZQ A;  1VYF A;  1HQP A;  1CBS A;  2FLJ A;  2ASN X;  3HK1 A;  4A1H A;  4YKM A;  3BU9 A;  3MBT A;  5DG4 A;  3FEP A;  3SAO A;  2CM4 A;  1DZM A;  1I06 A;  3UEW A;  4AW8 A;  3UEV A;  1GT5 A;  2AT3 X;  1PM1 X;  2R73 A;  2W2B A;  1GXA A;  5AQ6 A;  1KT5 A;  1DZK A;  1DZP A;  1O1U A;  1TXL A;  3B2H A;  2FT9 A;  3APW A;  1LFO A;  2G79 A;  4YCE A;  4BOE A;  1HMT A;  3TGA A;  2GTF X;  5LJE A;  1YWA A;  5HCD C;  4XMH A;  2AH7 X;  2OFM X;  3ZUO A;  3ZQ3 A;  1VYG A;  1B56 A;  2CBS A;  3FW4 A;  5B29 A;  4GRJ A;  5LKE A;  1DV9 A;  1JJJ A;  1BWY A;  1YWC A;  4OS3 A;  4IMN A;  3EYC A;  1MX8 A;  1EII A;  1G7N A;  4YBP A;  2EU7 X;  2AT6 X;  3VG7 A;  4IB8 A;  1JV4 A;  2K23 A;  2FWV A;  2AT0 X;  4LKP A;  5H9L A;  1KT6 A;  4GE1 A;  4I3C A;  2RD7 C;  1HMR A;  1XCA A;  1GT3 A;  1BJ7 A;  2A13 A;  4ZHD A;  3BLG A;  3DSZ A;  3P6D A;  1QQS A;  2AKQ A;  4GNW A;  3FIQ A;  4QYN A;  1OEJ A;  4ZHC A;  5HZ6 A;  5L8I A;  5HZ5 A;  3PH6 A;  3G7X A;  4MVL A;  1I04 A;  3TGC A;  1HBQ A;  4ZHG A;  5K06 A;  1FE3 A;  4YMY A;  1QG5 A;  5F7G A;  3VG3 A; 
#chains in the Genus database with same CATH topology
 2ACP X;  1EIO A;  4CDC A;  2L68 A;  2R74 A;  2JMB A;  1YP7 A;  3U03 A;  2RQ0 A;  2OL6 O;  2IFB A;  3WJG A;  1I78 A;  4ALO A;  5CHK A;  3OBL A;  3KQ0 A;  5L8O A;  1SWR A;  3MG5 A;  1U18 A;  1N9M A;  4I3B A;  3FEK A;  3HWD A;  1A57 A;  1KQX A;  2KD2 A;  2X45 A;  1X8N A;  4HPD A;  1EXS A;  1STR B;  4BQU A;  4Z2V A;  1B4M A;  5F1E A;  4O4O A;  2VFC A;  2HZR A;  2A8G A;  4GU8 A;  2FR3 A;  5EED A;  2BS5 A;  2RTF B;  2RTP B;  4QZT A;  3ZW1 A;  1KL5 A;  1LUQ A;  4BGF A;  2RTJ A;  1E06 A;  2L67 A;  3Q34 A;  4MVK A;  2I5V O;  1VWD B;  4HPC A;  3MM0 A;  3BU1 A;  2AL0 X;  1KT4 A;  2WR6 A;  3RWX A;  2JGS A;  4OMX A;  3WJD A;  4AZN A;  1LDO A;  3BDR A;  2RTO B;  3EM0 A;  5HZ8 A;  1G85 A;  2G8C O;  2WUT A;  3RDM A;  5B5G A;  1VWC B;  2X8T A;  4QGW A;  5EZ2 A;  4Z2P A;  3EC5 A;  3U0D A;  4M6S A;  4ORX A;  2IZL B;  1EPA A;  1JJX A;  3BY0 A;  3NAD A;  4HPA A;  2ANS A;  5HCE C;  5BYP A;  4OMW A;  3EBW A;  1SLF B;  1GKA A;  1BM5 A;  2G78 A;  1BRP A;  2OYB O;  4YVB A;  1CBQ A;  1ZRY A;  2WEW A;  1LCZ A;  1D3S A;  4ZGF A;  3ZW1 B;  1A18 A;  1NGL A;  1YP6 A;  2JU3 A;  3P6F A;  4YGG A;  3T2X A;  1SA8 A;  1MM9 A;  2LB6 A;  1ZND A;  1SMP I;  1KT7 A;  3T6F A;  3RSW A;  1MDC A;  1GT1 A;  2Y3F A;  4K19 A;  2RTA A;  3ZW0 B;  3ZZV A;  4QYP A;  1EUO A;  1HBP A;  1X8U A;  1SRE A;  3UEX A;  1QAB E;  1X8O A;  2GTL O;  3HWF A;  1X89 A;  2X8S A;  1S44 A;  2IZE B;  3CKG A;  4I9S A;  2HKD A;  4YGH A;  1QY2 A;  4EQA C;  5LJC A;  1IW2 A;  2YG2 A;  5F58 A;  3V8U A;  2RA6 A;  1T0V A;  2LA7 A;  4MIS A;  1JJU A;  4ORR A;  1VYO A;  3PPT A;  3PP6 A;  3STM X;  4ZHF A;  2Y3E A;  1QWD A;  3C78 X;  3NQ3 A;  1GKA B;  4PSQ A;  5DPQ A;  4CPF A;  4GDA A;  2QM9 A;  1CBI A;  5LJH A;  3P6H A;  3B2L A;  3D4R A;  2FTB A;  2GJ5 A;  3P02 A;  1X71 A;  3RKG A;  2IZG B;  1BLR A;  2IZF B;  2WWP A;  1GGL A;  3CBC A;  1SXW A;  4I60 A;  3WJE A;  3SOT A;  4ZHH A;  1EAL A;  2RTG B;  5H9A A;  2RTN B;  2LFO A;  2CM9 A;  4C5P A;  3KFF A;  2POA A;  1RSU B;  4NYQ A;  1OSP O;  2IZK A;  3JSQ A;  1SWK A;  3WYP A;  3P6G A;  1FEM A;  3SZH A;  1E5P A;  1L6M A;  1E02 A;  1BSO A;  3EW1 A;  3CBS A;  4KII A;  3U9P C;  5HAE A;  1SRI A;  4XME A;  5B27 A;  1GM6 A;  2BHV A;  1FDQ A;  1SWC A;  4DCB A;  1B0O A;  4ORY A;  2RTK A;  4FQB B;  3N91 A;  4D6B A;  4AYH A;  1SXY A;  1D2U A;  1PTS A;  2RTB B;  3F8A A;  1O8V A;  2AT5 X;  1SY2 A;  3CMP A;  1LCW A;  3KZA A;  3S5X A;  1A2D A;  1SY0 A;  2X4M A;  5LKF A;  1PMP A;  4I95 A;  5EDB A;  4DNE A;  2HZQ A;  1Y9L A;  2M4L A;  5HTE A;  3KFI A;  4GJS A;  4YH0 A;  3JS1 A;  1SWB A;  3O2Y A;  1RAV A;  3T6L A;  4ZJ0 A;  3ELZ A;  4ES7 A;  2QO4 A;  5JR8 A;  1QFT A;  1H91 A;  5IO7 A;  5IRW A;  4NV7 A;  3QQ2 A;  4O49 A;  3SZI A;  4GK9 A;  1ICN A;  1FEL A;  4BBO A;  1OBQ A;  2JU7 A;  3B2J A;  3I0A A;  3WZN A;  5K67 A;  4O3Z A;  2F73 A;  4O9S A;  2FR2 A;  1VWM B;  1LNM A;  4O4U A;  1VWO B;  4Y0R A;  4CPH B;  1BSQ A;  1JIW I;  1KL3 A;  2LBV A;  2E4J A;  4BX7 B;  1LCV A;  5EPQ A;  4ZGU A;  2FS6 A;  3STN A;  3WJF A;  3L4R A;  1YWD A;  4NYR A;  3D95 A;  5FEN A;  1ERX A;  3NQK A;  1LIF A;  5C0N A;  2AF5 A;  2NNE A;  3AKN A;  4ORW A;  4LKT A;  1I05 A;  2HLV A;  2A5B A;  3JQO A;  2MWH A;  2I5Z O;  1K24 A;  3VG4 A;  2HYS A;  2IZD B;  1VWI B;  1FJ1 E;  1YUP A;  1DFV A;  3FDC A;  2OL7 A;  4YGZ A;  2JN3 A;  3RDO A;  1GX9 A;  4IB6 A;  2Q9S A;  1GT4 A;  1MVG A;  4RUU A;  3ZW2 A;  4QGV A;  1LIC A;  3HWE A;  1SWT A;  2CZT A;  3WBG A;  2W2F A;  3OE3 A;  1AVD A;  4YDB A;  2GTL M;  4YKO A;  1ZNE A;  5L3Y A;  5F6B A;  3ZWE A;  3IFB A;  2OY1 O;  5FQ8 E;  1KFF A;  3BSZ E;  2YMS A;  1DZJ A;  1S2P A;  3BRN A;  3EBK A;  1GX3 A;  3FR2 A;  4U3Q A;  3RZY A;  4Y5D A;  4CSB A;  3D9W A;  3WYQ A;  4GH7 A;  3SLJ A;  2HMB A;  5B3M O;  1LIE A;  2DJF A;  4I9R A;  3RDQ A;  3X00 A;  1OBP A;  1I4U A;  2IZH B;  3FA9 A;  3P6C A;  5F2B A;  4YFP A;  1W6F A;  4FBR A;  3APU A;  1KXO A;  1VWE B;  4KC7 A;  4QGX A;  3ELX A;  3WJC A;  2WSJ A;  1ERB A;  3B2K A;  2QCB A;  4AZP A;  3OJY C;  1N7Y A;  3FW5 A;  4BVM A;  4Z2O A;  4JNJ A;  4QQ1 A;  4U8U O;  1NQM A;  4INN A;  1P6P A;  4IAX A;  2BSZ A;  1SRF A;  2NND A;  3O19 A;  1SLD B;  3FA6 A;  4KH8 A;  4XMD A;  4CDD A;  2OFR X;  2FRS A;  3WZP A;  4AZO A;  4A60 A;  2ZAI A;  1CRB A;  3VHI A;  1QFV A;  1Y53 X;  3ZW0 A;  4FGI B;  3FR4 A;  1JQP A;  4QAE A;  5HCC C;  2HNX A;  4XMG A;  5CYB A;  3VGW A;  2KTS A;  1BEB A;  3D96 A;  5KID A;  3VHH A;  5HZ9 A;  1SWA A;  5JD2 A;  2FHN X;  2GH7 A;  3ZI8 A;  4Y0P A;  2RTC B;  2CZU A;  1PBY A;  1G74 A;  1VWR B;  2ALL X;  4O3Y A;  1N0S A;  4XMF A;  4ZH6 A;  4DQ3 A;  4TKH A;  1EI5 A;  1GX8 A;  2WEX A;  3GE2 A;  4BCS A;  2O62 A;  1ZNL A;  1NBX A;  3BX7 A;  4U46 A;  1VWN B;  1N4J A;  3HTY A;  1PBO A;  5AJC A;  1IIU A;  3EMM A;  4TQ2 A;  5BVS A;  1Y0G A;  4JGL A;  5HBS A;  1KQW A;  4NNT A;  3QKG A;  4GGZ A;  4ZFX A;  5D45 A;  4ID2 A;  3WZQ A;  4I3D A;  4TNN A;  4AZM A;  2MJI A;  3PH5 A;  4GUZ A;  4LZV A;  3FEN A;  5KIC A;  2LBA A;  3CQN A;  2OL8 O;  1AVG I;  1SWS A;  1JMZ A;  1KZX A;  4WBK A;  1SWL A;  2FKJ A;  4UU2 A;  1VWK B;  3PK2 A;  1SWO A;  3NPO A;  4HFO A;  4M7M A;  3P24 A;  3RDX A;  3FYF A;  1G5W A;  4CK4 A;  1E2T A;  4Y59 A;  4NLI A;  4QRL A;  2Y32 A;  2OVA A;  1RXH A;  1T8V A;  2XKL A;  3NX2 A;  5FAZ A;  3WJB A;  4ORU A;  1WUB A;  3FA7 A;  2MO5 A;  4Y0Q A;  1UYN X;  4WFV A;  5F6Z A;  5FQ7 E;  4O4S A;  2PI3 O;  4AZR A;  1DF8 A;  1YIV A;  1VWA B;  3S5V A;  1SRJ A;  3UEU A;  3TGB A;  1KOI A;  1KGL A;  1HN2 A;  2R56 A;  3PEC A;  3OD9 A;  4RUN A;  5HA1 A;  1QY1 A;  2W2A A;  1T68 X;  3MX7 A;  5IO6 A;  4CDF A;  1O1V A;  3UAQ A;  1X8P A;  3C76 X;  2IZA A;  2OFA A;  4CPH A;  1ALB A;  4BX7 A;  3FMZ A;  4ML7 B;  4HPB A;  3RY2 A;  2X34 A;  1JYJ A;  4BX5 A;  1SY1 A;  2UZ2 A;  2VFB A;  4TJZ A;  5D8J A;  1OEK A;  2C4I A;  4EXZ A;  5D4A A;  2OF9 A;  5LJK A;  2KTD A;  3RY1 A;  3F9D A;  1U0X A;  1AEL A;  1EQD A;  3FEL A;  4PJ2 A;  3H3I A;  1OPB A;  3CWK A;  4U8U M;  3VE2 A;  1JYD A;  4NP1 A;  1VWF B;  2JU8 A;  2L5P A;  3RBY A;  1ACD A;  2X56 A;  4ALB A;  3C77 X;  4D6A A;  1LID A;  4ORS A;  1E00 A;  2IZB A;  4CV7 A;  1AVE A;  1CJ5 A;  2L9C A;  4LQZ A;  1R0U A;  2CAM A;  1X8Q A;  3FID A;  1VWQ B;  3RE6 A;  3B2I A;  1YWB A;  2G7B A;  1BSY A;  2Q2P A;  3NBX X;  1MUP A;  1N9Y A;  4KCA A;  3Q6L A;  5EDC A;  2MM3 A;  1RXJ A;  4BX5 B;  5B11 O;  3APX A;  3KVN A;  2C1Q A;  4XMC A;  1JBH A;  4WHI A;  1XKI A;  4HWM A;  1QY0 A;  2A3F X;  2NP1 A;  5H8T A;  4IRW A;  1TW4 A;  1LDQ A;  3S26 A;  1NP4 A;  2A2G A;  3KFH A;  5KHP A;  2KT4 B;  1SLE B;  4TKB A;  3DTQ A;  4N7D A;  2Q2M A;  5FQ6 E;  1RLB E;  3BS2 A;  1S7D A;  2IZI A;  4FBO A;  4IB7 A;  4YDA A;  3TF6 A;  2AVI A;  2AT8 X;  4OEM A;  1LIB A;  5H9K A;  3LV4 A;  1TOU A;  2DM5 A;  4N7C A;  5IRA A;  1RBP A;  2K62 A;  4GDZ A;  4IBA A;  1IFC A;  1DC9 A;  2WQ9 A;  4MVE A;  4JO6 A;  2X55 A;  2X46 A;  4YCH A;  3K3L A;  4ZH9 A;  2UYW A;  2C1S A;  3PED A;  4GGR A;  2RTE B;  3FLL A;  1LKE A;  2RN4 A;  1N43 A;  1I9H A;  4ZHC A;  1IJ8 A;  4R0B A;  3T1D A;  1MX7 A;  1VPR A;  2F01 A;  2LKK A;  4EFG A;  3TZS A;  4YFQ A;  1LF7 A;  1SY3 A;  4CPI A;  2WQA E;  1VWP B;  5HWZ A;  2PY1 A;  3GAQ A;  3D97 A;  1KT3 A;  4TKJ A;  3E3C A;  3VG6 A;  3BX8 A;  3APV A;  1OBU A;  3FA8 A;  2IZJ A;  5HA0 A;  1ZNG A;  2OY5 O;  2OVE A;  1ZNK A;  4IAB A;  3VG5 A;  4YFR A;  5AEO A;  2A0A A;  3HWG A;  4OKA A;  1DF3 A;  2G5L A;  4OEL A;  4MVI A;  1SXU A;  1A3Y A;  1VWJ B;  4QZU A;  5FFH A;  2GTL N;  3NP1 A;  4ODD A;  1TOW A;  5CSE A;  4UU3 A;  1HMS A;  5CE4 A;  1OPA A;  1ADL A;  2Q39 A;  4GGT A;  1JMX A;  1IFB A;  4IAW A;  2KW1 A;  5BVT A;  3HPE A;  4TLJ A;  3P6E A;  5HTD A;  3EW2 A;  1SXX A;  2OVD A;  1HY2 A;  1KZW A;  1BBP A;  3CKF A;  1STS B;  2X8F A;  5HZ6 A;  1SWN A;  3PQU A;  1Y9T A;  3NR3 A;  2X32 A;  1U17 A;  2FGS A;  2OZQ A;  3I17 A;  3CQR A;  2NNQ A;  2OVS A;  1BRQ A;  1HQQ A;  4O4X A;  2RCT A;  5H9N A;  5L8N A;  5IO5 A;  2AMM X;  1EPB A;  1MOY A;  4L3R A;  5AJB A;  1ML7 A;  1EW3 A;  4I6S A;  4GET A;  3O22 A;  2GC9 A;  1NDJ A;  4NW4 A;  2OFB A;  4WFU A;  4QNI A;  3NX1 A;  2RTD B;  2QO6 A;  3RDS A;  3STK A;  1W4T A;  1PEE A;  3MVF A;  1VWH B;  1K3B A;  3CR6 A;  4Y0S A;  4YBU A;  5LJG A;  4KT5 A;  4GKC A;  1URE A;  4L1N A;  4LZU A;  2ZSC A;  1VWB B;  1OEE A;  2BLG A;  2P8G A;  4IB9 A;  4EKV A;  2RTM A;  3ZUI A;  1ICM A;  5EEE A;  3LHN A;  1B8E A;  1SWD A;  3NQ9 A;  4ZR2 A;  4EEJ A;  4ARH A;  2VDF A;  3HOE A;  2FKG A;  4JHQ A;  4BX6 A;  1JZU A;  2QOS C;  2JOZ A;  5D47 A;  1NP1 A;  2BC3 A;  2RTQ B;  2Q4N A;  3VPJ E;  4CDE A;  1SLG B;  1LEL A;  4GZV A;  2BS6 A;  1SWF A;  1RST B;  5B10 O;  3WVM A;  1CBR A;  4ZCB A;  5LJD A;  2CBR A;  1AQB A;  4DQ4 A;  2OY8 A;  2Z4H A;  3KFG A;  1SRG A;  5BVQ A;  3VG2 A;  3VHM A;  2Z4I A;  1VWL B;  2QO5 A;  3AUM O;  3AKM A;  4NLJ A;  5HZQ A;  3S60 A;  1NC9 A;  3WXQ A;  4BJ8 A;  1ZNH A;  4FBV A;  1FTP A;  3IA8 A;  4OS0 A;  1SWH A;  4GNY A;  1AB0 A;  1Z24 A;  2MHD A;  4OS8 A;  3VU1 A;  4EDE A;  5LJB A;  2RTH B;  1IKE A;  1LPJ A;  1SWE A;  2ACO A;  4A8Z A;  1KL4 A;  2WPU A;  1FEN A;  2FHL A;  5D48 A;  4NNS A;  1UZ2 X;  2ZAG A;  4GD9 A;  5B2A O;  4KC8 A;  4BX6 B;  2FS7 A;  4A1Y A;  2RCQ A;  2XST A;  2N93 A;  1IKJ A;  1UYO X;  3HOL A;  5B5F A;  4IMO A;  1HXZ A;  2A2U A;  3FR5 A;  1TVQ A;  4MIR A;  4AZQ A;  1VYF A;  4O3W A;  1HQP A;  1CBS A;  2FLJ A;  2ASN X;  3HK1 A;  4MEE A;  3RE5 A;  3RDU A;  4A1H A;  3VE1 A;  4COT A;  4YKM A;  4U9C A;  4B55 A;  3BU9 A;  2QOM A;  3MBT A;  4GJV A;  5DG4 A;  1SWU A;  3FEP A;  3SAO A;  2CM4 A;  2RTL A;  3PQS A;  1DZM A;  1I06 A;  3UEW A;  1MEP A;  2IZC B;  2OF8 A;  4AW8 A;  3UEV A;  1GT5 A;  2AT3 X;  1PM1 X;  2F09 A;  1STP A;  2R73 A;  2W2B A;  1GXA A;  5AQ6 A;  1KT5 A;  1DZK A;  1DZP A;  5IRU A;  1O1U A;  1TXL A;  4O3X B;  3B2H A;  2FT9 A;  3APW A;  1LFO A;  2G79 A;  1Y52 X;  1HXL A;  1NQN A;  1SWG A;  4YCE A;  4BOE A;  4CPE A;  1HMT A;  3TGA A;  2GTF X;  5IXG A;  5LJE A;  1YWA A;  2RTI B;  4Z28 A;  4XMH A;  2AH7 X;  5HCD C;  3SLO A;  1SRH A;  2OFM X;  2BT9 A;  4U8U N;  2OY7 A;  1RXK A;  3ZQ3 A;  1VYG A;  1SWP A;  1B56 A;  3WZO A;  2CBS A;  3FW4 A;  3ZUO A;  5B29 A;  4Z27 A;  4ON1 A;  1SWQ A;  4GRJ A;  5LKE A;  1DV9 A;  1JJJ A;  2RTR B;  1BWY A;  4NV8 A;  1SWJ A;  1YWC A;  2MF6 A;  3T2W A;  5K68 A;  4OS3 A;  2A5C A;  4IMN A;  3EYC A;  3LTW A;  1MX8 A;  1EII A;  1G7N A;  4YBP A;  2EU7 X;  2AT6 X;  3VG7 A;  3AEH A;  1JV4 A;  2JW1 A;  4IB8 A;  1MK5 A;  3F6Z B;  2K23 A;  2FWV A;  2AT0 X;  3PDF A;  4LKP A;  5H9L A;  1KT6 A;  3SZJ A;  4GE1 A;  4I3C A;  2RD7 C;  1HMR A;  1XCA A;  2DJG A;  1GT3 A;  1BJ7 A;  2A13 A;  4ZHD A;  4Z6J A;  3BLG A;  3DSZ A;  3P6D A;  1QQS A;  2AKQ A;  4GNW A;  3FIQ A;  1Y55 X;  1OEJ A;  1WBI A;  4QYN A;  1VWG B;  5L8I A;  3PH6 A;  3G7X A;  4MVL A;  3WOV A;  5HZ5 A;  1I04 A;  3TGC A;  1HBQ A;  4ZHG A;  2QMI A;  3SLT A;  5K06 A;  1FE3 A;  1W5R A;  4YMY A;  1QG5 A;  5F7G A;  3VG3 A; 
#chains in the Genus database with same CATH homology
 2ACP X;  1EIO A;  2L68 A;  2R74 A;  2JMB A;  1YP7 A;  3U03 A;  2RQ0 A;  2IFB A;  3WJG A;  4ALO A;  3OBL A;  3KQ0 A;  5L8O A;  1U18 A;  4I3B A;  1A57 A;  3FEK A;  3HWD A;  1KQX A;  2KD2 A;  2X45 A;  1X8N A;  4HPD A;  1EXS A;  4BQU A;  1B4M A;  5F1E A;  4O4O A;  2HZR A;  4GU8 A;  2FR3 A;  5EED A;  2BS5 A;  3ZW1 A;  4QZT A;  4MVK A;  1E06 A;  2L67 A;  3UEX A;  4HPC A;  3BU1 A;  2AL0 X;  1KT4 A;  2WR6 A;  3RWX A;  4OMX A;  3WJD A;  4AZN A;  3BDR A;  3EM0 A;  5HZ8 A;  1G85 A;  2WUT A;  2X8T A;  4QGW A;  5EZ2 A;  3U0D A;  4M6S A;  4ORX A;  1EPA A;  1JJX A;  3BY0 A;  3NAD A;  4HPA A;  2ANS A;  5HCE C;  5BYP A;  4OMW A;  3EBW A;  1GKA A;  2G78 A;  1BRP A;  1CBQ A;  1ZRY A;  2WEW A;  1D3S A;  4ZGF A;  3ZW1 B;  1A18 A;  1NGL A;  1YP6 A;  2JU3 A;  3P6F A;  4YGG A;  1SA8 A;  2LB6 A;  1ZND A;  1SMP I;  1KT7 A;  3RSW A;  1MDC A;  1GT1 A;  3ZW0 B;  3ZZV A;  4QYP A;  1EUO A;  1HBP A;  1X8U A;  1QAB E;  1X8O A;  2GTL O;  3HWF A;  1X89 A;  2X8S A;  1S44 A;  4I9S A;  4YGH A;  1QY2 A;  4EQA C;  5LJC A;  1IW2 A;  2YG2 A;  5F58 A;  3V8U A;  2RA6 A;  1T0V A;  2LA7 A;  4MIS A;  4ORR A;  3PPT A;  3PP6 A;  3STM X;  4ZHF A;  1QWD A;  3C78 X;  3NQ3 A;  1GKA B;  4PSQ A;  5DPQ A;  2QM9 A;  1CBI A;  5LJH A;  3P6H A;  3B2L A;  3D4R A;  2FTB A;  2GJ5 A;  3P02 A;  1X71 A;  3RKG A;  1BLR A;  2WWP A;  1GGL A;  3CBC A;  1SXW A;  3WJE A;  1EAL A;  3SOT A;  4ZHH A;  5H9A A;  2LFO A;  2CM9 A;  3KFF A;  2POA A;  4NYQ A;  3JSQ A;  3P6G A;  1FEM A;  1E5P A;  1L6M A;  1E02 A;  1BSO A;  4KII A;  3CBS A;  3U9P C;  5HAE A;  4XME A;  5B27 A;  1GM6 A;  2BHV A;  1FDQ A;  1B0O A;  4ORY A;  4FQB B;  3N91 A;  4D6B A;  4AYH A;  1SXY A;  1D2U A;  3F8A A;  3KZA A;  4K19 A;  1O8V A;  2AT5 X;  1SY2 A;  3CMP A;  3S5X A;  1A2D A;  1SY0 A;  5LKF A;  1PMP A;  4I95 A;  5EDB A;  2HZQ A;  1Y9L A;  2M4L A;  5HTE A;  3KFI A;  4YH0 A;  3JS1 A;  3O2Y A;  4ZJ0 A;  3ELZ A;  4ES7 A;  2QO4 A;  5JR8 A;  1QFT A;  1H91 A;  4O49 A;  4GK9 A;  1ICN A;  1FEL A;  1OBQ A;  2JU7 A;  3B2J A;  3I0A A;  4O3Z A;  2F73 A;  4O9S A;  2FR2 A;  1LNM A;  4O4U A;  4Y0R A;  4ZGU A;  1BSQ A;  1JIW I;  2LBV A;  2E4J A;  5EPQ A;  2FS6 A;  3STN A;  3WJF A;  3L4R A;  1YWD A;  4NYR A;  3D95 A;  5FEN A;  1ERX A;  3NQK A;  1LIF A;  5C0N A;  2NNE A;  3AKN A;  4ORW A;  4LKT A;  1I05 A;  2HLV A;  3JQO A;  2MWH A;  3VG4 A;  2HYS A;  1YUP A;  1DFV A;  4YGZ A;  2JN3 A;  1GX9 A;  4IB6 A;  2Q9S A;  1GT4 A;  1MVG A;  4RUU A;  3ZW2 A;  4QGV A;  1LIC A;  3HWE A;  2CZT A;  3WBG A;  2W2F A;  3OE3 A;  4YDB A;  2GTL M;  4YKO A;  1ZNE A;  5F6B A;  3ZWE A;  3IFB A;  5FQ8 E;  3BSZ E;  3FR2 A;  2YMS A;  1DZJ A;  1S2P A;  3BRN A;  3EBK A;  4U3Q A;  3RZY A;  4CSB A;  4GH7 A;  2HMB A;  1LIE A;  4I9R A;  1OBP A;  1I4U A;  3FA9 A;  3P6C A;  4FBR A;  4YFP A;  3APU A;  1KXO A;  4KC7 A;  4QGX A;  3ELX A;  3WJC A;  2WSJ A;  1ERB A;  3B2K A;  4AZP A;  3OJY C;  3FW5 A;  4BVM A;  4QQ1 A;  4U8U O;  4INN A;  1P6P A;  4IAX A;  4KH8 A;  2NND A;  3O19 A;  3FA6 A;  4XMD A;  2OFR X;  2FRS A;  4AZO A;  4A60 A;  2ZAI A;  1CRB A;  1QFV A;  3ZW0 A;  4FGI B;  3FR4 A;  4QAE A;  5HCC C;  2HNX A;  4XMG A;  5CYB A;  5KID A;  2KTS A;  1BEB A;  3D96 A;  5HZ9 A;  3ZI8 A;  4Y0P A;  2CZU A;  2ALL X;  1G74 A;  4O3Y A;  4DQ3 A;  1JZU A;  1N0S A;  4XMF A;  4ZH6 A;  4TKH A;  1EI5 A;  1GX8 A;  2WEX A;  3GE2 A;  2O62 A;  1ZNL A;  3BX7 A;  3HTY A;  1PBO A;  5AJC A;  1IIU A;  3EMM A;  4TQ2 A;  5BVS A;  4JGL A;  5HBS A;  1KQW A;  4NNT A;  3QKG A;  4ZFX A;  5D45 A;  4ID2 A;  4I3D A;  4TNN A;  4AZM A;  2MJI A;  3PH5 A;  4LZV A;  3FEN A;  5KIC A;  2LBA A;  3CQN A;  1AVG I;  1KZX A;  4WBK A;  4UU2 A;  4HFO A;  3NPO A;  4M7M A;  1G5W A;  3P24 A;  3FYF A;  4CK4 A;  4NLI A;  4QRL A;  2OVA A;  1T8V A;  2XKL A;  3NX2 A;  5FAZ A;  3WJB A;  4ORU A;  3FA7 A;  2MO5 A;  4Y0Q A;  5F6Z A;  4WFV A;  5FQ7 E;  4O4S A;  4AZR A;  1YIV A;  3UEU A;  3S5V A;  3TGB A;  1KOI A;  1KGL A;  1HN2 A;  2R56 A;  3PEC A;  3OD9 A;  4RUN A;  5HA1 A;  1QY1 A;  2W2A A;  1T68 X;  3MX7 A;  5IO6 A;  1O1V A;  3UAQ A;  1X8P A;  3C76 X;  1ALB A;  3FMZ A;  4ML7 B;  4HPB A;  1JYJ A;  1SY1 A;  4TJZ A;  5D8J A;  1OEK A;  4EXZ A;  5D4A A;  5LJK A;  2KTD A;  3F9D A;  1U0X A;  1AEL A;  1EQD A;  3FEL A;  4PJ2 A;  3H3I A;  1OPB A;  3CWK A;  4U8U M;  3VE2 A;  1JYD A;  4NP1 A;  2JU8 A;  2L5P A;  3RBY A;  1ACD A;  4D6A A;  4ALB A;  3C77 X;  4CV7 A;  1LID A;  4ORS A;  1E00 A;  1CJ5 A;  2L9C A;  4LQZ A;  1R0U A;  1X8Q A;  3B2I A;  1YWB A;  2G7B A;  1BSY A;  2Q2P A;  3NBX X;  1MUP A;  4KCA A;  3Q6L A;  5EDC A;  2MM3 A;  3APX A;  4XMC A;  1JBH A;  4WHI A;  1XKI A;  4HWM A;  1QY0 A;  2A3F X;  2NP1 A;  5H8T A;  4EEJ A;  1TW4 A;  3S26 A;  5IO7 A;  1NP4 A;  2A2G A;  3KFH A;  5KHP A;  2KT4 B;  4TKB A;  3DTQ A;  4N7D A;  2Q2M A;  5FQ6 E;  1RLB E;  3BS2 A;  1S7D A;  4FBO A;  4IB7 A;  4YDA A;  3TF6 A;  2AT8 X;  1LIB A;  5H9K A;  3LV4 A;  1TOU A;  2DM5 A;  4N7C A;  1BM5 A;  1RBP A;  2K62 A;  4GDZ A;  4IBA A;  1IFC A;  1DC9 A;  2WQ9 A;  4MVE A;  2X46 A;  4YCH A;  3K3L A;  4ZH9 A;  3PED A;  3FLL A;  1LKE A;  2RN4 A;  4R0B A;  3T1D A;  1MX7 A;  1VPR A;  2LKK A;  4EFG A;  3TZS A;  4YFQ A;  1LF7 A;  1SY3 A;  5HWZ A;  2WQA E;  2PY1 A;  3GAQ A;  3D97 A;  1KT3 A;  4TKJ A;  3E3C A;  3VG6 A;  3BX8 A;  3APV A;  1OBU A;  3FA8 A;  3VG5 A;  5HA0 A;  1ZNG A;  4YFR A;  2OVE A;  1ZNK A;  4IAB A;  5AEO A;  1DF3 A;  2A0A A;  3HWG A;  4MVI A;  1SXU A;  1A3Y A;  4QZU A;  5FFH A;  2GTL N;  3NP1 A;  4ODD A;  1TOW A;  4UU3 A;  1HMS A;  5CE4 A;  1OPA A;  1ADL A;  2Q39 A;  1IFB A;  4IAW A;  5BVT A;  2KW1 A;  5HTD A;  4TLJ A;  3P6E A;  1SXX A;  2OVD A;  1KZW A;  1BBP A;  2X8F A;  3PQU A;  1Y9T A;  3NR3 A;  1U17 A;  3I17 A;  2OZQ A;  3CQR A;  2NNQ A;  2OVS A;  1BRQ A;  4O4X A;  2RCT A;  5H9N A;  5L8N A;  5IO5 A;  2AMM X;  1EPB A;  4L3R A;  5AJB A;  1ML7 A;  1EW3 A;  4I6S A;  4GET A;  3O22 A;  2GC9 A;  4WFU A;  4NW4 A;  4QNI A;  3NX1 A;  2QO6 A;  3STK A;  1PEE A;  3MVF A;  4Y0S A;  3CR6 A;  4YBU A;  5LJG A;  4KT5 A;  4GKC A;  1URE A;  4L1N A;  4LZU A;  1OEE A;  2BLG A;  2P8G A;  4IB9 A;  3ZUI A;  1ICM A;  5EEE A;  3LHN A;  1B8E A;  3NQ9 A;  4ZR2 A;  4ARH A;  3HOE A;  2QOS C;  2JOZ A;  5D47 A;  1NP1 A;  2Q4N A;  3VPJ E;  4GZV A;  2BS6 A;  3WVM A;  1CBR A;  4ZCB A;  5LJD A;  2CBR A;  1AQB A;  4DQ4 A;  2Z4H A;  3KFG A;  5BVQ A;  3VG2 A;  2Z4I A;  4NLJ A;  2QO5 A;  3AKM A;  5HZQ A;  3S60 A;  3WXQ A;  1ZNH A;  4FBV A;  1FTP A;  3IA8 A;  4OS0 A;  3VU1 A;  4GNY A;  1AB0 A;  1Z24 A;  2MHD A;  4OS8 A;  4EDE A;  5LJB A;  1IKE A;  1LPJ A;  4A8Z A;  2ACO A;  1FEN A;  5D48 A;  4NNS A;  1UZ2 X;  2ZAG A;  4KC8 A;  2FS7 A;  4A1Y A;  2RCQ A;  2XST A;  2N93 A;  1IKJ A;  3HOL A;  4IMO A;  2A2U A;  3FR5 A;  1TVQ A;  4MIR A;  4AZQ A;  1VYF A;  4O3W A;  1HQP A;  1CBS A;  2FLJ A;  2ASN X;  3HK1 A;  4A1H A;  4COT A;  3VE1 A;  4YKM A;  4U9C A;  3BU9 A;  3MBT A;  5DG4 A;  3FEP A;  3SAO A;  2CM4 A;  3PQS A;  1DZM A;  1I06 A;  3UEW A;  4AW8 A;  3UEV A;  1GT5 A;  2AT3 X;  1PM1 X;  2F09 A;  2R73 A;  2W2B A;  1GXA A;  5AQ6 A;  1KT5 A;  1DZK A;  1DZP A;  1O1U A;  1TXL A;  4O3X B;  3B2H A;  2FT9 A;  3APW A;  1LFO A;  2G79 A;  4YCE A;  4BOE A;  1HMT A;  3TGA A;  2GTF X;  5LJE A;  1YWA A;  5HCD C;  4XMH A;  2AH7 X;  2OFM X;  2BT9 A;  4U8U N;  3ZUO A;  3ZQ3 A;  1VYG A;  1B56 A;  2CBS A;  3FW4 A;  5B29 A;  4ON1 A;  4GRJ A;  5LKE A;  1DV9 A;  1JJJ A;  1BWY A;  1YWC A;  4OS3 A;  4IMN A;  3EYC A;  1MX8 A;  1EII A;  1G7N A;  4YBP A;  2EU7 X;  2AT6 X;  3VG7 A;  4IB8 A;  1JV4 A;  2JW1 A;  3F6Z B;  2K23 A;  2FWV A;  2AT0 X;  4LKP A;  5H9L A;  1KT6 A;  4GE1 A;  4I3C A;  2RD7 C;  1HMR A;  1XCA A;  1GT3 A;  1BJ7 A;  2A13 A;  4ZHD A;  3BLG A;  3DSZ A;  3P6D A;  1QQS A;  2AKQ A;  4GNW A;  3FIQ A;  4QYN A;  1OEJ A;  4ZHC A;  3WOV A;  5L8I A;  5HZ5 A;  3PH6 A;  3G7X A;  4MVL A;  5HZ6 A;  1I04 A;  3TGC A;  1HBQ A;  4ZHG A;  2QMI A;  5K06 A;  1FE3 A;  4YMY A;  1QG5 A;  5F7G A;  3VG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...