1KZWA

Solution structure of human intestinal fatty acid binding protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
131
structure length
131
Chain Sequence
AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords INTESTINAL FATTY ACID-BINDING PROTEIN (A54)
publication title Solution structure of human intestinal fatty acid binding protein with a naturally-occurring single amino acid substitution (A54T) that is associated with altered lipid metabolism
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2002-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1kzwA00
4QZUA 4NNTA 4A60A 1G7NA 3CR6A 4YFPA 1QY2A 4TLJA 2LFOA 3IFBA 1X8PA 2OFMX 2W2BA 1DC9A 3PEDA 4YGHA 1D2UA 1LF7A 2ANSA 1FE3A 2GTFX 2JN3A 1S2PA 3U9PC 1A57A 5EEDA 4MVKA 1CBIA 1HBQA 3WVMA 3P6FA 1FEMA 2FS7A 4HPAA 4TJZA 1DZPA 3FR4A 4GH7A 1PMPA 5HZ6A 4WFVA 4LKPA 1N0SA 3FIQA 2QO4A 4NYQA 2QO5A 4ZHHA 5L8NA 3ELZA 4ORYA 4GE1A 1KT7A 4BQUA 4I9RA 1SY1A 1ZNDA 4I3DA 4ORWA 4XMCA 4Y0PA 1UZ2X 3RZYA 1GT5A 4IB8A 1ACDA 4A8ZA 1QG5A 1QFTA 3TGAA 4QGVA 2JU3A 3QKGA 2MJIA 1B4MA 4I3CA 1CBRA 2HLVA 2A2GA 3ZUIA 4ALBA 1O8VA 4EFGA 4YFQA 2AT6X 3U0DA 3I0AA 1IFBA 5HA1A 3C77X 4XMHA 5B29A 1KZWA 5IO6A 3FA9A 2WQAE 2Q2MA 1E02A 1S7DA 1GGLA 2FR2A 3D95A 1DZMA 4IMNA 1IKJA 5DG4A 1T0VA 1BRPA 4GRJA 4HPDA 1KT6A 3TGBA 1OBQA 3APUA 3T1DA 1LFOA 2AT0X 1O1VA 1JJJA 3CQNA 1BEBA 1AQBA 4GETA 3UEVA 5F58A 1I04A 3FA7A 4YH0A 4D6AA 4QZTA 1LIDA 1VYGA 1A18A 1ICMA 3STMX 3FELA 4Y0QA 2CBRA 1HQPA 2AL0X 1KT5A 1BSOA 5F1EA 1GX8A 4AZQA 4ZGUA 4ORSA 3KFGA 1TVQA 2LKKA 4RUUA 1KXOA 2W2FA 3KZAA 5F6ZA 5HZ5A 2FT9A 3WJGA 1ERXA 3BLGA 3VG7A 1AVGI 2MM3A 4ES7A 5HCDC 3KQ0A 4ZH9A 3BS2A 2CZTA 2ACPX 2MO5A 4N7CA 2W2AA 4YGGA 5F7GA 1PM1X 2A13A 1YWBA 1RLBE 5HWZA 4Y0SA 3TF6A 1ICNA 1A3YA 4HFOA 1KQXA 2QO6A 3C78X 1JJXA 2G79A 4YCEA 5D4AA 4BOEA 1VYFA 2WWPA 4EEJA 5HZ9A 1BLRA 3HWGA 1DZJA 2AKQA 4TNNA 1CBSA 5H9LA 2GC9A 1EIOA 5FAZA 4KIIA 1NP1A 3B2JA 1LIFA 1YWCA 1QY1A 4IBAA 1VPRA 1RBPA 1B8EA 1H91A 4K19A 3NQ9A 1KOIA 5H8TA 4A1HA 3WJDA 1X8NA 2FTBA 2CZUA 4DQ3A 1E5PA 1KZXA 2FRSA 2OFRX 3EYCA 3NQ3A 3P6EA 5HCEC 2OVDA 5IO7A 1FTPA 1QWDA 1MUPA 4LZUA 3APXA 2KTDA 2QM9A 2R74A 3BRNA 1OPBA 1OEJA 2POAA 5LJBA 2NNDA 2CM4A 1TOUA 4ORXA 1KGLA 1X71A 1PBOA 3HK1A 1GT3A 1YWDA 3I17A 4YMYA 1AB0A 4ZHDA 2LBAA 1XCAA 3F8AA 2LB6A 4QGXA 4NLJA 3JS1A 1U0XA 4ZHFA 1ZNGA 4OMWA 4MVLA 3MBTA 3VG4A 2XSTA 2Q2PA 3FR2A 4IB7A 5KICA 2HZRA 2JOZA 3TZSA 1SA8A 2HYSA 2RCQA 2LBVA 1LKEA 3EBWA 4OS8A 4ARHA 4EDEA 5HZ8A 2NNEA 2Q9SA 1I4UA 3FW5A 4AW8A 1HMRA 2FWVA 4AZPA 1BBPA 1CBQA 1EIIA 2N93A 1T68X 3APWA 4NNSA 5JR8A 1G74A 4YGZA 1QY0A 1SXXA 2R56A 2EU7X 4TQ2A 1NGLA 1KT3A 4M6SA 1U18A 2G7BA 1SY3A 1IIUA 5FFHA 1ZRYA 3BY0A 3FLLA 4ZHGA 4YBPA 2R73A 5K06A 3O2YA 4CK4A 5DPQA 1I05A 2FS6A 3ELXA 2X45A 4PSQA 5KIDA 1DF3A 2CBSA 3OJYC 5EZ2A 1OPAA 3KFFA 4XMEA 5H9KA 3STNA 2WEWA 1Z24A 3FENA 3NR3A 3VG2A 5D8JA 4DQ4A 2ALLX 2L9CA 3PH6A 1L6MA 3PP6A 1QFVA 1SXWA 2IFBA 2QOSC 3U03A 4AZMA 1ZNLA 4GNWA 2FLJA 4ALOA 3G7XA 1T8VA 1E00A 3VG3A 1R0UA 1YWAA 1LIBA 1G85A 2L5PA 1X8QA 3DTQA 4EXZA 1LPJA 3FEPA 2JU7A 2KT4B 4NYRA 3AKMA 4YDBA 5H9AA 3GAQA 5EDCA 2FR3A 1ZNEA 3CBSA 2AMMX 1LICA 3FEKA 5EPQA 1LIEA 3WJBA 5HCCC 5HBSA 1TXLA 3BSZE 5EDBA 5L8IA 5BVSA 1BM5A 2RD7C 3BU9A 2F73A 1TW4A 3FA6A 1GT4A 4NLIA 3ZQ3A 4ZJ0A 1A2DA 2E4JA 5HTDA 3IA8A 3L4RA 3STKA 1SXUA 1DV9A 1YP6A 4QYNA 3EBKA 2RQ0A 4N7DA 3B2IA 1LNMA 2XKLA 2DM5A 4A1YA 1EALA 5H9NA 1YUPA 3B2LA 2NP1A 3PH5A 4OS0A 5IO5A 4HPCA 3MVFA 1X89A 1SXYA 4I9SA 3ZUOA 1P6PA 4LZVA 2RA6A 5F6BA 3P6GA 1UREA 2AT3X 2CM9A 5LJGA 1X8OA 2O62A 4QAEA 3P6DA 3WBGA 2Q4NA 3CWKA 3BX8A 4O9SA 4IB6A 5C0NA 1BSQA 1B56A 1U17A 4IAWA 2L68A 1I06A 2P8GA 3NPOA 3KFIA 4BVMA 1BSYA 1KQWA 1DZKA 1GKAA 2GJ5A 2X46A 1BRQA 4R0BA 3D97A 2WUTA 1EPBA 2AH7X 3NADA 3K3LA 5LKEA 4NP1A 1JZUA 1E06A 1DFVA 1BWYA 4UU2A 3O22A 4Y0RA 2OVEA 5EEEA 1EW3A 1GXAA 1FENA 2AT5X 3HWDA 2JU8A 3VG5A 4ORRA 1YP7A 3NX2A 2BLGA 5LJKA 4XMFA 5D45A 5BVTA 3BDRA 2A0AA 1JBHA 1IKEA 1YIVA 3DSZA 1ZNHA 1NP4A 1CRBA 5HAEA 3UEUA 1D3SA 1ZNKA 1GT1A 1MX8A 2A3FX 2OVAA 3FA8A 1ERBA 1HMSA 2OZQA 4WFUA 3UEXA 1PEEA 1GX9A 2HNXA 1FDQA 4LKTA 2NNQA 1HMTA 3JSQA 4ORUA 3HWEA 4AYHA 1HN2A 4TKBA 3EM0A 3P6HA 4YBUA 3CQRA 3NX1A 3FW4A 4GKCA 1MDCA 3EMMA 4M7MA 1G5WA 4TKJA 3BX7A 1HBPA 5LJCA 5CE4A 4YFRA 5L8OA 2G78A 1EUOA 5BVQA 1OEEA 3FR5A 1JV4A 1BJ7A 2K23A 3APVA 3UEWA 1GM6A 1QABE 3C76X 1OBPA 1MX7A 1TOWA 2WSJA 4QGWA 2Q39A 3CMPA 5AQ6A 1O1UA 4D6BA 2HMBA 2YG2A 3TGCA 5LJDA 1EPAA 5KHPA 1GKAB 5LJEA 5LJHA 2HZQA 4ZHCA 1SY2A 1JYDA 4QYPA 1XKIA 4IMOA 3CBCA 3NP1A 3WJEA 4XMGA 5HZQA 4ZCBA 5D47A 2A2UA 2RCTA 4MVIA 2PY1A 2WR6A 1IFCA 3PPTA 4YCHA 1QQSA 3BU1A 4ZH6A 5HA0A 3F9DA 1CJ5A 1ADLA 3B2KA 4HPBA 2WQ9A 4OS3A 4I3BA 1ALBA 3RSWA 2ACOA 1EXSA 5HTEA 5LKFA 1ML7A 3P6CA 3PECA 4RUNA 2K62A 4GNYA 4WBKA 5D48A 2L67A 1AELA 3B2HA 4AZRA 4AZOA 3O19A 3D96A 3HWFA 3WXQA 4ZFXA 3FMZA 1IW2A 4IAXA 1S44A 1EQDA 4ZR2A 3SAOA 4XMDA 5FENA 1JYJA 4YKOA 2WEXA 1X8UA 4OMXA 2AT8X 1SY0A 3KFHA 3Q6LA 3WJFA 2ASNX 1KT4A 1MVGA 1OEKA 1FELA 4ODDA 3S26A 5B27A 4TKHA 1B0OA 4AZNA 3VG6A 4UU3A 3WJCA 1OBUA 4IB9A 4YDAA 4YKMA 3AKNA
chains in the Genus database with same CATH superfamily
4QZUA 3H3IA 4CDCA 4NNTA 2PI3O 2RN4A 4A60A 1G7NA 3CR6A 3WZOA 4PJ2A 2KD2A 4YFPA 1QY2A 4TLJA 2LFOA 2OL7A 1N9YA 2OF8A 1SWPA 3IFBA 1X8PA 2OFMX 2W2BA 1DC9A 3PEDA 4YGHA 3D9WA 4GU8A 1D2UA 1LF7A 2OVSA 2ANSA 4Y59A 1FE3A 1KFFA 1SREA 1S2PA 2GTFX 2JN3A 2RTLA 3U9PC 5EEDA 3HOLA 3LTWA 4MVKA 1A57A 1CBIA 1KL5A 2RTEB 2X32A 1HBQA 3QQ2A 5B2AO 3WVMA 3P6FA 1FEMA 2FS7A 2IZFB 2RTFB 2Y32A 1DZPA 3FR4A 4HPAA 4NV8A 2BSZA 4GH7A 4I60A 1PMPA 4ML7B 5HZ6A 4WFVA 4LKPA 1N0SA 3FIQA 1GX3A 2QO4A 4EQAC 4NYQA 2QO5A 2OY5O 4ZGFA 4ZHHA 5L8NA 3ELZA 4ORYA 4GE1A 1KT7A 1SWGA 4BQUA 4I9RA 2BC3A 1SY1A 2UYWA 1ZNDA 4I3DA 3P02A 4ORWA 4FBVA 4XMCA 4Y0PA 1UZ2X 3N91A 3RZYA 1SLDB 1GT5A 2OL8O 4IB8A 1LUQA 4BX7B 1N4JA 5IRWA 1ACDA 4A8ZA 1QG5A 1QFTA 4O3XB 3TGAA 1RSTB 4QGVA 2JU3A 3QKGA 2KW1A 2MJIA 3SZHA 3KVNA 1B4MA 4U46A 1STPA 1CBRA 4I3CA 4ZHCA 2MHDA 2OYBO 3AUMO 2HLVA 2A2GA 3ZUIA 4ALBA 1O8VA 3S5VA 4YFQA 4EFGA 4GUZA 3MG5A 1HQQA 2AT6X 3CKGA 1SLFB 3ZW1B 3U0DA 2OF9A 3OBLA 1JMXA 2Y3FA 3I0AA 1IFBA 5HA1A 3LHNA 3C77X 4XMHA 2QMIA 5B29A 1KZWA 2UZ2A 5IO6A 4O3WA 3FA9A 2WQAE 2Q2MA 1VWRB 1SWKA 4Y5DA 1E02A 1RXJA 2Y3EA 1S7DA 1GGLA 1VWHB 2ZAIA 2DJGA 2FR2A 3D95A 1SWTA 1DZMA 4IMNA 1IKJA 5DG4A 1T0VA 1BRPA 2RTMA 4GRJA 4HPDA 1WUBA 1KT6A 3TGBA 1OBQA 3APUA 3T1DA 1PTSA 1LFOA 1SRHA 1O1VA 2AT0X 3E3CA 1JJJA 4QNIA 3CQNA 1BEBA 1AQBA 4GETA 3UEVA 3GE2A 5F58A 1I04A 4BGFA 2IZGB 3FA7A 4YH0A 1RXHA 4QZTA 1LIDA 1VYGA 1A18A 1ICMA 3STMX 4D6AA 3FELA 1KL4A 4GDZA 4GDAA 4Y0QA 2CBRA 4O3YA 1HQPA 2AL0X 1KT5A 2FHLA 2IZDB 4MEEA 1BSOA 5B5GA 5F1EA 4GJVA 1GX8A 4AZQA 4Z2VA 2X55A 4ZGUA 4ON1A 4ORSA 2C1SA 4Z2PA 1WBIA 3KFGA 1TVQA 2LKKA 2RTNB 4RUUA 1KXOA 1SRFA 2W2FA 2RTCB 3KZAA 1UYOX 5F6ZA 5HZ5A 2FT9A 4GGTA 3WJGA 1ERXA 3BLGA 3VG7A 1AVGI 1LDQA 4NW4A 2MM3A 3ZW0A 4ES7A 5HCDC 5F2BA 2G5LA 3KQ0A 4HWMA 4Z6JA 1VWGB 1EI5A 4ZH9A 3BS2A 2CZTA 2ACPX 1VWCB 2MO5A 2AVIA 4N7CA 2JMBA 2W2AA 3CKFA 4YGGA 4DNEA 5AEOA 1SWQA 2LA7A 5F7GA 1PM1X 2A13A 1YWBA 3RE5A 1RLBE 5HWZA 4Y0SA 3TF6A 1ICNA 2RTDB 1A3YA 4HFOA 1KQXA 2QO6A 3C78X 1JJXA 2G79A 4YCEA 5D4AA 4BOEA 1VYFA 2WWPA 4EEJA 5HZ9A 4CPEA 1BLRA 3HWGA 1LCWA 1SLEB 3EC5A 1DZJA 3HPEA 2AKQA 4TNNA 1CBSA 1SRJA 2GC9A 2RTHB 5FAZA 4KIIA 5H9LA 1EIOA 3ZW2A 3FYFA 1SWSA 3WZQA 1VWKB 1NP1A 3B2JA 1LIFA 1YWCA 1QY1A 4IBAA 1VPRA 1RBPA 3VHHA 4BJ8A 1B8EA 1H91A 4K19A 3WYQA 3NQ9A 3D4RA 2A5BA 1KOIA 5H8TA 4A1HA 3VE1A 3WJDA 1X8NA 2FTBA 2CZUA 3NQKA 4DQ3A 3FDCA 1E5PA 1KZXA 2RTAA 2FRSA 2OFRX 3EYCA 3NQ3A 3P6EA 1PBYA 5HCEC 2OVDA 5IO7A 1FTPA 1JMZA 4BX6A 1QWDA 3WZNA 1MUPA 4LZUA 2X8SA 3APXA 2KTDA 2QM9A 2R74A 5AJCA 5K67A 3BRNA 5LJHA 1OPBA 1OEJA 2POAA 2IZBA 1SWOA 1SRIA 5LJBA 5CHKA 2NNDA 1UYNX 2RTIB 2CM4A 1TOUA 2IZEB 2MF6A 4ORXA 5IO5A 4I95A 1SWFA 4GGRA 1X71A 1KGLA 3AEHA 2C1QA 1PBOA 3HK1A 1GT3A 1YWDA 3I17A 4YMYA 1AB0A 4ZHDA 1STSB 2LBAA 1XCAA 3F8AA 2JW1A 2LB6A 3FIDA 4QGXA 4NLJA 2BT9A 3JS1A 1U0XA 4ZHFA 1SWLA 1LCVA 1ZNGA 4OMWA 5B3MO 4MVLA 3MBTA 3VG4A 2XSTA 4JHQA 2OL6O 2Q2PA 3FR2A 4IB7A 5KICA 1LDOA 2IZLB 2HZRA 2JOZA 3TZSA 1SA8A 2HYSA 2MWHA 2RCQA 2LBVA 1LKEA 3EBWA 4OS8A 4ARHA 4EDEA 5HZ8A 3ZWEA 2NNEA 4JGLA 3WYPA 2Q9SA 1I4UA 3FW5A 5IRAA 4QRLA 4AW8A 1HMRA 2FWVA 4AZPA 1BBPA 1SWRA 2A5CA 4FBOA 1CBQA 5CSEA 1EIIA 2N93A 1T68X 1NC9A 3APWA 1LCZA 1STRB 4NNSA 1SWHA 1G74A 2I5VO 1QY0A 1SXXA 2R56A 3EW1A 4YGZA 2EU7X 3RY1A 3VHIA 3VGWA 4TQ2A 1NGLA 1KT3A 4M6SA 3RDUA 1U18A 2G7BA 1SY3A 1IIUA 2Z4IA 1ZRYA 1VWIB 3BY0A 5FFHA 3FLLA 4ZHGA 4YBPA 2R73A 3V8UA 5K06A 3O2YA 3ZW0B 4CK4A 4MIRA 5DPQA 1I05A 2FS6A 3ELXA 2X45A 4PSQA 5KIDA 3HOEA 1JJUA 2CBSA 3OJYC 1DF3A 5EZ2A 4BX6B 1OPAA 3KFFA 2OFAA 4XMEA 5H9KA 2WEWA 3STNA 4CV7A 2GH7A 1Z24A 4FBRA 3FENA 3NR3A 2IZAA 4OELA 5D8JA 3VG2A 1I9HA 2ALLX 4DQ4A 3RDOA 2L9CA 2RTBB 3PH6A 3RDXA 1L6MA 3PP6A 1AVDA 1NDJA 1QFVA 1SXWA 2IFBA 2QOSC 3U03A 3VE2A 4LQZA 1JIWI 4AZMA 1ZNLA 4GNWA 2FLJA 1Y9LA 1JQPA 1VYOA 4ALOA 3G7XA 3NBXX 1T8VA 1E00A 3VG3A 1R0UA 1YWAA 1LIBA 1G85A 3S60A 3LV4A 2L5PA 1X8QA 3DTQA 3RKGA 4C5PA 4CPHA 2HKDA 1LPJA 4FGIB 3FEPA 4EKVA 4EXZA 2JU7A 2KT4B 1Y9TA 4NYRA 3AKMA 5AJBA 4YDBA 5H9AA 3GAQA 3SLOA 5EDCA 4Z28A 2YMSA 2GTLM 3P24A 2FR3A 1Y52X 3T6FA 1N7YA 3PQSA 4U8UM 1ZNEA 3CBSA 4QQ1A 2AMMX 1LICA 3FEKA 5EPQA 1LIEA 3WJBA 5HCCC 5HBSA 1SWNA 1TXLA 1VWDB 3BSZE 5JR8A 5EDBA 5L8IA 1VWJB 4FQBB 5BVSA 2RD7C 1BM5A 2BS6A 3BU9A 2F73A 5B11O 1TW4A 3FA6A 1GT4A 2GTLN 4O49A 4NLIA 3ZQ3A 3OE3A 1VWQB 4ZJ0A 1A2DA 4GJSA 2E4JA 4U8UN 1VWEB 3WOVA 5HTDA 3IA8A 3L4RA 1SWDA 3RDMA 4DCBA 4OEMA 3STKA 1SXUA 1DV9A 1MK5A 2BS5A 1K3BA 1YP6A 1HXLA 2X8FA 3EBKA 2RQ0A 4N7DA 4QYNA 3RDSA 4YVBA 3B2IA 5B5FA 1W6FA 1LNMA 2XKLA 2DM5A 4A1YA 1EALA 5H9NA 1YUPA 3PDFA 1IJ8A 3RWXA 1Y53X 3B2LA 2NP1A 3PH5A 1VWOB 4JNJA 4O4XA 4HPCA 2OFBA 4OS0A 2RTOB 1OSPO 1X89A 3MVFA 1SXYA 3MM0A 4I9SA 3ZUOA 1P6PA 4LZVA 4CDFA 2RA6A 5F6BA 2AF5A 3P6GA 1UREA 4GD9A 2I5ZO 2AT3X 4TJZA 2CM9A 5LJGA 3ZZVA 1X8OA 2O62A 3VHMA 5CYBA 4QAEA 1SWAA 3P6DA 3PQUA 3WBGA 2Q4NA 3CWKA 5BYPA 1DF8A 3BX8A 4GZVA 4O9SA 1MM9A 4IB6A 4COTA 1VWBB 5C0NA 1BSQA 1B56A 1U17A 2OY1O 2IZJA 2L68A 2RTQB 4IAWA 1I06A 3F6ZB 4KH8A 4L3RA 2IZCB 2P8GA 3KFIA 3NPOA 4BVMA 1BSYA 3SLJA 1KQWA 1DZKA 5K68A 4KCAA 1GKAA 2M4LA 2ZSCA 2GJ5A 2X46A 1BRQA 1NQMA 4BX5A 5L3YA 1HXZA 1I78A 4R0BA 3D97A 2WUTA 3UAQA 1RAVA 1EPBA 1RSUB 3EW2A 1W4TA 1SRGA 2AH7X 3NADA 3K3LA 5LKEA 4NP1A 2KTSA 1JZUA 1E06A 1DFVA 2VFBA 3HTYA 3VU1A 1BWYA 2X4MA 4UU2A 3SOTA 1NQNA 3O22A 4Y0RA 1RXKA 2OVEA 5EEEA 1EW3A 3JQOA 3PK2A 5FQ7E 1GXAA 1FENA 2AT5X 2G8CO 2IZKA 4BCSA 2RTRB 4ID2A 4U3QA 4BBOA 2C4IA 3HWDA 2JU8A 3VG5A 4ORRA 1YP7A 2Z4HA 3NX2A 3S5XA 2BLGA 5LJKA 4XMFA 5D45A 5BVTA 3BDRA 5IXGA 4Z27A 2A0AA 3WZPA 1JBHA 1IKEA 4CPHB 2QOMA 4MISA 1YIVA 3Q34A 2FHNX 2FKGA 2WPUA 4KT5A 5B10O 2FKJA 3DSZA 4CDDA 1ZNHA 1NP4A 2IZHB 3RDQA 1MOYA 1K24A 4WHIA 1CRBA 5HAEA 4NV7A 3UEUA 1D3SA 1ZNKA 1GT1A 2JGSA 3MX7A 4CSBA 1MX8A 2A3FX 1SMPI 2OVAA 3SZIA 3FA8A 1Y55X 1ERBA 1HMSA 2OZQA 4U9CA 4WFUA 2A8GA 3UEXA 1PEEA 3T2WA 1GX9A 2HNXA 4CPFA 1FDQA 4LKTA 2NNQA 3RBYA 4O3ZA 1SWUA 1HMTA 3X00A 3JSQA 3SLTA 4ORUA 3HWEA 4KC8A 4AYHA 3VPJE 1VWMB 1Y0GA 2GTLO 1HN2A 4I6SA 4TKBA 3EM0A 3P6HA 4CPIA 4GGZA 4YBUA 4U8UO 3CQRA 3NX1A 3FW4A 4GKCA 1MDCA 2X34A 3EMMA 3T2XA 4M7MA 5FQ8E 4TKJA 3BX7A 4MVEA 1G5WA 1HBPA 1N43A 5LJCA 5CE4A 4YFRA 1SWJA 3ZI8A 1SWEA 3SZJA 4B55A 5L8OA 2G78A 1EUOA 5BVQA 1OEEA 1AVEA 1VWFB 3OD9A 1SWBA 4JO6A 3FR5A 1JV4A 1BJ7A 2K23A 3APVA 3UEWA 1GM6A 1QABE 2RTPB 3C76X 5JD2A 1OBPA 1MX7A 1TOWA 2WSJA 2X8TA 4QGWA 2Q39A 3CMPA 5AQ6A 1O1UA 4D6BA 2HMBA 2YG2A 3TGCA 4OKAA 5LJDA 1EPAA 1HY2A 4GK9A 5KHPA 1GKAB 5LJEA 1VWLB 1SLGB 2HZQA 2VFCA 1SY2A 1JYDA 2OY8A 1XKIA 2RTJA 1NBXA 2ZAGA 4QYPA 4IMOA 5FQ6E 4BX5B 3CBCA 3NP1A 3WJEA 4KC7A 1VWNB 1MEPA 4XMGA 5HZQA 4ZCBA 3RY2A 5D47A 2F09A 2A2UA 2RCTA 4MVIA 4INNA 4CDEA 2PY1A 2WR6A 1IFCA 3PPTA 4YCHA 4L1NA 1QQSA 2VDFA 1E2TA 3BU1A 4ZH6A 5IRUA 5HA0A 2QCBA 2DJFA 3F9DA 4O4OA 1ADLA 1CJ5A 3B2KA 4HPBA 2WQ9A 4OS3A 4I3BA 3T6LA 1ALBA 2RTKA 3ZW1A 4O4UA 2FGSA 3RSWA 2ACOA 1EXSA 2RTGB 2OY7A 1KL3A 5HTEA 5LKFA 1ML7A 3P6CA 3PECA 1N9MA 4O4SA 4RUNA 2K62A 4GNYA 4WBKA 5D48A 2L67A 1AELA 1FJ1E 3B2HA 4AZRA 1LELA 4AZOA 3O19A 4Z2OA 3D96A 3RE6A 3HWFA 3WXQA 2F01A 2IZIA 2CAMA 4ZFXA 4BX7A 2BHVA 3FMZA 1IW2A 2X56A 4IAXA 1S44A 1EQDA 4ZR2A 3SAOA 4XMDA 5FENA 1VWAB 1JYJA 4YKOA 2WEXA 1X8UA 4OMXA 4IRWA 4IABA 1SWCA 1SY0A 2AT8X 3KFHA 3Q6LA 3WJFA 2ASNX 1KT4A 1MVGA 1OEKA 1FELA 4ODDA 3S26A 5B27A 4TKHA 1B0OA 4AZNA 3VG6A 4UU3A 3WJCA 1OBUA 4IB9A 4YDAA 1W5RA 4YKMA 1VWPB 3AKNA
chains in the Genus database with same CATH topology
4QZUA 3H3IA 4NNTA 2RN4A 4A60A 1G7NA 3CR6A 4PJ2A 2KD2A 4YFPA 1QY2A 4TLJA 2LFOA 3IFBA 1X8PA 2OFMX 2W2BA 1DC9A 3PEDA 4YGHA 4GU8A 1D2UA 1LF7A 2OVSA 2ANSA 1FE3A 2GTFX 2JN3A 1S2PA 3U9PC 1A57A 5EEDA 3HOLA 4MVKA 1CBIA 1HBQA 3WVMA 3P6FA 1FEMA 2FS7A 4HPAA 4TJZA 1DZPA 3FR4A 4GH7A 1PMPA 4ML7B 5HZ6A 4WFVA 4LKPA 1N0SA 3FIQA 2QO4A 4EQAC 4NYQA 2QO5A 4ZHHA 4ZGFA 5L8NA 3ELZA 4ORYA 4GE1A 1KT7A 4BQUA 4I9RA 1SY1A 1ZNDA 4I3DA 3P02A 4ORWA 4FBVA 4XMCA 4Y0PA 1UZ2X 3N91A 3RZYA 1GT5A 4IB8A 1ACDA 4A8ZA 1QG5A 1QFTA 4O3XB 3TGAA 4QGVA 2JU3A 3QKGA 2KW1A 2MJIA 1B4MA 4I3CA 1CBRA 2MHDA 2HLVA 2A2GA 3ZUIA 4ALBA 1O8VA 3S5VA 4YFQA 4EFGA 2AT6X 3ZW1B 3U0DA 3OBLA 3I0AA 1IFBA 5HA1A 3LHNA 3C77X 4XMHA 2QMIA 5B29A 1KZWA 5IO6A 4O3WA 3FA9A 2WQAE 2Q2MA 1E02A 1S7DA 1GGLA 2ZAIA 2FR2A 3D95A 1DZMA 4IMNA 1IKJA 5DG4A 1T0VA 1BRPA 4GRJA 4HPDA 1KT6A 3TGBA 1OBQA 3APUA 3T1DA 1LFOA 2AT0X 1O1VA 3E3CA 1JJJA 4QNIA 3CQNA 1BEBA 1AQBA 4GETA 3UEVA 3GE2A 5F58A 1I04A 3FA7A 4YH0A 4D6AA 4QZTA 1LIDA 1VYGA 1A18A 1ICMA 3STMX 3FELA 4GDZA 4Y0QA 2CBRA 4O3YA 1HQPA 2AL0X 1KT5A 1BSOA 5F1EA 1GX8A 4AZQA 4ZGUA 4ON1A 4ORSA 3KFGA 1TVQA 2LKKA 4RUUA 1KXOA 2W2FA 3KZAA 5F6ZA 5HZ5A 2FT9A 3WJGA 1ERXA 3BLGA 3VG7A 1AVGI 4NW4A 3ZW0A 2MM3A 4ES7A 5HCDC 3KQ0A 4HWMA 4ZH9A 1EI5A 3BS2A 2CZTA 2ACPX 2MO5A 4N7CA 2JMBA 2W2AA 4YGGA 5AEOA 2LA7A 5F7GA 1PM1X 2A13A 1YWBA 1RLBE 5HWZA 4Y0SA 3TF6A 1ICNA 1A3YA 4HFOA 1KQXA 2QO6A 3C78X 1JJXA 2G79A 4YCEA 5D4AA 4BOEA 1VYFA 2WWPA 4EEJA 5HZ9A 1BLRA 3HWGA 1DZJA 3SOTA 2AKQA 4TNNA 1CBSA 5H9LA 2GC9A 1EIOA 5FAZA 4KIIA 3ZW2A 3FYFA 1NP1A 3B2JA 1LIFA 1YWCA 1QY1A 4IBAA 1VPRA 1RBPA 1B8EA 1H91A 4K19A 3NQ9A 3D4RA 1KOIA 5H8TA 4A1HA 3VE1A 3WJDA 1X8NA 2FTBA 2CZUA 3NQKA 4DQ3A 1E5PA 1KZXA 2FRSA 2OFRX 3EYCA 3NQ3A 3P6EA 5HCEC 2OVDA 5IO7A 1FTPA 1QWDA 1MUPA 4LZUA 2X8SA 3APXA 2KTDA 2QM9A 2R74A 5AJCA 3BRNA 1OPBA 1OEJA 2POAA 5LJBA 2NNDA 2CM4A 1TOUA 4ORXA 4I95A 1KGLA 1X71A 1PBOA 3HK1A 1GT3A 1YWDA 3I17A 4YMYA 1AB0A 4ZHDA 2LBAA 1XCAA 3F8AA 2JW1A 2LB6A 4QGXA 4NLJA 2BT9A 3JS1A 1U0XA 4ZHFA 1ZNGA 4OMWA 4MVLA 3MBTA 3VG4A 2XSTA 2Q2PA 3FR2A 4IB7A 5KICA 2HZRA 2JOZA 3TZSA 1SA8A 2HYSA 2MWHA 2RCQA 2LBVA 1LKEA 3EBWA 4OS8A 4ARHA 4EDEA 5HZ8A 3ZWEA 2NNEA 4JGLA 2Q9SA 1I4UA 3FW5A 4QRLA 4AW8A 1HMRA 2FWVA 4AZPA 1BBPA 4FBOA 1CBQA 1EIIA 2N93A 1T68X 3APWA 4NNSA 5JR8A 1G74A 4YGZA 1QY0A 1SXXA 2R56A 2EU7X 4TQ2A 1NGLA 1KT3A 4M6SA 1U18A 2G7BA 1SY3A 1IIUA 2Z4IA 1ZRYA 3BY0A 5FFHA 3FLLA 4ZHGA 4YBPA 2R73A 3V8UA 5K06A 3O2YA 3ZW0B 4CK4A 4MIRA 5DPQA 1I05A 2FS6A 3ELXA 2X45A 4PSQA 5KIDA 3HOEA 2CBSA 1DF3A 3OJYC 5EZ2A 1OPAA 3KFFA 4XMEA 5H9KA 3STNA 2WEWA 4CV7A 1Z24A 4FBRA 3FENA 3NR3A 3VG2A 5D8JA 4DQ4A 2ALLX 2L9CA 3PH6A 1L6MA 3PP6A 1QFVA 1SXWA 2IFBA 2QOSC 3U03A 3VE2A 4LQZA 1JIWI 4AZMA 1ZNLA 4GNWA 2FLJA 1Y9LA 4ALOA 3G7XA 3NBXX 1T8VA 1E00A 3VG3A 1R0UA 1YWAA 1LIBA 1G85A 3S60A 3LV4A 2L5PA 1X8QA 3DTQA 3RKGA 4EXZA 4FGIB 1LPJA 3FEPA 2JU7A 2KT4B 1Y9TA 4NYRA 3AKMA 5AJBA 4YDBA 5H9AA 3GAQA 5EDCA 2YMSA 2GTLM 3P24A 2FR3A 3PQSA 4U8UM 1ZNEA 3CBSA 4QQ1A 2AMMX 1LICA 3FEKA 5EPQA 1LIEA 3WJBA 5HCCC 5HBSA 1TXLA 3BSZE 5EDBA 5L8IA 4FQBB 5BVSA 1BM5A 2RD7C 2BS6A 3BU9A 2F73A 1TW4A 3FA6A 1GT4A 2GTLN 4O49A 4NLIA 3ZQ3A 3OE3A 4ZJ0A 1A2DA 3WOVA 2E4JA 4U8UN 5HTDA 3IA8A 3L4RA 3STKA 1SXUA 1DV9A 2BS5A 1YP6A 2X8FA 3EBKA 2RQ0A 4N7DA 4QYNA 3B2IA 1LNMA 2XKLA 2DM5A 4A1YA 1EALA 5H9NA 1YUPA 3RWXA 3B2LA 2NP1A 3PH5A 4O4XA 4OS0A 5IO5A 4HPCA 3MVFA 1X89A 1SXYA 4I9SA 3ZUOA 1P6PA 4LZVA 2RA6A 5F6BA 3P6GA 1UREA 2AT3X 2CM9A 5LJGA 3ZZVA 1X8OA 2O62A 5CYBA 4QAEA 3P6DA 3PQUA 3WBGA 2Q4NA 3CWKA 5BYPA 3BX8A 4GZVA 4O9SA 4COTA 4IB6A 5C0NA 1BSQA 1B56A 1U17A 4IAWA 4KH8A 2L68A 4L3RA 1I06A 3F6ZB 2P8GA 3NPOA 3KFIA 4BVMA 1BSYA 1KQWA 1DZKA 4KCAA 1GKAA 2M4LA 2GJ5A 2X46A 1BRQA 4R0BA 3D97A 2WUTA 3UAQA 1EPBA 2AH7X 3NADA 3K3LA 5LKEA 4NP1A 2KTSA 1JZUA 1E06A 1DFVA 3HTYA 3VU1A 1BWYA 4UU2A 3O22A 4Y0RA 2OVEA 5EEEA 1EW3A 3JQOA 5FQ7E 1GXAA 1FENA 2AT5X 4ID2A 3HWDA 2JU8A 3VG5A 4ORRA 1YP7A 2Z4HA 3NX2A 3S5XA 2BLGA 5LJKA 4XMFA 5D45A 5BVTA 3BDRA 2A0AA 1JBHA 1IKEA 4MISA 1YIVA 4KT5A 3DSZA 1ZNHA 1NP4A 4WHIA 1CRBA 5HAEA 3UEUA 1D3SA 1ZNKA 1GT1A 3MX7A 4CSBA 1MX8A 2A3FX 1SMPI 2OVAA 3FA8A 1ERBA 1HMSA 2OZQA 4U9CA 4WFUA 3UEXA 1PEEA 1GX9A 2HNXA 1FDQA 4LKTA 2NNQA 3RBYA 4O3ZA 1HMTA 3JSQA 4ORUA 3HWEA 4KC8A 4AYHA 3VPJE 2GTLO 1HN2A 4I6SA 4TKBA 3EM0A 3P6HA 4YBUA 4U8UO 3CQRA 3NX1A 3FW4A 4GKCA 1MDCA 3EMMA 4M7MA 5FQ8E 4TKJA 3BX7A 4MVEA 1G5WA 1HBPA 5LJCA 5CE4A 4YFRA 3ZI8A 5L8OA 2G78A 1EUOA 5BVQA 1OEEA 3OD9A 3FR5A 1JV4A 1BJ7A 2K23A 3APVA 3UEWA 1GM6A 1QABE 3C76X 1OBPA 1MX7A 1TOWA 2WSJA 2X8TA 4QGWA 2Q39A 3CMPA 5AQ6A 1O1UA 4D6BA 2HMBA 2YG2A 3TGCA 5LJDA 1EPAA 4GK9A 5KHPA 1GKAB 5LJEA 5LJHA 2HZQA 4U3QA 2ZAGA 1SY2A 1JYDA 4QYPA 1XKIA 5FQ6E 4ZHCA 4IMOA 3CBCA 3NP1A 3WJEA 4KC7A 4XMGA 5HZQA 4ZCBA 5D47A 2F09A 2A2UA 2RCTA 4MVIA 4INNA 2PY1A 2WR6A 1IFCA 3PPTA 4YCHA 4L1NA 1QQSA 3BU1A 4ZH6A 5HA0A 3F9DA 4O4OA 1ADLA 1CJ5A 3B2KA 4HPBA 2WQ9A 4OS3A 4I3BA 1ALBA 3ZW1A 4O4UA 3RSWA 2ACOA 1EXSA 5HTEA 5LKFA 1ML7A 3P6CA 3PECA 4O4SA 4RUNA 2K62A 4GNYA 4WBKA 5D48A 2L67A 1AELA 3B2HA 4AZRA 4AZOA 3O19A 3D96A 3HWFA 3WXQA 4ZFXA 2BHVA 3FMZA 1IW2A 4IAXA 1S44A 1EQDA 4ZR2A 3SAOA 4XMDA 5FENA 1JYJA 4YKOA 2WEXA 1X8UA 4OMXA 4IABA 2AT8X 1SY0A 3KFHA 3Q6LA 3WJFA 2ASNX 1KT4A 1MVGA 1OEKA 1FELA 4ODDA 3S26A 5B27A 4TKHA 1B0OA 4AZNA 3VG6A 4UU3A 3WJCA 1OBUA 4IB9A 4YDAA 4YKMA 3AKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QZU A;  4NNT A;  4A60 A;  1G7N A;  3CR6 A;  4YFP A;  1QY2 A;  4TLJ A;  2LFO A;  3IFB A;  1X8P A;  2OFM X;  2W2B A;  1DC9 A;  3PED A;  4YGH A;  1D2U A;  1LF7 A;  2ANS A;  1FE3 A;  2GTF X;  2JN3 A;  1S2P A;  3U9P C;  1A57 A;  5EED A;  4MVK A;  1CBI A;  1HBQ A;  3WVM A;  3P6F A;  1FEM A;  2FS7 A;  4HPA A;  4TJZ A;  1DZP A;  3FR4 A;  4GH7 A;  1PMP A;  5HZ6 A;  4WFV A;  4LKP A;  1N0S A;  3FIQ A;  2QO4 A;  4NYQ A;  2QO5 A;  4ZHH A;  5L8N A;  3ELZ A;  4ORY A;  4GE1 A;  1KT7 A;  4BQU A;  4I9R A;  1SY1 A;  1ZND A;  4I3D A;  4ORW A;  4XMC A;  4Y0P A;  1UZ2 X;  3RZY A;  1GT5 A;  4IB8 A;  1ACD A;  4A8Z A;  1QG5 A;  1QFT A;  3TGA A;  4QGV A;  2JU3 A;  3QKG A;  2MJI A;  1B4M A;  4I3C A;  1CBR A;  2HLV A;  2A2G A;  3ZUI A;  4ALB A;  1O8V A;  4EFG A;  4YFQ A;  2AT6 X;  3U0D A;  3I0A A;  1IFB A;  5HA1 A;  3C77 X;  4XMH A;  5B29 A;  1KZW A;  5IO6 A;  3FA9 A;  2WQA E;  2Q2M A;  1E02 A;  1S7D A;  1GGL A;  2FR2 A;  3D95 A;  1DZM A;  4IMN A;  1IKJ A;  5DG4 A;  1T0V A;  1BRP A;  4GRJ A;  4HPD A;  1KT6 A;  3TGB A;  1OBQ A;  3APU A;  3T1D A;  1LFO A;  2AT0 X;  1O1V A;  1JJJ A;  3CQN A;  1BEB A;  1AQB A;  4GET A;  3UEV A;  5F58 A;  1I04 A;  3FA7 A;  4YH0 A;  4D6A A;  4QZT A;  1LID A;  1VYG A;  1A18 A;  1ICM A;  3STM X;  3FEL A;  4Y0Q A;  2CBR A;  1HQP A;  2AL0 X;  1KT5 A;  1BSO A;  5F1E A;  1GX8 A;  4AZQ A;  4ZGU A;  4ORS A;  3KFG A;  1TVQ A;  2LKK A;  4RUU A;  1KXO A;  2W2F A;  3KZA A;  5F6Z A;  5HZ5 A;  2FT9 A;  3WJG A;  1ERX A;  3BLG A;  3VG7 A;  1AVG I;  2MM3 A;  4ES7 A;  5HCD C;  3KQ0 A;  4ZH9 A;  3BS2 A;  2CZT A;  2ACP X;  2MO5 A;  4N7C A;  2W2A A;  4YGG A;  5F7G A;  1PM1 X;  2A13 A;  1YWB A;  1RLB E;  5HWZ A;  4Y0S A;  3TF6 A;  1ICN A;  1A3Y A;  4HFO A;  1KQX A;  2QO6 A;  3C78 X;  1JJX A;  2G79 A;  4YCE A;  5D4A A;  4BOE A;  1VYF A;  2WWP A;  4EEJ A;  5HZ9 A;  1BLR A;  3HWG A;  1DZJ A;  2AKQ A;  4TNN A;  1CBS A;  5H9L A;  2GC9 A;  1EIO A;  5FAZ A;  4KII A;  1NP1 A;  3B2J A;  1LIF A;  1YWC A;  1QY1 A;  4IBA A;  1VPR A;  1RBP A;  1B8E A;  1H91 A;  4K19 A;  3NQ9 A;  1KOI A;  5H8T A;  4A1H A;  3WJD A;  1X8N A;  2FTB A;  2CZU A;  4DQ3 A;  1E5P A;  1KZX A;  2FRS A;  2OFR X;  3EYC A;  3NQ3 A;  3P6E A;  5HCE C;  2OVD A;  5IO7 A;  1FTP A;  1QWD A;  1MUP A;  4LZU A;  3APX A;  2KTD A;  2QM9 A;  2R74 A;  3BRN A;  1OPB A;  1OEJ A;  2POA A;  5LJB A;  2NND A;  2CM4 A;  1TOU A;  4ORX A;  1KGL A;  1X71 A;  1PBO A;  3HK1 A;  1GT3 A;  1YWD A;  3I17 A;  4YMY A;  1AB0 A;  4ZHD A;  2LBA A;  1XCA A;  3F8A A;  2LB6 A;  4QGX A;  4NLJ A;  3JS1 A;  1U0X A;  4ZHF A;  1ZNG A;  4OMW A;  4MVL A;  3MBT A;  3VG4 A;  2XST A;  2Q2P A;  3FR2 A;  4IB7 A;  5KIC A;  2HZR A;  2JOZ A;  3TZS A;  1SA8 A;  2HYS A;  2RCQ A;  2LBV A;  1LKE A;  3EBW A;  4OS8 A;  4ARH A;  4EDE A;  5HZ8 A;  2NNE A;  2Q9S A;  1I4U A;  3FW5 A;  4AW8 A;  1HMR A;  2FWV A;  4AZP A;  1BBP A;  1CBQ A;  1EII A;  2N93 A;  1T68 X;  3APW A;  4NNS A;  5JR8 A;  1G74 A;  4YGZ A;  1QY0 A;  1SXX A;  2R56 A;  2EU7 X;  4TQ2 A;  1NGL A;  1KT3 A;  4M6S A;  1U18 A;  2G7B A;  1SY3 A;  1IIU A;  5FFH A;  1ZRY A;  3BY0 A;  3FLL A;  4ZHG A;  4YBP A;  2R73 A;  5K06 A;  3O2Y A;  4CK4 A;  5DPQ A;  1I05 A;  2FS6 A;  3ELX A;  2X45 A;  4PSQ A;  5KID A;  1DF3 A;  2CBS A;  3OJY C;  5EZ2 A;  1OPA A;  3KFF A;  4XME A;  5H9K A;  3STN A;  2WEW A;  1Z24 A;  3FEN A;  3NR3 A;  3VG2 A;  5D8J A;  4DQ4 A;  2ALL X;  2L9C A;  3PH6 A;  1L6M A;  3PP6 A;  1QFV A;  1SXW A;  2IFB A;  2QOS C;  3U03 A;  4AZM A;  1ZNL A;  4GNW A;  2FLJ A;  4ALO A;  3G7X A;  1T8V A;  1E00 A;  3VG3 A;  1R0U A;  1YWA A;  1LIB A;  1G85 A;  2L5P A;  1X8Q A;  3DTQ A;  4EXZ A;  1LPJ A;  3FEP A;  2JU7 A;  2KT4 B;  4NYR A;  3AKM A;  4YDB A;  5H9A A;  3GAQ A;  5EDC A;  2FR3 A;  1ZNE A;  3CBS A;  2AMM X;  1LIC A;  3FEK A;  5EPQ A;  1LIE A;  3WJB A;  5HCC C;  5HBS A;  1TXL A;  3BSZ E;  5EDB A;  5L8I A;  5BVS A;  1BM5 A;  2RD7 C;  3BU9 A;  2F73 A;  1TW4 A;  3FA6 A;  1GT4 A;  4NLI A;  3ZQ3 A;  4ZJ0 A;  1A2D A;  2E4J A;  5HTD A;  3IA8 A;  3L4R A;  3STK A;  1SXU A;  1DV9 A;  1YP6 A;  4QYN A;  3EBK A;  2RQ0 A;  4N7D A;  3B2I A;  1LNM A;  2XKL A;  2DM5 A;  4A1Y A;  1EAL A;  5H9N A;  1YUP A;  3B2L A;  2NP1 A;  3PH5 A;  4OS0 A;  5IO5 A;  4HPC A;  3MVF A;  1X89 A;  1SXY A;  4I9S A;  3ZUO A;  1P6P A;  4LZV A;  2RA6 A;  5F6B A;  3P6G A;  1URE A;  2AT3 X;  2CM9 A;  5LJG A;  1X8O A;  2O62 A;  4QAE A;  3P6D A;  3WBG A;  2Q4N A;  3CWK A;  3BX8 A;  4O9S A;  4IB6 A;  5C0N A;  1BSQ A;  1B56 A;  1U17 A;  4IAW A;  2L68 A;  1I06 A;  2P8G A;  3NPO A;  3KFI A;  4BVM A;  1BSY A;  1KQW A;  1DZK A;  1GKA A;  2GJ5 A;  2X46 A;  1BRQ A;  4R0B A;  3D97 A;  2WUT A;  1EPB A;  2AH7 X;  3NAD A;  3K3L A;  5LKE A;  4NP1 A;  1JZU A;  1E06 A;  1DFV A;  1BWY A;  4UU2 A;  3O22 A;  4Y0R A;  2OVE A;  5EEE A;  1EW3 A;  1GXA A;  1FEN A;  2AT5 X;  3HWD A;  2JU8 A;  3VG5 A;  4ORR A;  1YP7 A;  3NX2 A;  2BLG A;  5LJK A;  4XMF A;  5D45 A;  5BVT A;  3BDR A;  2A0A A;  1JBH A;  1IKE A;  1YIV A;  3DSZ A;  1ZNH A;  1NP4 A;  1CRB A;  5HAE A;  3UEU A;  1D3S A;  1ZNK A;  1GT1 A;  1MX8 A;  2A3F X;  2OVA A;  3FA8 A;  1ERB A;  1HMS A;  2OZQ A;  4WFU A;  3UEX A;  1PEE A;  1GX9 A;  2HNX A;  1FDQ A;  4LKT A;  2NNQ A;  1HMT A;  3JSQ A;  4ORU A;  3HWE A;  4AYH A;  1HN2 A;  4TKB A;  3EM0 A;  3P6H A;  4YBU A;  3CQR A;  3NX1 A;  3FW4 A;  4GKC A;  1MDC A;  3EMM A;  4M7M A;  1G5W A;  4TKJ A;  3BX7 A;  1HBP A;  5LJC A;  5CE4 A;  4YFR A;  5L8O A;  2G78 A;  1EUO A;  5BVQ A;  1OEE A;  3FR5 A;  1JV4 A;  1BJ7 A;  2K23 A;  3APV A;  3UEW A;  1GM6 A;  1QAB E;  3C76 X;  1OBP A;  1MX7 A;  1TOW A;  2WSJ A;  4QGW A;  2Q39 A;  3CMP A;  5AQ6 A;  1O1U A;  4D6B A;  2HMB A;  2YG2 A;  3TGC A;  5LJD A;  1EPA A;  5KHP A;  1GKA B;  5LJE A;  5LJH A;  2HZQ A;  4ZHC A;  1SY2 A;  1JYD A;  4QYP A;  1XKI A;  4IMO A;  3CBC A;  3NP1 A;  3WJE A;  4XMG A;  5HZQ A;  4ZCB A;  5D47 A;  2A2U A;  2RCT A;  4MVI A;  2PY1 A;  2WR6 A;  1IFC A;  3PPT A;  4YCH A;  1QQS A;  3BU1 A;  4ZH6 A;  5HA0 A;  3F9D A;  1CJ5 A;  1ADL A;  3B2K A;  4HPB A;  2WQ9 A;  4OS3 A;  4I3B A;  1ALB A;  3RSW A;  2ACO A;  1EXS A;  5HTE A;  5LKF A;  1ML7 A;  3P6C A;  3PEC A;  4RUN A;  2K62 A;  4GNY A;  4WBK A;  5D48 A;  2L67 A;  1AEL A;  3B2H A;  4AZR A;  4AZO A;  3O19 A;  3D96 A;  3HWF A;  3WXQ A;  4ZFX A;  3FMZ A;  1IW2 A;  4IAX A;  1S44 A;  1EQD A;  4ZR2 A;  3SAO A;  4XMD A;  5FEN A;  1JYJ A;  4YKO A;  2WEX A;  1X8U A;  4OMX A;  2AT8 X;  1SY0 A;  3KFH A;  3Q6L A;  3WJF A;  2ASN X;  1KT4 A;  1MVG A;  1OEK A;  1FEL A;  4ODD A;  3S26 A;  5B27 A;  4TKH A;  1B0O A;  4AZN A;  3VG6 A;  4UU3 A;  3WJC A;  1OBU A;  4IB9 A;  4YDA A;  4YKM A;  3AKN A; 
#chains in the Genus database with same CATH topology
 4QZU A;  3H3I A;  4CDC A;  4NNT A;  2PI3 O;  2RN4 A;  4A60 A;  1G7N A;  3CR6 A;  3WZO A;  4PJ2 A;  2KD2 A;  4YFP A;  1QY2 A;  4TLJ A;  2LFO A;  2OL7 A;  1N9Y A;  2OF8 A;  1SWP A;  3IFB A;  1X8P A;  2OFM X;  2W2B A;  1DC9 A;  3PED A;  4YGH A;  3D9W A;  4GU8 A;  1D2U A;  1LF7 A;  2OVS A;  2ANS A;  4Y59 A;  1FE3 A;  1KFF A;  1SRE A;  1S2P A;  2GTF X;  2JN3 A;  2RTL A;  3U9P C;  5EED A;  3HOL A;  3LTW A;  4MVK A;  1A57 A;  1CBI A;  1KL5 A;  2RTE B;  2X32 A;  1HBQ A;  3QQ2 A;  5B2A O;  3WVM A;  3P6F A;  1FEM A;  2FS7 A;  2IZF B;  2RTF B;  2Y32 A;  1DZP A;  3FR4 A;  4HPA A;  4NV8 A;  2BSZ A;  4GH7 A;  4I60 A;  1PMP A;  4ML7 B;  5HZ6 A;  4WFV A;  4LKP A;  1N0S A;  3FIQ A;  1GX3 A;  2QO4 A;  4EQA C;  4NYQ A;  2QO5 A;  2OY5 O;  4ZGF A;  4ZHH A;  5L8N A;  3ELZ A;  4ORY A;  4GE1 A;  1KT7 A;  1SWG A;  4BQU A;  4I9R A;  2BC3 A;  1SY1 A;  2UYW A;  1ZND A;  4I3D A;  3P02 A;  4ORW A;  4FBV A;  4XMC A;  4Y0P A;  1UZ2 X;  3N91 A;  3RZY A;  1SLD B;  1GT5 A;  2OL8 O;  4IB8 A;  1LUQ A;  4BX7 B;  1N4J A;  5IRW A;  1ACD A;  4A8Z A;  1QG5 A;  1QFT A;  4O3X B;  3TGA A;  1RST B;  4QGV A;  2JU3 A;  3QKG A;  2KW1 A;  2MJI A;  3SZH A;  3KVN A;  1B4M A;  4U46 A;  1STP A;  1CBR A;  4I3C A;  4ZHC A;  2MHD A;  2OYB O;  3AUM O;  2HLV A;  2A2G A;  3ZUI A;  4ALB A;  1O8V A;  3S5V A;  4YFQ A;  4EFG A;  4GUZ A;  3MG5 A;  1HQQ A;  2AT6 X;  3CKG A;  1SLF B;  3ZW1 B;  3U0D A;  2OF9 A;  3OBL A;  1JMX A;  2Y3F A;  3I0A A;  1IFB A;  5HA1 A;  3LHN A;  3C77 X;  4XMH A;  2QMI A;  5B29 A;  1KZW A;  2UZ2 A;  5IO6 A;  4O3W A;  3FA9 A;  2WQA E;  2Q2M A;  1VWR B;  1SWK A;  4Y5D A;  1E02 A;  1RXJ A;  2Y3E A;  1S7D A;  1GGL A;  1VWH B;  2ZAI A;  2DJG A;  2FR2 A;  3D95 A;  1SWT A;  1DZM A;  4IMN A;  1IKJ A;  5DG4 A;  1T0V A;  1BRP A;  2RTM A;  4GRJ A;  4HPD A;  1WUB A;  1KT6 A;  3TGB A;  1OBQ A;  3APU A;  3T1D A;  1PTS A;  1LFO A;  1SRH A;  1O1V A;  2AT0 X;  3E3C A;  1JJJ A;  4QNI A;  3CQN A;  1BEB A;  1AQB A;  4GET A;  3UEV A;  3GE2 A;  5F58 A;  1I04 A;  4BGF A;  2IZG B;  3FA7 A;  4YH0 A;  1RXH A;  4QZT A;  1LID A;  1VYG A;  1A18 A;  1ICM A;  3STM X;  4D6A A;  3FEL A;  1KL4 A;  4GDZ A;  4GDA A;  4Y0Q A;  2CBR A;  4O3Y A;  1HQP A;  2AL0 X;  1KT5 A;  2FHL A;  2IZD B;  4MEE A;  1BSO A;  5B5G A;  5F1E A;  4GJV A;  1GX8 A;  4AZQ A;  4Z2V A;  2X55 A;  4ZGU A;  4ON1 A;  4ORS A;  2C1S A;  4Z2P A;  1WBI A;  3KFG A;  1TVQ A;  2LKK A;  2RTN B;  4RUU A;  1KXO A;  1SRF A;  2W2F A;  2RTC B;  3KZA A;  1UYO X;  5F6Z A;  5HZ5 A;  2FT9 A;  4GGT A;  3WJG A;  1ERX A;  3BLG A;  3VG7 A;  1AVG I;  1LDQ A;  4NW4 A;  2MM3 A;  3ZW0 A;  4ES7 A;  5HCD C;  5F2B A;  2G5L A;  3KQ0 A;  4HWM A;  4Z6J A;  1VWG B;  1EI5 A;  4ZH9 A;  3BS2 A;  2CZT A;  2ACP X;  1VWC B;  2MO5 A;  2AVI A;  4N7C A;  2JMB A;  2W2A A;  3CKF A;  4YGG A;  4DNE A;  5AEO A;  1SWQ A;  2LA7 A;  5F7G A;  1PM1 X;  2A13 A;  1YWB A;  3RE5 A;  1RLB E;  5HWZ A;  4Y0S A;  3TF6 A;  1ICN A;  2RTD B;  1A3Y A;  4HFO A;  1KQX A;  2QO6 A;  3C78 X;  1JJX A;  2G79 A;  4YCE A;  5D4A A;  4BOE A;  1VYF A;  2WWP A;  4EEJ A;  5HZ9 A;  4CPE A;  1BLR A;  3HWG A;  1LCW A;  1SLE B;  3EC5 A;  1DZJ A;  3HPE A;  2AKQ A;  4TNN A;  1CBS A;  1SRJ A;  2GC9 A;  2RTH B;  5FAZ A;  4KII A;  5H9L A;  1EIO A;  3ZW2 A;  3FYF A;  1SWS A;  3WZQ A;  1VWK B;  1NP1 A;  3B2J A;  1LIF A;  1YWC A;  1QY1 A;  4IBA A;  1VPR A;  1RBP A;  3VHH A;  4BJ8 A;  1B8E A;  1H91 A;  4K19 A;  3WYQ A;  3NQ9 A;  3D4R A;  2A5B A;  1KOI A;  5H8T A;  4A1H A;  3VE1 A;  3WJD A;  1X8N A;  2FTB A;  2CZU A;  3NQK A;  4DQ3 A;  3FDC A;  1E5P A;  1KZX A;  2RTA A;  2FRS A;  2OFR X;  3EYC A;  3NQ3 A;  3P6E A;  1PBY A;  5HCE C;  2OVD A;  5IO7 A;  1FTP A;  1JMZ A;  4BX6 A;  1QWD A;  3WZN A;  1MUP A;  4LZU A;  2X8S A;  3APX A;  2KTD A;  2QM9 A;  2R74 A;  5AJC A;  5K67 A;  3BRN A;  5LJH A;  1OPB A;  1OEJ A;  2POA A;  2IZB A;  1SWO A;  1SRI A;  5LJB A;  5CHK A;  2NND A;  1UYN X;  2RTI B;  2CM4 A;  1TOU A;  2IZE B;  2MF6 A;  4ORX A;  5IO5 A;  4I95 A;  1SWF A;  4GGR A;  1X71 A;  1KGL A;  3AEH A;  2C1Q A;  1PBO A;  3HK1 A;  1GT3 A;  1YWD A;  3I17 A;  4YMY A;  1AB0 A;  4ZHD A;  1STS B;  2LBA A;  1XCA A;  3F8A A;  2JW1 A;  2LB6 A;  3FID A;  4QGX A;  4NLJ A;  2BT9 A;  3JS1 A;  1U0X A;  4ZHF A;  1SWL A;  1LCV A;  1ZNG A;  4OMW A;  5B3M O;  4MVL A;  3MBT A;  3VG4 A;  2XST A;  4JHQ A;  2OL6 O;  2Q2P A;  3FR2 A;  4IB7 A;  5KIC A;  1LDO A;  2IZL B;  2HZR A;  2JOZ A;  3TZS A;  1SA8 A;  2HYS A;  2MWH A;  2RCQ A;  2LBV A;  1LKE A;  3EBW A;  4OS8 A;  4ARH A;  4EDE A;  5HZ8 A;  3ZWE A;  2NNE A;  4JGL A;  3WYP A;  2Q9S A;  1I4U A;  3FW5 A;  5IRA A;  4QRL A;  4AW8 A;  1HMR A;  2FWV A;  4AZP A;  1BBP A;  1SWR A;  2A5C A;  4FBO A;  1CBQ A;  5CSE A;  1EII A;  2N93 A;  1T68 X;  1NC9 A;  3APW A;  1LCZ A;  1STR B;  4NNS A;  1SWH A;  1G74 A;  2I5V O;  1QY0 A;  1SXX A;  2R56 A;  3EW1 A;  4YGZ A;  2EU7 X;  3RY1 A;  3VHI A;  3VGW A;  4TQ2 A;  1NGL A;  1KT3 A;  4M6S A;  3RDU A;  1U18 A;  2G7B A;  1SY3 A;  1IIU A;  2Z4I A;  1ZRY A;  1VWI B;  3BY0 A;  5FFH A;  3FLL A;  4ZHG A;  4YBP A;  2R73 A;  3V8U A;  5K06 A;  3O2Y A;  3ZW0 B;  4CK4 A;  4MIR A;  5DPQ A;  1I05 A;  2FS6 A;  3ELX A;  2X45 A;  4PSQ A;  5KID A;  3HOE A;  1JJU A;  2CBS A;  3OJY C;  1DF3 A;  5EZ2 A;  4BX6 B;  1OPA A;  3KFF A;  2OFA A;  4XME A;  5H9K A;  2WEW A;  3STN A;  4CV7 A;  2GH7 A;  1Z24 A;  4FBR A;  3FEN A;  3NR3 A;  2IZA A;  4OEL A;  5D8J A;  3VG2 A;  1I9H A;  2ALL X;  4DQ4 A;  3RDO A;  2L9C A;  2RTB B;  3PH6 A;  3RDX A;  1L6M A;  3PP6 A;  1AVD A;  1NDJ A;  1QFV A;  1SXW A;  2IFB A;  2QOS C;  3U03 A;  3VE2 A;  4LQZ A;  1JIW I;  4AZM A;  1ZNL A;  4GNW A;  2FLJ A;  1Y9L A;  1JQP A;  1VYO A;  4ALO A;  3G7X A;  3NBX X;  1T8V A;  1E00 A;  3VG3 A;  1R0U A;  1YWA A;  1LIB A;  1G85 A;  3S60 A;  3LV4 A;  2L5P A;  1X8Q A;  3DTQ A;  3RKG A;  4C5P A;  4CPH A;  2HKD A;  1LPJ A;  4FGI B;  3FEP A;  4EKV A;  4EXZ A;  2JU7 A;  2KT4 B;  1Y9T A;  4NYR A;  3AKM A;  5AJB A;  4YDB A;  5H9A A;  3GAQ A;  3SLO A;  5EDC A;  4Z28 A;  2YMS A;  2GTL M;  3P24 A;  2FR3 A;  1Y52 X;  3T6F A;  1N7Y A;  3PQS A;  4U8U M;  1ZNE A;  3CBS A;  4QQ1 A;  2AMM X;  1LIC A;  3FEK A;  5EPQ A;  1LIE A;  3WJB A;  5HCC C;  5HBS A;  1SWN A;  1TXL A;  1VWD B;  3BSZ E;  5JR8 A;  5EDB A;  5L8I A;  1VWJ B;  4FQB B;  5BVS A;  2RD7 C;  1BM5 A;  2BS6 A;  3BU9 A;  2F73 A;  5B11 O;  1TW4 A;  3FA6 A;  1GT4 A;  2GTL N;  4O49 A;  4NLI A;  3ZQ3 A;  3OE3 A;  1VWQ B;  4ZJ0 A;  1A2D A;  4GJS A;  2E4J A;  4U8U N;  1VWE B;  3WOV A;  5HTD A;  3IA8 A;  3L4R A;  1SWD A;  3RDM A;  4DCB A;  4OEM A;  3STK A;  1SXU A;  1DV9 A;  1MK5 A;  2BS5 A;  1K3B A;  1YP6 A;  1HXL A;  2X8F A;  3EBK A;  2RQ0 A;  4N7D A;  4QYN A;  3RDS A;  4YVB A;  3B2I A;  5B5F A;  1W6F A;  1LNM A;  2XKL A;  2DM5 A;  4A1Y A;  1EAL A;  5H9N A;  1YUP A;  3PDF A;  1IJ8 A;  3RWX A;  1Y53 X;  3B2L A;  2NP1 A;  3PH5 A;  1VWO B;  4JNJ A;  4O4X A;  4HPC A;  2OFB A;  4OS0 A;  2RTO B;  1OSP O;  1X89 A;  3MVF A;  1SXY A;  3MM0 A;  4I9S A;  3ZUO A;  1P6P A;  4LZV A;  4CDF A;  2RA6 A;  5F6B A;  2AF5 A;  3P6G A;  1URE A;  4GD9 A;  2I5Z O;  2AT3 X;  4TJZ A;  2CM9 A;  5LJG A;  3ZZV A;  1X8O A;  2O62 A;  3VHM A;  5CYB A;  4QAE A;  1SWA A;  3P6D A;  3PQU A;  3WBG A;  2Q4N A;  3CWK A;  5BYP A;  1DF8 A;  3BX8 A;  4GZV A;  4O9S A;  1MM9 A;  4IB6 A;  4COT A;  1VWB B;  5C0N A;  1BSQ A;  1B56 A;  1U17 A;  2OY1 O;  2IZJ A;  2L68 A;  2RTQ B;  4IAW A;  1I06 A;  3F6Z B;  4KH8 A;  4L3R A;  2IZC B;  2P8G A;  3KFI A;  3NPO A;  4BVM A;  1BSY A;  3SLJ A;  1KQW A;  1DZK A;  5K68 A;  4KCA A;  1GKA A;  2M4L A;  2ZSC A;  2GJ5 A;  2X46 A;  1BRQ A;  1NQM A;  4BX5 A;  5L3Y A;  1HXZ A;  1I78 A;  4R0B A;  3D97 A;  2WUT A;  3UAQ A;  1RAV A;  1EPB A;  1RSU B;  3EW2 A;  1W4T A;  1SRG A;  2AH7 X;  3NAD A;  3K3L A;  5LKE A;  4NP1 A;  2KTS A;  1JZU A;  1E06 A;  1DFV A;  2VFB A;  3HTY A;  3VU1 A;  1BWY A;  2X4M A;  4UU2 A;  3SOT A;  1NQN A;  3O22 A;  4Y0R A;  1RXK A;  2OVE A;  5EEE A;  1EW3 A;  3JQO A;  3PK2 A;  5FQ7 E;  1GXA A;  1FEN A;  2AT5 X;  2G8C O;  2IZK A;  4BCS A;  2RTR B;  4ID2 A;  4U3Q A;  4BBO A;  2C4I A;  3HWD A;  2JU8 A;  3VG5 A;  4ORR A;  1YP7 A;  2Z4H A;  3NX2 A;  3S5X A;  2BLG A;  5LJK A;  4XMF A;  5D45 A;  5BVT A;  3BDR A;  5IXG A;  4Z27 A;  2A0A A;  3WZP A;  1JBH A;  1IKE A;  4CPH B;  2QOM A;  4MIS A;  1YIV A;  3Q34 A;  2FHN X;  2FKG A;  2WPU A;  4KT5 A;  5B10 O;  2FKJ A;  3DSZ A;  4CDD A;  1ZNH A;  1NP4 A;  2IZH B;  3RDQ A;  1MOY A;  1K24 A;  4WHI A;  1CRB A;  5HAE A;  4NV7 A;  3UEU A;  1D3S A;  1ZNK A;  1GT1 A;  2JGS A;  3MX7 A;  4CSB A;  1MX8 A;  2A3F X;  1SMP I;  2OVA A;  3SZI A;  3FA8 A;  1Y55 X;  1ERB A;  1HMS A;  2OZQ A;  4U9C A;  4WFU A;  2A8G A;  3UEX A;  1PEE A;  3T2W A;  1GX9 A;  2HNX A;  4CPF A;  1FDQ A;  4LKT A;  2NNQ A;  3RBY A;  4O3Z A;  1SWU A;  1HMT A;  3X00 A;  3JSQ A;  3SLT A;  4ORU A;  3HWE A;  4KC8 A;  4AYH A;  3VPJ E;  1VWM B;  1Y0G A;  2GTL O;  1HN2 A;  4I6S A;  4TKB A;  3EM0 A;  3P6H A;  4CPI A;  4GGZ A;  4YBU A;  4U8U O;  3CQR A;  3NX1 A;  3FW4 A;  4GKC A;  1MDC A;  2X34 A;  3EMM A;  3T2X A;  4M7M A;  5FQ8 E;  4TKJ A;  3BX7 A;  4MVE A;  1G5W A;  1HBP A;  1N43 A;  5LJC A;  5CE4 A;  4YFR A;  1SWJ A;  3ZI8 A;  1SWE A;  3SZJ A;  4B55 A;  5L8O A;  2G78 A;  1EUO A;  5BVQ A;  1OEE A;  1AVE A;  1VWF B;  3OD9 A;  1SWB A;  4JO6 A;  3FR5 A;  1JV4 A;  1BJ7 A;  2K23 A;  3APV A;  3UEW A;  1GM6 A;  1QAB E;  2RTP B;  3C76 X;  5JD2 A;  1OBP A;  1MX7 A;  1TOW A;  2WSJ A;  2X8T A;  4QGW A;  2Q39 A;  3CMP A;  5AQ6 A;  1O1U A;  4D6B A;  2HMB A;  2YG2 A;  3TGC A;  4OKA A;  5LJD A;  1EPA A;  1HY2 A;  4GK9 A;  5KHP A;  1GKA B;  5LJE A;  1VWL B;  1SLG B;  2HZQ A;  2VFC A;  1SY2 A;  1JYD A;  2OY8 A;  1XKI A;  2RTJ A;  1NBX A;  2ZAG A;  4QYP A;  4IMO A;  5FQ6 E;  4BX5 B;  3CBC A;  3NP1 A;  3WJE A;  4KC7 A;  1VWN B;  1MEP A;  4XMG A;  5HZQ A;  4ZCB A;  3RY2 A;  5D47 A;  2F09 A;  2A2U A;  2RCT A;  4MVI A;  4INN A;  4CDE A;  2PY1 A;  2WR6 A;  1IFC A;  3PPT A;  4YCH A;  4L1N A;  1QQS A;  2VDF A;  1E2T A;  3BU1 A;  4ZH6 A;  5IRU A;  5HA0 A;  2QCB A;  2DJF A;  3F9D A;  4O4O A;  1ADL A;  1CJ5 A;  3B2K A;  4HPB A;  2WQ9 A;  4OS3 A;  4I3B A;  3T6L A;  1ALB A;  2RTK A;  3ZW1 A;  4O4U A;  2FGS A;  3RSW A;  2ACO A;  1EXS A;  2RTG B;  2OY7 A;  1KL3 A;  5HTE A;  5LKF A;  1ML7 A;  3P6C A;  3PEC A;  1N9M A;  4O4S A;  4RUN A;  2K62 A;  4GNY A;  4WBK A;  5D48 A;  2L67 A;  1AEL A;  1FJ1 E;  3B2H A;  4AZR A;  1LEL A;  4AZO A;  3O19 A;  4Z2O A;  3D96 A;  3RE6 A;  3HWF A;  3WXQ A;  2F01 A;  2IZI A;  2CAM A;  4ZFX A;  4BX7 A;  2BHV A;  3FMZ A;  1IW2 A;  2X56 A;  4IAX A;  1S44 A;  1EQD A;  4ZR2 A;  3SAO A;  4XMD A;  5FEN A;  1VWA B;  1JYJ A;  4YKO A;  2WEX A;  1X8U A;  4OMX A;  4IRW A;  4IAB A;  1SWC A;  1SY0 A;  2AT8 X;  3KFH A;  3Q6L A;  3WJF A;  2ASN X;  1KT4 A;  1MVG A;  1OEK A;  1FEL A;  4ODD A;  3S26 A;  5B27 A;  4TKH A;  1B0O A;  4AZN A;  3VG6 A;  4UU3 A;  3WJC A;  1OBU A;  4IB9 A;  4YDA A;  1W5R A;  4YKM A;  1VWP B;  3AKN A; 
#chains in the Genus database with same CATH homology
 4QZU A;  3H3I A;  4NNT A;  2RN4 A;  4A60 A;  1G7N A;  3CR6 A;  4PJ2 A;  2KD2 A;  4YFP A;  1QY2 A;  4TLJ A;  2LFO A;  3IFB A;  1X8P A;  2OFM X;  2W2B A;  1DC9 A;  3PED A;  4YGH A;  4GU8 A;  1D2U A;  1LF7 A;  2OVS A;  2ANS A;  1FE3 A;  2GTF X;  2JN3 A;  1S2P A;  3U9P C;  1A57 A;  5EED A;  3HOL A;  4MVK A;  1CBI A;  1HBQ A;  3WVM A;  3P6F A;  1FEM A;  2FS7 A;  4HPA A;  4TJZ A;  1DZP A;  3FR4 A;  4GH7 A;  1PMP A;  4ML7 B;  5HZ6 A;  4WFV A;  4LKP A;  1N0S A;  3FIQ A;  2QO4 A;  4EQA C;  4NYQ A;  2QO5 A;  4ZHH A;  4ZGF A;  5L8N A;  3ELZ A;  4ORY A;  4GE1 A;  1KT7 A;  4BQU A;  4I9R A;  1SY1 A;  1ZND A;  4I3D A;  3P02 A;  4ORW A;  4FBV A;  4XMC A;  4Y0P A;  1UZ2 X;  3N91 A;  3RZY A;  1GT5 A;  4IB8 A;  1ACD A;  4A8Z A;  1QG5 A;  1QFT A;  4O3X B;  3TGA A;  4QGV A;  2JU3 A;  3QKG A;  2KW1 A;  2MJI A;  1B4M A;  4I3C A;  1CBR A;  2MHD A;  2HLV A;  2A2G A;  3ZUI A;  4ALB A;  1O8V A;  3S5V A;  4YFQ A;  4EFG A;  2AT6 X;  3ZW1 B;  3U0D A;  3OBL A;  3I0A A;  1IFB A;  5HA1 A;  3LHN A;  3C77 X;  4XMH A;  2QMI A;  5B29 A;  1KZW A;  5IO6 A;  4O3W A;  3FA9 A;  2WQA E;  2Q2M A;  1E02 A;  1S7D A;  1GGL A;  2ZAI A;  2FR2 A;  3D95 A;  1DZM A;  4IMN A;  1IKJ A;  5DG4 A;  1T0V A;  1BRP A;  4GRJ A;  4HPD A;  1KT6 A;  3TGB A;  1OBQ A;  3APU A;  3T1D A;  1LFO A;  2AT0 X;  1O1V A;  3E3C A;  1JJJ A;  4QNI A;  3CQN A;  1BEB A;  1AQB A;  4GET A;  3UEV A;  3GE2 A;  5F58 A;  1I04 A;  3FA7 A;  4YH0 A;  4D6A A;  4QZT A;  1LID A;  1VYG A;  1A18 A;  1ICM A;  3STM X;  3FEL A;  4GDZ A;  4Y0Q A;  2CBR A;  4O3Y A;  1HQP A;  2AL0 X;  1KT5 A;  1BSO A;  5F1E A;  1GX8 A;  4AZQ A;  4ZGU A;  4ON1 A;  4ORS A;  3KFG A;  1TVQ A;  2LKK A;  4RUU A;  1KXO A;  2W2F A;  3KZA A;  5F6Z A;  5HZ5 A;  2FT9 A;  3WJG A;  1ERX A;  3BLG A;  3VG7 A;  1AVG I;  4NW4 A;  3ZW0 A;  2MM3 A;  4ES7 A;  5HCD C;  3KQ0 A;  4HWM A;  4ZH9 A;  1EI5 A;  3BS2 A;  2CZT A;  2ACP X;  2MO5 A;  4N7C A;  2JMB A;  2W2A A;  4YGG A;  5AEO A;  2LA7 A;  5F7G A;  1PM1 X;  2A13 A;  1YWB A;  1RLB E;  5HWZ A;  4Y0S A;  3TF6 A;  1ICN A;  1A3Y A;  4HFO A;  1KQX A;  2QO6 A;  3C78 X;  1JJX A;  2G79 A;  4YCE A;  5D4A A;  4BOE A;  1VYF A;  2WWP A;  4EEJ A;  5HZ9 A;  1BLR A;  3HWG A;  1DZJ A;  3SOT A;  2AKQ A;  4TNN A;  1CBS A;  5H9L A;  2GC9 A;  1EIO A;  5FAZ A;  4KII A;  3ZW2 A;  3FYF A;  1NP1 A;  3B2J A;  1LIF A;  1YWC A;  1QY1 A;  4IBA A;  1VPR A;  1RBP A;  1B8E A;  1H91 A;  4K19 A;  3NQ9 A;  3D4R A;  1KOI A;  5H8T A;  4A1H A;  3VE1 A;  3WJD A;  1X8N A;  2FTB A;  2CZU A;  3NQK A;  4DQ3 A;  1E5P A;  1KZX A;  2FRS A;  2OFR X;  3EYC A;  3NQ3 A;  3P6E A;  5HCE C;  2OVD A;  5IO7 A;  1FTP A;  1QWD A;  1MUP A;  4LZU A;  2X8S A;  3APX A;  2KTD A;  2QM9 A;  2R74 A;  5AJC A;  3BRN A;  1OPB A;  1OEJ A;  2POA A;  5LJB A;  2NND A;  2CM4 A;  1TOU A;  4ORX A;  4I95 A;  1KGL A;  1X71 A;  1PBO A;  3HK1 A;  1GT3 A;  1YWD A;  3I17 A;  4YMY A;  1AB0 A;  4ZHD A;  2LBA A;  1XCA A;  3F8A A;  2JW1 A;  2LB6 A;  4QGX A;  4NLJ A;  2BT9 A;  3JS1 A;  1U0X A;  4ZHF A;  1ZNG A;  4OMW A;  4MVL A;  3MBT A;  3VG4 A;  2XST A;  2Q2P A;  3FR2 A;  4IB7 A;  5KIC A;  2HZR A;  2JOZ A;  3TZS A;  1SA8 A;  2HYS A;  2MWH A;  2RCQ A;  2LBV A;  1LKE A;  3EBW A;  4OS8 A;  4ARH A;  4EDE A;  5HZ8 A;  3ZWE A;  2NNE A;  4JGL A;  2Q9S A;  1I4U A;  3FW5 A;  4QRL A;  4AW8 A;  1HMR A;  2FWV A;  4AZP A;  1BBP A;  4FBO A;  1CBQ A;  1EII A;  2N93 A;  1T68 X;  3APW A;  4NNS A;  5JR8 A;  1G74 A;  4YGZ A;  1QY0 A;  1SXX A;  2R56 A;  2EU7 X;  4TQ2 A;  1NGL A;  1KT3 A;  4M6S A;  1U18 A;  2G7B A;  1SY3 A;  1IIU A;  2Z4I A;  1ZRY A;  3BY0 A;  5FFH A;  3FLL A;  4ZHG A;  4YBP A;  2R73 A;  3V8U A;  5K06 A;  3O2Y A;  3ZW0 B;  4CK4 A;  4MIR A;  5DPQ A;  1I05 A;  2FS6 A;  3ELX A;  2X45 A;  4PSQ A;  5KID A;  3HOE A;  2CBS A;  1DF3 A;  3OJY C;  5EZ2 A;  1OPA A;  3KFF A;  4XME A;  5H9K A;  3STN A;  2WEW A;  4CV7 A;  1Z24 A;  4FBR A;  3FEN A;  3NR3 A;  3VG2 A;  5D8J A;  4DQ4 A;  2ALL X;  2L9C A;  3PH6 A;  1L6M A;  3PP6 A;  1QFV A;  1SXW A;  2IFB A;  2QOS C;  3U03 A;  3VE2 A;  4LQZ A;  1JIW I;  4AZM A;  1ZNL A;  4GNW A;  2FLJ A;  1Y9L A;  4ALO A;  3G7X A;  3NBX X;  1T8V A;  1E00 A;  3VG3 A;  1R0U A;  1YWA A;  1LIB A;  1G85 A;  3S60 A;  3LV4 A;  2L5P A;  1X8Q A;  3DTQ A;  3RKG A;  4EXZ A;  4FGI B;  1LPJ A;  3FEP A;  2JU7 A;  2KT4 B;  1Y9T A;  4NYR A;  3AKM A;  5AJB A;  4YDB A;  5H9A A;  3GAQ A;  5EDC A;  2YMS A;  2GTL M;  3P24 A;  2FR3 A;  3PQS A;  4U8U M;  1ZNE A;  3CBS A;  4QQ1 A;  2AMM X;  1LIC A;  3FEK A;  5EPQ A;  1LIE A;  3WJB A;  5HCC C;  5HBS A;  1TXL A;  3BSZ E;  5EDB A;  5L8I A;  4FQB B;  5BVS A;  1BM5 A;  2RD7 C;  2BS6 A;  3BU9 A;  2F73 A;  1TW4 A;  3FA6 A;  1GT4 A;  2GTL N;  4O49 A;  4NLI A;  3ZQ3 A;  3OE3 A;  4ZJ0 A;  1A2D A;  3WOV A;  2E4J A;  4U8U N;  5HTD A;  3IA8 A;  3L4R A;  3STK A;  1SXU A;  1DV9 A;  2BS5 A;  1YP6 A;  2X8F A;  3EBK A;  2RQ0 A;  4N7D A;  4QYN A;  3B2I A;  1LNM A;  2XKL A;  2DM5 A;  4A1Y A;  1EAL A;  5H9N A;  1YUP A;  3RWX A;  3B2L A;  2NP1 A;  3PH5 A;  4O4X A;  4OS0 A;  5IO5 A;  4HPC A;  3MVF A;  1X89 A;  1SXY A;  4I9S A;  3ZUO A;  1P6P A;  4LZV A;  2RA6 A;  5F6B A;  3P6G A;  1URE A;  2AT3 X;  2CM9 A;  5LJG A;  3ZZV A;  1X8O A;  2O62 A;  5CYB A;  4QAE A;  3P6D A;  3PQU A;  3WBG A;  2Q4N A;  3CWK A;  5BYP A;  3BX8 A;  4GZV A;  4O9S A;  4COT A;  4IB6 A;  5C0N A;  1BSQ A;  1B56 A;  1U17 A;  4IAW A;  4KH8 A;  2L68 A;  4L3R A;  1I06 A;  3F6Z B;  2P8G A;  3NPO A;  3KFI A;  4BVM A;  1BSY A;  1KQW A;  1DZK A;  4KCA A;  1GKA A;  2M4L A;  2GJ5 A;  2X46 A;  1BRQ A;  4R0B A;  3D97 A;  2WUT A;  3UAQ A;  1EPB A;  2AH7 X;  3NAD A;  3K3L A;  5LKE A;  4NP1 A;  2KTS A;  1JZU A;  1E06 A;  1DFV A;  3HTY A;  3VU1 A;  1BWY A;  4UU2 A;  3O22 A;  4Y0R A;  2OVE A;  5EEE A;  1EW3 A;  3JQO A;  5FQ7 E;  1GXA A;  1FEN A;  2AT5 X;  4ID2 A;  3HWD A;  2JU8 A;  3VG5 A;  4ORR A;  1YP7 A;  2Z4H A;  3NX2 A;  3S5X A;  2BLG A;  5LJK A;  4XMF A;  5D45 A;  5BVT A;  3BDR A;  2A0A A;  1JBH A;  1IKE A;  4MIS A;  1YIV A;  4KT5 A;  3DSZ A;  1ZNH A;  1NP4 A;  4WHI A;  1CRB A;  5HAE A;  3UEU A;  1D3S A;  1ZNK A;  1GT1 A;  3MX7 A;  4CSB A;  1MX8 A;  2A3F X;  1SMP I;  2OVA A;  3FA8 A;  1ERB A;  1HMS A;  2OZQ A;  4U9C A;  4WFU A;  3UEX A;  1PEE A;  1GX9 A;  2HNX A;  1FDQ A;  4LKT A;  2NNQ A;  3RBY A;  4O3Z A;  1HMT A;  3JSQ A;  4ORU A;  3HWE A;  4KC8 A;  4AYH A;  3VPJ E;  2GTL O;  1HN2 A;  4I6S A;  4TKB A;  3EM0 A;  3P6H A;  4YBU A;  4U8U O;  3CQR A;  3NX1 A;  3FW4 A;  4GKC A;  1MDC A;  3EMM A;  4M7M A;  5FQ8 E;  4TKJ A;  3BX7 A;  4MVE A;  1G5W A;  1HBP A;  5LJC A;  5CE4 A;  4YFR A;  3ZI8 A;  5L8O A;  2G78 A;  1EUO A;  5BVQ A;  1OEE A;  3OD9 A;  3FR5 A;  1JV4 A;  1BJ7 A;  2K23 A;  3APV A;  3UEW A;  1GM6 A;  1QAB E;  3C76 X;  1OBP A;  1MX7 A;  1TOW A;  2WSJ A;  2X8T A;  4QGW A;  2Q39 A;  3CMP A;  5AQ6 A;  1O1U A;  4D6B A;  2HMB A;  2YG2 A;  3TGC A;  5LJD A;  1EPA A;  4GK9 A;  5KHP A;  1GKA B;  5LJE A;  5LJH A;  2HZQ A;  4U3Q A;  2ZAG A;  1SY2 A;  1JYD A;  4QYP A;  1XKI A;  5FQ6 E;  4ZHC A;  4IMO A;  3CBC A;  3NP1 A;  3WJE A;  4KC7 A;  4XMG A;  5HZQ A;  4ZCB A;  5D47 A;  2F09 A;  2A2U A;  2RCT A;  4MVI A;  4INN A;  2PY1 A;  2WR6 A;  1IFC A;  3PPT A;  4YCH A;  4L1N A;  1QQS A;  3BU1 A;  4ZH6 A;  5HA0 A;  3F9D A;  4O4O A;  1ADL A;  1CJ5 A;  3B2K A;  4HPB A;  2WQ9 A;  4OS3 A;  4I3B A;  1ALB A;  3ZW1 A;  4O4U A;  3RSW A;  2ACO A;  1EXS A;  5HTE A;  5LKF A;  1ML7 A;  3P6C A;  3PEC A;  4O4S A;  4RUN A;  2K62 A;  4GNY A;  4WBK A;  5D48 A;  2L67 A;  1AEL A;  3B2H A;  4AZR A;  4AZO A;  3O19 A;  3D96 A;  3HWF A;  3WXQ A;  4ZFX A;  2BHV A;  3FMZ A;  1IW2 A;  4IAX A;  1S44 A;  1EQD A;  4ZR2 A;  3SAO A;  4XMD A;  5FEN A;  1JYJ A;  4YKO A;  2WEX A;  1X8U A;  4OMX A;  4IAB A;  2AT8 X;  1SY0 A;  3KFH A;  3Q6L A;  3WJF A;  2ASN X;  1KT4 A;  1MVG A;  1OEK A;  1FEL A;  4ODD A;  3S26 A;  5B27 A;  4TKH A;  1B0O A;  4AZN A;  3VG6 A;  4UU3 A;  3WJC A;  1OBU A;  4IB9 A;  4YDA A;  4YKM A;  3AKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...