2BS6A

Lectin from ralstonia solanacearum complexed with xyloglucan fragment
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
89
structure length
89
Chain Sequence
b'SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCWGGNGWTKSAYTAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
publication title The fucose-binding lectin from Ralstonia solanacearum. A new type of beta-propeller architecture formed by oligomerization and interacting with fucoside, fucosyllactose, and plant xyloglucan.
pubmed doi rcsb
source organism Ralstonia solanacearum
molecule tags Lectin
total genus 12
structure length 89
sequence length 89
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07938 Fungal_lectin Fungal fucose-specific lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.190 Mainly Beta Beta Barrel Lipocalin Lipocalin 2bs6A01
5AJCA 3ZW0A 2BT9A 3ZI8A 3ZW1A 2BS6A 3ZW2A 3ZWEA 3ZW1B 4I6SA 5AJBA 3ZZVA 2BS5A 3ZW0B
chains in the Genus database with same CATH superfamily
3NBXX 2CZUA 4U8UN 4YBUA 4YVBA 1N43A 3FA6A 3WJEA 2X46A 4Z2OA 4GD9A 3KFIA 3I0AA 4IB6A 3VG2A 4TQ2A 5HCCC 3VHHA 1G74A 1HN2A 2IZCB 2JU7A 1DFVA 3P6HA 1SLFB 2ANSA 2FS6A 3EM0A 2AT5X 4OMXA 3APUA 3BU1A 2W2AA 5HCEC 4LQZA 1VWKB 4WFVA 3BX7A 4WBKA 4QNIA 2POAA 1DC9A 3ELXA 5FQ8E 3ZQ3A 4ZJ0A 1S7DA 2NNQA 1SRFA 2L9CA 1VWRB 1D3SA 3KVNA 4NV8A 5B5GA 4MISA 2RCQA 1LIFA 1VWIB 4IAWA 1KL4A 2BHVA 2P8GA 1BSQA 1FENA 1CBIA 4LKPA 2RTGB 3B2LA 3HK1A 2EU7X 3PEDA 1EALA 2W2FA 2FRSA 4ZH6A 4Z2PA 4QGWA 1JJUA 3FLLA 5F58A 2DM5A 5FQ7E 2G5LA 3FEPA 4ORSA 5EDCA 5F6BA 4ALBA 3JS1A 4MVLA 4Z2VA 3GE2A 5F1EA 2L5PA 3TGCA 3UEVA 1ACDA 1EI5A 3HOEA 2HZRA 1KT3A 2BC3A 2FR2A 3CWKA 3EBWA 4I9SA 5CYBA 2ACPX 3HPEA 3WXQA 1EW3A 1OPAA 1SY0A 1VWJB 2WQAE 2WWPA 3D4RA 4OS0A 1STSB 5B27A 3RSWA 3UAQA 1VWEB 2A2UA 1ALBA 3BLGA 3NX2A 3AUMO 2FHLA 2WQ9A 3KFGA 2AT0X 1B0OA 4I60A 2VFBA 4NP1A 4D6BA 5AQ6A 5LJGA 5IXGA 2WUTA 1GKAA 2FLJA 1MUPA 4CDCA 2FS7A 2JGSA 2RTJA 1X8PA 4BVMA 5LJEA 3AEHA 2Y3EA 4N7DA 1E00A 4AYHA 4QQ1A 3KFFA 3C78X 3PDFA 1KZXA 4YKMA 3S60A 3WZOA 4YMYA 2WEWA 4CSBA 4ZHCA 4NNSA 4ID2A 1QQSA 3SLTA 1SWRA 3APXA 2IZHB 1AB0A 4NLJA 5L8NA 1SXWA 2MM3A 1E06A 3L4RA 1NP1A 1IKEA 2Q9SA 3FENA 4KT5A 4LZUA 3FIQA 1Z24A 4YDBA 3VG7A 1MK5A 3RZYA 4GGTA 4DNEA 1X8UA 4EEJA 2RTLA 5EDBA 3WYQA 1SWAA 3BDRA 1VWDB 2X32A 3B2KA 3HOLA 3MG5A 3RKGA 5EEDA 4U3QA 1SWHA 1SLGB 3STMX 4I6SA 1FTPA 1OBPA 2RTCB 1O1VA 3H3IA 2X8FA 4GGZA 1RXJA 4XMDA 1U18A 5HZ8A 5L3YA 3SZHA 1T68X 5KICA 2L67A 2RTDB 2UZ2A 1U17A 4ML7B 3VPJE 1QY2A 1DZPA 1HXZA 3ZW1A 1YP6A 3PECA 3SOTA 1GM6A 4GDAA 2QM9A 2AF5A 2RTIB 3VG6A 1ZNDA 4BBOA 1KQXA 1LIDA 1SXUA 3RDXA 4ZR2A 2RTAA 4O3WA 3ELZA 1HBPA 1LIBA 1W4TA 4QZUA 2WEXA 5LJKA 4O49A 1GT1A 4GRJA 4IMNA 2HLVA 1PM1X 2JN3A 4A60A 2RTRB 4BGFA 4EKVA 3PQUA 1SWJA 1OBUA 3RY1A 3MX7A 4OS8A 1BSYA 4QZTA 2MHDA 2OL7A 1DF3A 5B11O 1EXSA 1EIOA 5FQ6E 1GX9A 3KQ0A 3WYPA 2QO6A 4GJVA 4O4SA 3RE5A 1AELA 3EW1A 1YIVA 1S2PA 2ASNX 2KW1A 2RTMA 1NP4A 3VGWA 1JMXA 1GX3A 1SRHA 4QGVA 1JZUA 4YBPA 1NGLA 3OE3A 1CJ5A 4ZHHA 2HMBA 1G7NA 1K24A 1KFFA 2RQ0A 2I5ZO 5D4AA 1ZNLA 1QY1A 2RTEB 5HZQA 1VYGA 2OL6O 3TZSA 3P6GA 2HNXA 2AL0X 2MJIA 5HZ6A 1TOUA 4CPFA 1NDJA 2RTHB 5EEEA 4GK9A 1WUBA 3Q6LA 5IRUA 1JV4A 1T0VA 1VWGB 3VG5A 4ORYA 3LV4A 2K62A 4AZRA 1FJ1E 3SZJA 2OFRX 1JBHA 4CPHA 5LJDA 3P6DA 5IRWA 4U9CA 1BJ7A 1LCWA 2CZTA 3BX8A 3RBYA 5KIDA 2R74A 3D97A 2F73A 4O4XA 5H9KA 3FR5A 4D6AA 2MO5A 4JO6A 2WPUA 4Z28A 3QQ2A 5K06A 1ERXA 4NLIA 3UEWA 3HWDA 1HMSA 1NC9A 1NQNA 2C4IA 3FR4A 1GGLA 5BVQA 1BBPA 1A2DA 5BVTA 1HQPA 4BQUA 1I05A 2FKGA 3BU9A 3BSZE 1BRPA 1X89A 2LFOA 2W2BA 1XCAA 4EXZA 5B2AO 1RXKA 1SWLA 1O8VA 1ZNGA 3FYFA 2IZJA 5IO7A 2NNEA 2DJGA 4M6SA 1EPAA 1VWBB 4IBAA 1GKAB 3D96A 3O22A 3F9DA 4GU8A 2YG2A 5FAZA 5D45A 5B3MO 3T2XA 2M4LA 3VU1A 4CV7A 1SWEA 3NX1A 1LKEA 1K3BA 1VWLB 4YGGA 1VWQB 3G7XA 5H8TA 3STKA 1PMPA 1SLEB 5H9NA 4CK4A 2IZAA 1SRJA 1FEMA 1DZKA 3EC5A 3WJBA 4ZGUA 4OELA 1LPJA 1BSOA 3BY0A 1SRGA 2AT3X 1SWBA 1YWDA 1FE3A 1SWGA 1DF8A 2G7BA 2LKKA 4QYNA 1G5WA 1BRQA 4C5PA 4XMEA 2NP1A 4HPCA 1N7YA 3NPOA 3BS2A 1SWKA 3VE1A 2NNDA 1B4MA 4BX7B 2GTFX 3FA7A 4XMFA 3WZQA 4UU3A 1RAVA 1S44A 2RTFB 1I9HA 3LTWA 4LKTA 1LF7A 3WJGA 3WBGA 2K23A 4XMCA 3VG3A 4YCEA 1LUQA 2X55A 4EDEA 3NQ3A 1SWQA 4TKJA 2O62A 5L8IA 3NADA 3CBCA 1JMZA 1IW2A 2L68A 3EYCA 3FIDA 3CKGA 3WZPA 1KXOA 1MOYA 1SWDA 1LCVA 2OVEA 4N7CA 2BS6A 1U0XA 2F09A 5DPQA 1KL3A 1AVDA 1HXLA 4GNYA 5D47A 5CE4A 1PBOA 1SY3A 2CAMA 2QMIA 4FGIB 4TNNA 4MEEA 3STNA 4MVIA 3FDCA 3RDMA 1QABE 3TGBA 1FDQA 1W6FA 3P02A 1X8QA 3RE6A 3NR3A 4UU2A 3T2WA 5HCDC 4O9SA 2LA7A 3ZW1B 1IFCA 4DQ4A 4Y0RA 1X8OA 2A5BA 3P24A 2RA6A 1RXHA 1JYJA 1I04A 3FMZA 3UEUA 4PJ2A 3VE2A 1AVEA 1OEEA 3FELA 4GZVA 1LIEA 4IMOA 4BX7A 1STPA 2X34A 3DSZA 4L3RA 1EUOA 1IKJA 1G85A 1RSTB 2KTDA 5CSEA 3AKMA 3BRNA 5AEOA 4AZPA 1BEBA 3JSQA 3P6EA 4ORWA 1MX7A 1VWFB 1KZWA 4BOEA 1FELA 1I4UA 1X71A 1VWMB 2A3FX 2QOMA 2GTLM 4DCBA 2C1SA 4NYQA 3B2IA 1NQMA 3WJDA 1ICNA 4ZH9A 1SWUA 3QKGA 3T6LA 4WFUA 2OYBO 3VG4A 3VHIA 1XKIA 4GJSA 1CBSA 4CPHB 4BX6A 2OFAA 4IABA 2XSTA 1HQQA 4CPEA 4YGHA 5LKFA 3OJYC 2BLGA 5IRAA 1GT4A 3KZAA 2KTSA 4ZHDA 4ZGFA 4ALOA 1CRBA 2DJFA 1VPRA 3EBKA 2A0AA 3V8UA 1YWAA 5AJCA 2Q39A 2FGSA 1KT7A 5HBSA 2IZBA 4I3BA 2OY7A 2CBRA 3IFBA 4CDDA 2QCBA 1HY2A 5D48A 5JD2A 1GT5A 2WR6A 1VYFA 3OD9A 3U0DA 3GAQA 5LKEA 1EQDA 1P6PA 2X8SA 2IFBA 1SWTA 3K3LA 4GH7A 4O3ZA 4O3YA 5K67A 4ODDA 2OL8O 2FKJA 4RUNA 5HTDA 2VDFA 3PQSA 3SLOA 2RTPB 4XMHA 2X45A 1UYNX 2RN4A 3EMMA 1YUPA 1E02A 4U8UM 4ZCBA 3ZW0A 4Z6JA 3FA8A 1EPBA 3C76X 3S26A 2GH7A 4HPDA 2LB6A 2OZQA 3OBLA 3F8AA 5HWZA 4TKBA 2OFBA 4Y0SA 1HMTA 3ZUOA 4O4UA 1OEKA 3WJCA 3WVMA 1TW4A 2IZKA 2OF8A 4AW8A 1SLDB 1MEPA 2RTQB 1R0UA 2JOZA 5IO5A 2E4JA 2HZQA 2WSJA 2X4MA 2ZSCA 3D9WA 3MBTA 4I3DA 5B10O 1VYOA 4FBOA 3WOVA 1DZMA 4QGXA 3T1DA 1Y9LA 3FW5A 3SAOA 3X00A 2GTLO 2AKQA 1N0SA 2ZAGA 2AH7X 4ZHGA 1DV9A 3IA8A 1A3YA 4WHIA 4R0BA 1ML7A 3TGAA 1PEEA 2OVAA 4IRWA 5HA1A 2JU8A 3ZZVA 1SRIA 2BS5A 1JIWI 4CPIA 2R56A 1ZNHA 2ALLX 4YH0A 1QY0A 1SA8A 1ZRYA 4MVKA 2MF6A 1AQBA 1LCZA 4ZHFA 1E2TA 4LZVA 1ZNKA 3CMPA 3MVFA 5HZ9A 2G78A 3JQOA 2GJ5A 4MVEA 3CKFA 2MWHA 1A18A 1JJJA 2XKLA 4O3XB 2Y32A 1LFOA 4A1HA 1LDQA 1Y9TA 3HTYA 2AT8X 2Q4NA 4ORXA 1KGLA 2IZEB 4AZQA 1JQPA 1LELA 4O4OA 4BX5A 1BLRA 3U9PC 5AJBA 3APVA 4YFPA 1B8EA 1YWBA 2G8CO 1MDCA 5C0NA 2OVDA 3RDSA 1LNMA 3O19A 4U8UO 3RDQA 2QOSC 2HKDA 1H91A 3HWFA 3PH5A 2IZGB 1UREA 1JYDA 4OMWA 4AZMA 5B29A 5LJBA 1KT4A 4IAXA 4I95A 3EW2A 1SWOA 2YMSA 3PP6A 4EFGA 5HA0A 4PSQA 2JU3A 4KC7A 1KT5A 2GC9A 1YP7A 4CDFA 2RTKA 1OSPO 2UYWA 2LBAA 3C77X 5KHPA 2OY8A 4QYPA 5F7GA 1N9MA 3DTQA 4BX6B 4EQAC 1HBQA 1SWFA 1SY1A 3AKNA 3B2HA 1KQWA 3PH6A 2FHNX 1B56A 2FWVA 1VWNB 4QAEA 2QO4A 3ZWEA 4YFRA 4GKCA 3CQRA 2QO5A 3ZI8A 1O1UA 5LJCA 1PTSA 4Y5DA 1SWNA 4Z27A 4YGZA 4BCSA 3S5XA 3LHNA 3B2JA 1JJXA 4AZNA 1I78A 1UYOX 5H9LA 2IZDB 3RWXA 3WJFA 4GE1A 2X56A 4KIIA 3HWEA 1ERBA 4ARHA 1L6MA 2KD2A 4OKAA 2LBVA 2OVSA 3RDUA 2BSZA 2CBSA 4OEMA 4FBRA 2PI3O 1OEJA 4FQBB 2RD7C 5JR8A 1X8NA 2AT6X 1GT3A 2JW1A 1HMRA 4QRLA 3NQKA 1QFTA 5F6ZA 2FT9A 2JMBA 1DZJA 1ICMA 1TXLA 3MM0A 2IZLB 1AVGI 4YKOA 5EZ2A 3UEXA 1MM9A 1QG5A 1SY2A 1A57A 1BM5A 2VFCA 5BVSA 3ZW0B 4B55A 2F01A 3RDOA 4TLJA 1SWPA 3PPTA 1KOIA 1CBRA 2A8GA 4JNJA 4NV7A 3E3CA 1UZ2X 4YFQA 1IFBA 2ACOA 2OY1O 3VHMA 4XMGA 2FR3A 4GETA 2RTBB 4YCHA 2BT9A 3SLJA 5H9AA 4IB9A 3NQ9A 1TOWA 4IB7A 2Z4HA 2RTOB 2ZAIA 1N4JA 1EIIA 1PBYA 2OFMX 4FBVA 1MVGA 1VWAB 4HWMA 4KH8A 5FFHA 5HAEA 3FA9A 5EPQA 2G79A 4A8ZA 4BJ8A 4CDEA 1SWSA 1WBIA 5BYPA 3N91A 3ZW2A 1D2UA 4BX5B 1BWYA 1STRB 2A13A 3FEKA 4I9RA 4Y0PA 1Y0GA 4KC8A 2IZIA 2AMMX 1MX8A 2C1QA 4MIRA 4DQ3A 2RTNB 4JGLA 1SWCA 1VWOB 4HFOA 4NW4A 1Y52X 3T6FA 4INNA 1GX8A 1W5RA 2X8TA 1LDOA 4M7MA 3I17A 4TJZA 3KFHA 1IJ8A 4GNWA 1OPBA 5K68A 4COTA 2AVIA 1SXYA 4GDZA 4OS3A 3P6FA 2OF9A 4HPAA 2A2GA 1CBQA 3P6CA 4A1YA 5FENA 2OY5O 3NP1A 2Q2MA 2RCTA 1TVQA 1GXAA 3O2YA 2Q2PA 5B5FA 2GTLN 1I06A 4I3CA 5D8JA 1QFVA 4ES7A 5L8OA 5IO6A 1RLBE 2PY1A 1RBPA 4Y0QA 1YWCA 3CBSA 3SZIA 5LJHA 1Y53X 2IZFB 4ON1A 3APWA 1VWHB 5HTEA 5CHKA 4RUUA 4YDAA 4KCAA 5DG4A 1VWPB 1QWDA 1SXXA 4ORUA 4K19A 1Y55X 1OBQA 1SMPI 3CQNA 1SREA 4GGRA 2KT4B 3HWGA 1VWCB 2HYSA 4IB8A 4Y59A 2R73A 4ZFXA 1NBXA 3PK2A 3CR6A 1ADLA 2FTBA 2N93A 1T8VA 1E5PA 4HPBA 5F2BA 3S5VA 3D95A 3FR2A 2I5VO 1N9YA 3F6ZB 4JHQA 3ZUIA 3U03A 4TKHA 4NYRA 4ORRA 4GUZA 3RY2A 2CM4A 2CM9A 1KL5A 1KT6A 1RSUB 3TF6A 5HZ5A 4U46A 3FW4A 3WZNA 1LICA 4AZOA 2A5CA 2Z4IA 1IIUA 2Y3FA 3Q34A 1ZNEA 4L1NA 4NNTA
chains in the Genus database with same CATH topology
3NBXX 2CZUA 4U8UN 4YBUA 3FA6A 3WJEA 2X46A 4IB6A 3KFIA 3I0AA 3VG2A 4TQ2A 5HCCC 1G74A 1HN2A 2JU7A 1DFVA 3P6HA 3EM0A 2ANSA 2FS6A 4OMXA 2AT5X 3APUA 3BU1A 2W2AA 5HCEC 4LQZA 4WFVA 3BX7A 4WBKA 4QNIA 2POAA 1DC9A 3ELXA 5FQ8E 3ZQ3A 4ZJ0A 1S7DA 2NNQA 2L9CA 1D3SA 4MISA 2RCQA 1LIFA 4IAWA 2BHVA 2P8GA 1BSQA 1FENA 1CBIA 4LKPA 3B2LA 3HK1A 2EU7X 3PEDA 1EALA 2W2FA 2FRSA 4ZH6A 4QGWA 3FLLA 5F58A 2DM5A 5FQ7E 3FEPA 4ORSA 5EDCA 5F6BA 4ALBA 3JS1A 4MVLA 3GE2A 5F1EA 2L5PA 3TGCA 3UEVA 1ACDA 1EI5A 3HOEA 2HZRA 1KT3A 3CWKA 2FR2A 3EBWA 4I9SA 3ZW1B 5CYBA 2ACPX 3WXQA 4BVMA 1EW3A 1OPAA 1SY0A 2WQAE 2WWPA 4OS0A 3D4RA 3UAQA 5B27A 3RSWA 2A2UA 1ALBA 3BLGA 3NX2A 2WQ9A 3KFGA 2AT0X 1B0OA 4D6BA 4NP1A 5AQ6A 5LJGA 2WUTA 1GKAA 2FLJA 1MUPA 2FS7A 1X8PA 5LJEA 4N7DA 1E00A 4AYHA 4QQ1A 3KFFA 3C78X 1KZXA 4YKMA 3S60A 4YMYA 2WEWA 4CSBA 4ZHCA 4NNSA 4ID2A 1QQSA 3APXA 4NLJA 1AB0A 5L8NA 1SXWA 2MM3A 1E06A 3L4RA 1NP1A 1IKEA 2Q9SA 3FENA 4KT5A 4LZUA 3FIQA 1Z24A 4YDBA 3VG7A 3RZYA 4EEJA 1X8UA 5EDBA 3BDRA 3B2KA 3HOLA 3RKGA 5EEDA 4U3QA 3STMX 4I6SA 1FTPA 1OBPA 4XMDA 1O1VA 3H3IA 2X8FA 5HZ8A 1U18A 5KICA 1T68X 2L67A 4ML7B 3ZW1A 1U17A 3VPJE 1QY2A 1DZPA 1YP6A 3PECA 3SOTA 1GM6A 2QM9A 3VG6A 1ZNDA 1KQXA 1LIDA 1SXUA 4ZR2A 4O3WA 3ELZA 1HBPA 1LIBA 4QZUA 5LJKA 2WEXA 4O49A 1GT1A 4GRJA 4IMNA 2HLVA 1PM1X 2JN3A 4A60A 3PQUA 1OBUA 3MX7A 4OS8A 1BSYA 4QZTA 2MHDA 1DF3A 1EXSA 1EIOA 5FQ6E 1GX9A 3KQ0A 1AELA 2QO6A 4O4SA 1YIVA 1S2PA 2ASNX 2KW1A 1NP4A 4QGVA 1JZUA 4YBPA 1NGLA 3OE3A 1CJ5A 4ZHHA 2HMBA 1G7NA 2RQ0A 5D4AA 1ZNLA 1QY1A 5HZQA 1VYGA 3TZSA 3P6GA 2HNXA 2AL0X 2MJIA 5HZ6A 1TOUA 5EEEA 3VG5A 4GK9A 3Q6LA 1G5WA 1JV4A 1T0VA 4AZRA 4ORYA 3LV4A 2K62A 2OFRX 1JBHA 5LJDA 3P6DA 4U9CA 1BJ7A 3RBYA 2CZTA 3BX8A 5KIDA 2R74A 3D97A 2F73A 4O4XA 5H9KA 3FR5A 4D6AA 2MO5A 5K06A 1ERXA 4NLIA 3UEWA 3HWDA 1HMSA 3FR4A 1GGLA 1BBPA 1A2DA 5BVTA 1HQPA 4BQUA 1I05A 3BU9A 3BSZE 1BRPA 1X89A 2LFOA 2W2BA 1XCAA 4EXZA 1O8VA 1ZNGA 3FYFA 5IO7A 2NNEA 4M6SA 1EPAA 4IBAA 1GKAB 3D96A 3O22A 3F9DA 4GU8A 2YG2A 5FAZA 5D45A 3VU1A 2M4LA 4CV7A 3NX1A 4YGGA 1LKEA 5H8TA 3G7XA 3STKA 1PMPA 5H9NA 4CK4A 1FEMA 1DZKA 3WJBA 4ZGUA 1LPJA 1BSOA 3BY0A 4K19A 2AT3X 1YWDA 2LKKA 1FE3A 4QYNA 2G7BA 1BRQA 4XMEA 2NP1A 4HPCA 3NPOA 3BS2A 3VE1A 2NNDA 1B4MA 2GTFX 3FA7A 4XMFA 4UU3A 1S44A 4LKTA 3WJGA 1LF7A 3WBGA 2K23A 4XMCA 3VG3A 4YCEA 4EDEA 3NQ3A 4TKJA 2O62A 5L8IA 3NADA 3CBCA 3EYCA 1IW2A 2L68A 1KXOA 2OVEA 4N7CA 2BS6A 1U0XA 2F09A 5DPQA 4GNYA 5D47A 5CE4A 1PBOA 1SY3A 2QMIA 4TNNA 4FGIB 3STNA 4MVIA 1QABE 3TGBA 1FDQA 3P02A 1X8QA 3NR3A 4UU2A 5HCDC 4O9SA 2LA7A 1IFCA 4DQ4A 4Y0RA 1X8OA 3P24A 2RA6A 3UEUA 1JYJA 1I04A 3FMZA 3VE2A 4PJ2A 1OEEA 3FELA 4GZVA 1LIEA 4IMOA 3DSZA 4L3RA 1EUOA 1IKJA 1G85A 2KTDA 3AKMA 3BRNA 5AEOA 4AZPA 1BEBA 3JSQA 3P6EA 4ORWA 1MX7A 1KZWA 4BOEA 1FELA 1I4UA 1X71A 2A3FX 2GTLM 4NYQA 3B2IA 3WJDA 1ICNA 4ZH9A 3QKGA 4WFUA 3VG4A 1XKIA 1CBSA 4IABA 2XSTA 4YGHA 5LKFA 3OJYC 2BLGA 1GT4A 3KZAA 2KTSA 4ZHDA 4ZGFA 4ALOA 1CRBA 1VPRA 3EBKA 2A0AA 3V8UA 1YWAA 5AJCA 2Q39A 1KT7A 5HBSA 4I3BA 2CBRA 3IFBA 5D48A 1GT5A 2WR6A 1VYFA 3OD9A 3U0DA 3GAQA 5LKEA 1EQDA 1P6PA 2X8SA 2IFBA 3K3LA 4GH7A 4O3ZA 4O3YA 4ODDA 4RUNA 5HTDA 3PQSA 4XMHA 2X45A 2RN4A 3EMMA 1YUPA 1E02A 4U8UM 4ZCBA 3ZW0A 3FA8A 1EPBA 3C76X 3S26A 4HPDA 2LB6A 2OZQA 3OBLA 3F8AA 5HWZA 4TKBA 4Y0SA 3ZUOA 1HMTA 4O4UA 1OEKA 3WJCA 3WVMA 1TW4A 4AW8A 5IO5A 1R0UA 2JOZA 2E4JA 2HZQA 2WSJA 4I3DA 3MBTA 4FBOA 1DZMA 4QGXA 3T1DA 1Y9LA 3FW5A 3SAOA 2GTLO 2AKQA 1N0SA 2ZAGA 2AH7X 4ZHGA 1DV9A 3IA8A 1A3YA 4WHIA 4R0BA 1ML7A 3TGAA 1PEEA 2OVAA 3ZZVA 5HA1A 2JU8A 2BS5A 1JIWI 2R56A 1ZNHA 2ALLX 4YH0A 1QY0A 1SA8A 1ZRYA 4MVKA 1AQBA 4ZHFA 4LZVA 1ZNKA 3CMPA 3MVFA 5HZ9A 2G78A 3JQOA 2GJ5A 4MVEA 2MWHA 1A18A 1JJJA 2XKLA 4O3XB 1LFOA 4A1HA 1Y9TA 3HTYA 2AT8X 2Q4NA 4ORXA 1KGLA 4AZQA 4O4OA 1BLRA 3U9PC 5AJBA 3APVA 4YFPA 1B8EA 1YWBA 1MDCA 5C0NA 2OVDA 1LNMA 3O19A 4U8UO 2QOSC 3HWFA 1H91A 4OMWA 3PH5A 4AZMA 1UREA 1JYDA 5B29A 5LJBA 1KT4A 4IAXA 4I95A 3PP6A 2YMSA 4EFGA 5HA0A 4PSQA 2JU3A 4KC7A 1KT5A 2GC9A 1YP7A 5KHPA 2LBAA 3C77X 4QYPA 5F7GA 3DTQA 4EQAC 1HBQA 3AKNA 1SY1A 3B2HA 5BVQA 1KQWA 3PH6A 3WOVA 1B56A 2FWVA 4QAEA 3ZWEA 2QO4A 4YFRA 4GKCA 3CQRA 2QO5A 3ZI8A 1O1UA 5LJCA 4YGZA 3S5XA 3LHNA 3B2JA 1JJXA 4AZNA 5H9LA 3RWXA 3WJFA 4GE1A 4KIIA 4ARHA 3HWEA 1ERBA 1L6MA 2KD2A 2LBVA 2OVSA 2CBSA 4FBRA 1OEJA 4FQBB 2RD7C 5JR8A 1X8NA 2AT6X 1GT3A 2JW1A 1HMRA 4QRLA 3NQKA 1QFTA 5F6ZA 2JMBA 2FT9A 1DZJA 1ICMA 1TXLA 5EZ2A 1AVGI 4YKOA 3UEXA 1A57A 1QG5A 1SY2A 1BM5A 5BVSA 3ZW0B 4TLJA 3PPTA 1KOIA 1CBRA 4YFQA 3E3CA 1UZ2X 1IFBA 2ACOA 4XMGA 2FR3A 4GETA 4YCHA 2BT9A 5H9AA 4IB9A 3NQ9A 1TOWA 4IB7A 2Z4HA 2ZAIA 1EIIA 4FBVA 2OFMX 1MVGA 4HWMA 4KH8A 5FFHA 5HAEA 3FA9A 5EPQA 2G79A 4A8ZA 5BYPA 3N91A 3ZW2A 1D2UA 1BWYA 2A13A 3FEKA 4I9RA 4Y0PA 4KC8A 2AMMX 1MX8A 4MIRA 4DQ3A 4JGLA 4HFOA 4NW4A 4INNA 1GX8A 4M7MA 2X8TA 4TJZA 3I17A 3KFHA 4GNWA 1OPBA 4COTA 1SXYA 4GDZA 4OS3A 3P6FA 4HPAA 2A2GA 1CBQA 3P6CA 4A1YA 5FENA 3NP1A 2Q2MA 2RCTA 1TVQA 1GXAA 3O2YA 2Q2PA 2GTLN 1I06A 4I3CA 5D8JA 1QFVA 4ES7A 5L8OA 5IO6A 1RLBE 2PY1A 1RBPA 4Y0QA 1YWCA 3CBSA 5LJHA 4ON1A 3APWA 5HTEA 4RUUA 4YDAA 4KCAA 5DG4A 1QWDA 1SXXA 4ORUA 1OBQA 1SMPI 3CQNA 2KT4B 3HWGA 4IB8A 2HYSA 2R73A 4ZFXA 3CR6A 1ADLA 2FTBA 2N93A 1T8VA 1E5PA 4HPBA 3S5VA 3D95A 3FR2A 3U03A 3F6ZB 3ZUIA 4TKHA 4NYRA 4ORRA 2CM4A 2CM9A 1KT6A 3TF6A 5HZ5A 3FW4A 1LICA 4AZOA 2Z4IA 1IIUA 1ZNEA 4L1NA 4NNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJC A;  3ZW0 A;  2BT9 A;  3ZI8 A;  3ZW1 A;  2BS6 A;  3ZW2 A;  3ZWE A;  3ZW1 B;  4I6S A;  5AJB A;  3ZZV A;  2BS5 A;  3ZW0 B; 
#chains in the Genus database with same CATH topology
 3NBX X;  2CZU A;  4U8U N;  4YBU A;  4YVB A;  1N43 A;  3FA6 A;  3WJE A;  2X46 A;  4Z2O A;  4GD9 A;  3KFI A;  3I0A A;  4IB6 A;  3VG2 A;  4TQ2 A;  5HCC C;  3VHH A;  1G74 A;  1HN2 A;  2IZC B;  2JU7 A;  1DFV A;  3P6H A;  1SLF B;  2ANS A;  2FS6 A;  3EM0 A;  2AT5 X;  4OMX A;  3APU A;  3BU1 A;  2W2A A;  5HCE C;  4LQZ A;  1VWK B;  4WFV A;  3BX7 A;  4WBK A;  4QNI A;  2POA A;  1DC9 A;  3ELX A;  5FQ8 E;  3ZQ3 A;  4ZJ0 A;  1S7D A;  2NNQ A;  1SRF A;  2L9C A;  1VWR B;  1D3S A;  3KVN A;  4NV8 A;  5B5G A;  4MIS A;  2RCQ A;  1LIF A;  1VWI B;  4IAW A;  1KL4 A;  2BHV A;  2P8G A;  1BSQ A;  1FEN A;  1CBI A;  4LKP A;  2RTG B;  3B2L A;  3HK1 A;  2EU7 X;  3PED A;  1EAL A;  2W2F A;  2FRS A;  4ZH6 A;  4Z2P A;  4QGW A;  1JJU A;  3FLL A;  5F58 A;  2DM5 A;  5FQ7 E;  2G5L A;  3FEP A;  4ORS A;  5EDC A;  5F6B A;  4ALB A;  3JS1 A;  4MVL A;  4Z2V A;  3GE2 A;  5F1E A;  2L5P A;  3TGC A;  3UEV A;  1ACD A;  1EI5 A;  3HOE A;  2HZR A;  1KT3 A;  2BC3 A;  2FR2 A;  3CWK A;  3EBW A;  4I9S A;  5CYB A;  2ACP X;  3HPE A;  3WXQ A;  1EW3 A;  1OPA A;  1SY0 A;  1VWJ B;  2WQA E;  2WWP A;  3D4R A;  4OS0 A;  1STS B;  5B27 A;  3RSW A;  3UAQ A;  1VWE B;  2A2U A;  1ALB A;  3BLG A;  3NX2 A;  3AUM O;  2FHL A;  2WQ9 A;  3KFG A;  2AT0 X;  1B0O A;  4I60 A;  2VFB A;  4NP1 A;  4D6B A;  5AQ6 A;  5LJG A;  5IXG A;  2WUT A;  1GKA A;  2FLJ A;  1MUP A;  4CDC A;  2FS7 A;  2JGS A;  2RTJ A;  1X8P A;  4BVM A;  5LJE A;  3AEH A;  2Y3E A;  4N7D A;  1E00 A;  4AYH A;  4QQ1 A;  3KFF A;  3C78 X;  3PDF A;  1KZX A;  4YKM A;  3S60 A;  3WZO A;  4YMY A;  2WEW A;  4CSB A;  4ZHC A;  4NNS A;  4ID2 A;  1QQS A;  3SLT A;  1SWR A;  3APX A;  2IZH B;  1AB0 A;  4NLJ A;  5L8N A;  1SXW A;  2MM3 A;  1E06 A;  3L4R A;  1NP1 A;  1IKE A;  2Q9S A;  3FEN A;  4KT5 A;  4LZU A;  3FIQ A;  1Z24 A;  4YDB A;  3VG7 A;  1MK5 A;  3RZY A;  4GGT A;  4DNE A;  1X8U A;  4EEJ A;  2RTL A;  5EDB A;  3WYQ A;  1SWA A;  3BDR A;  1VWD B;  2X32 A;  3B2K A;  3HOL A;  3MG5 A;  3RKG A;  5EED A;  4U3Q A;  1SWH A;  1SLG B;  3STM X;  4I6S A;  1FTP A;  1OBP A;  2RTC B;  1O1V A;  3H3I A;  2X8F A;  4GGZ A;  1RXJ A;  4XMD A;  1U18 A;  5HZ8 A;  5L3Y A;  3SZH A;  1T68 X;  5KIC A;  2L67 A;  2RTD B;  2UZ2 A;  1U17 A;  4ML7 B;  3VPJ E;  1QY2 A;  1DZP A;  1HXZ A;  3ZW1 A;  1YP6 A;  3PEC A;  3SOT A;  1GM6 A;  4GDA A;  2QM9 A;  2AF5 A;  2RTI B;  3VG6 A;  1ZND A;  4BBO A;  1KQX A;  1LID A;  1SXU A;  3RDX A;  4ZR2 A;  2RTA A;  4O3W A;  3ELZ A;  1HBP A;  1LIB A;  1W4T A;  4QZU A;  2WEX A;  5LJK A;  4O49 A;  1GT1 A;  4GRJ A;  4IMN A;  2HLV A;  1PM1 X;  2JN3 A;  4A60 A;  2RTR B;  4BGF A;  4EKV A;  3PQU A;  1SWJ A;  1OBU A;  3RY1 A;  3MX7 A;  4OS8 A;  1BSY A;  4QZT A;  2MHD A;  2OL7 A;  1DF3 A;  5B11 O;  1EXS A;  1EIO A;  5FQ6 E;  1GX9 A;  3KQ0 A;  3WYP A;  2QO6 A;  4GJV A;  4O4S A;  3RE5 A;  1AEL A;  3EW1 A;  1YIV A;  1S2P A;  2ASN X;  2KW1 A;  2RTM A;  1NP4 A;  3VGW A;  1JMX A;  1GX3 A;  1SRH A;  4QGV A;  1JZU A;  4YBP A;  1NGL A;  3OE3 A;  1CJ5 A;  4ZHH A;  2HMB A;  1G7N A;  1K24 A;  1KFF A;  2RQ0 A;  2I5Z O;  5D4A A;  1ZNL A;  1QY1 A;  2RTE B;  5HZQ A;  1VYG A;  2OL6 O;  3TZS A;  3P6G A;  2HNX A;  2AL0 X;  2MJI A;  5HZ6 A;  1TOU A;  4CPF A;  1NDJ A;  2RTH B;  5EEE A;  4GK9 A;  1WUB A;  3Q6L A;  5IRU A;  1JV4 A;  1T0V A;  1VWG B;  3VG5 A;  4ORY A;  3LV4 A;  2K62 A;  4AZR A;  1FJ1 E;  3SZJ A;  2OFR X;  1JBH A;  4CPH A;  5LJD A;  3P6D A;  5IRW A;  4U9C A;  1BJ7 A;  1LCW A;  2CZT A;  3BX8 A;  3RBY A;  5KID A;  2R74 A;  3D97 A;  2F73 A;  4O4X A;  5H9K A;  3FR5 A;  4D6A A;  2MO5 A;  4JO6 A;  2WPU A;  4Z28 A;  3QQ2 A;  5K06 A;  1ERX A;  4NLI A;  3UEW A;  3HWD A;  1HMS A;  1NC9 A;  1NQN A;  2C4I A;  3FR4 A;  1GGL A;  5BVQ A;  1BBP A;  1A2D A;  5BVT A;  1HQP A;  4BQU A;  1I05 A;  2FKG A;  3BU9 A;  3BSZ E;  1BRP A;  1X89 A;  2LFO A;  2W2B A;  1XCA A;  4EXZ A;  5B2A O;  1RXK A;  1SWL A;  1O8V A;  1ZNG A;  3FYF A;  2IZJ A;  5IO7 A;  2NNE A;  2DJG A;  4M6S A;  1EPA A;  1VWB B;  4IBA A;  1GKA B;  3D96 A;  3O22 A;  3F9D A;  4GU8 A;  2YG2 A;  5FAZ A;  5D45 A;  5B3M O;  3T2X A;  2M4L A;  3VU1 A;  4CV7 A;  1SWE A;  3NX1 A;  1LKE A;  1K3B A;  1VWL B;  4YGG A;  1VWQ B;  3G7X A;  5H8T A;  3STK A;  1PMP A;  1SLE B;  5H9N A;  4CK4 A;  2IZA A;  1SRJ A;  1FEM A;  1DZK A;  3EC5 A;  3WJB A;  4ZGU A;  4OEL A;  1LPJ A;  1BSO A;  3BY0 A;  1SRG A;  2AT3 X;  1SWB A;  1YWD A;  1FE3 A;  1SWG A;  1DF8 A;  2G7B A;  2LKK A;  4QYN A;  1G5W A;  1BRQ A;  4C5P A;  4XME A;  2NP1 A;  4HPC A;  1N7Y A;  3NPO A;  3BS2 A;  1SWK A;  3VE1 A;  2NND A;  1B4M A;  4BX7 B;  2GTF X;  3FA7 A;  4XMF A;  3WZQ A;  4UU3 A;  1RAV A;  1S44 A;  2RTF B;  1I9H A;  3LTW A;  4LKT A;  1LF7 A;  3WJG A;  3WBG A;  2K23 A;  4XMC A;  3VG3 A;  4YCE A;  1LUQ A;  2X55 A;  4EDE A;  3NQ3 A;  1SWQ A;  4TKJ A;  2O62 A;  5L8I A;  3NAD A;  3CBC A;  1JMZ A;  1IW2 A;  2L68 A;  3EYC A;  3FID A;  3CKG A;  3WZP A;  1KXO A;  1MOY A;  1SWD A;  1LCV A;  2OVE A;  4N7C A;  2BS6 A;  1U0X A;  2F09 A;  5DPQ A;  1KL3 A;  1AVD A;  1HXL A;  4GNY A;  5D47 A;  5CE4 A;  1PBO A;  1SY3 A;  2CAM A;  2QMI A;  4FGI B;  4TNN A;  4MEE A;  3STN A;  4MVI A;  3FDC A;  3RDM A;  1QAB E;  3TGB A;  1FDQ A;  1W6F A;  3P02 A;  1X8Q A;  3RE6 A;  3NR3 A;  4UU2 A;  3T2W A;  5HCD C;  4O9S A;  2LA7 A;  3ZW1 B;  1IFC A;  4DQ4 A;  4Y0R A;  1X8O A;  2A5B A;  3P24 A;  2RA6 A;  1RXH A;  1JYJ A;  1I04 A;  3FMZ A;  3UEU A;  4PJ2 A;  3VE2 A;  1AVE A;  1OEE A;  3FEL A;  4GZV A;  1LIE A;  4IMO A;  4BX7 A;  1STP A;  2X34 A;  3DSZ A;  4L3R A;  1EUO A;  1IKJ A;  1G85 A;  1RST B;  2KTD A;  5CSE A;  3AKM A;  3BRN A;  5AEO A;  4AZP A;  1BEB A;  3JSQ A;  3P6E A;  4ORW A;  1MX7 A;  1VWF B;  1KZW A;  4BOE A;  1FEL A;  1I4U A;  1X71 A;  1VWM B;  2A3F X;  2QOM A;  2GTL M;  4DCB A;  2C1S A;  4NYQ A;  3B2I A;  1NQM A;  3WJD A;  1ICN A;  4ZH9 A;  1SWU A;  3QKG A;  3T6L A;  4WFU A;  2OYB O;  3VG4 A;  3VHI A;  1XKI A;  4GJS A;  1CBS A;  4CPH B;  4BX6 A;  2OFA A;  4IAB A;  2XST A;  1HQQ A;  4CPE A;  4YGH A;  5LKF A;  3OJY C;  2BLG A;  5IRA A;  1GT4 A;  3KZA A;  2KTS A;  4ZHD A;  4ZGF A;  4ALO A;  1CRB A;  2DJF A;  1VPR A;  3EBK A;  2A0A A;  3V8U A;  1YWA A;  5AJC A;  2Q39 A;  2FGS A;  1KT7 A;  5HBS A;  2IZB A;  4I3B A;  2OY7 A;  2CBR A;  3IFB A;  4CDD A;  2QCB A;  1HY2 A;  5D48 A;  5JD2 A;  1GT5 A;  2WR6 A;  1VYF A;  3OD9 A;  3U0D A;  3GAQ A;  5LKE A;  1EQD A;  1P6P A;  2X8S A;  2IFB A;  1SWT A;  3K3L A;  4GH7 A;  4O3Z A;  4O3Y A;  5K67 A;  4ODD A;  2OL8 O;  2FKJ A;  4RUN A;  5HTD A;  2VDF A;  3PQS A;  3SLO A;  2RTP B;  4XMH A;  2X45 A;  1UYN X;  2RN4 A;  3EMM A;  1YUP A;  1E02 A;  4U8U M;  4ZCB A;  3ZW0 A;  4Z6J A;  3FA8 A;  1EPB A;  3C76 X;  3S26 A;  2GH7 A;  4HPD A;  2LB6 A;  2OZQ A;  3OBL A;  3F8A A;  5HWZ A;  4TKB A;  2OFB A;  4Y0S A;  1HMT A;  3ZUO A;  4O4U A;  1OEK A;  3WJC A;  3WVM A;  1TW4 A;  2IZK A;  2OF8 A;  4AW8 A;  1SLD B;  1MEP A;  2RTQ B;  1R0U A;  2JOZ A;  5IO5 A;  2E4J A;  2HZQ A;  2WSJ A;  2X4M A;  2ZSC A;  3D9W A;  3MBT A;  4I3D A;  5B10 O;  1VYO A;  4FBO A;  3WOV A;  1DZM A;  4QGX A;  3T1D A;  1Y9L A;  3FW5 A;  3SAO A;  3X00 A;  2GTL O;  2AKQ A;  1N0S A;  2ZAG A;  2AH7 X;  4ZHG A;  1DV9 A;  3IA8 A;  1A3Y A;  4WHI A;  4R0B A;  1ML7 A;  3TGA A;  1PEE A;  2OVA A;  4IRW A;  5HA1 A;  2JU8 A;  3ZZV A;  1SRI A;  2BS5 A;  1JIW I;  4CPI A;  2R56 A;  1ZNH A;  2ALL X;  4YH0 A;  1QY0 A;  1SA8 A;  1ZRY A;  4MVK A;  2MF6 A;  1AQB A;  1LCZ A;  4ZHF A;  1E2T A;  4LZV A;  1ZNK A;  3CMP A;  3MVF A;  5HZ9 A;  2G78 A;  3JQO A;  2GJ5 A;  4MVE A;  3CKF A;  2MWH A;  1A18 A;  1JJJ A;  2XKL A;  4O3X B;  2Y32 A;  1LFO A;  4A1H A;  1LDQ A;  1Y9T A;  3HTY A;  2AT8 X;  2Q4N A;  4ORX A;  1KGL A;  2IZE B;  4AZQ A;  1JQP A;  1LEL A;  4O4O A;  4BX5 A;  1BLR A;  3U9P C;  5AJB A;  3APV A;  4YFP A;  1B8E A;  1YWB A;  2G8C O;  1MDC A;  5C0N A;  2OVD A;  3RDS A;  1LNM A;  3O19 A;  4U8U O;  3RDQ A;  2QOS C;  2HKD A;  1H91 A;  3HWF A;  3PH5 A;  2IZG B;  1URE A;  1JYD A;  4OMW A;  4AZM A;  5B29 A;  5LJB A;  1KT4 A;  4IAX A;  4I95 A;  3EW2 A;  1SWO A;  2YMS A;  3PP6 A;  4EFG A;  5HA0 A;  4PSQ A;  2JU3 A;  4KC7 A;  1KT5 A;  2GC9 A;  1YP7 A;  4CDF A;  2RTK A;  1OSP O;  2UYW A;  2LBA A;  3C77 X;  5KHP A;  2OY8 A;  4QYP A;  5F7G A;  1N9M A;  3DTQ A;  4BX6 B;  4EQA C;  1HBQ A;  1SWF A;  1SY1 A;  3AKN A;  3B2H A;  1KQW A;  3PH6 A;  2FHN X;  1B56 A;  2FWV A;  1VWN B;  4QAE A;  2QO4 A;  3ZWE A;  4YFR A;  4GKC A;  3CQR A;  2QO5 A;  3ZI8 A;  1O1U A;  5LJC A;  1PTS A;  4Y5D A;  1SWN A;  4Z27 A;  4YGZ A;  4BCS A;  3S5X A;  3LHN A;  3B2J A;  1JJX A;  4AZN A;  1I78 A;  1UYO X;  5H9L A;  2IZD B;  3RWX A;  3WJF A;  4GE1 A;  2X56 A;  4KII A;  3HWE A;  1ERB A;  4ARH A;  1L6M A;  2KD2 A;  4OKA A;  2LBV A;  2OVS A;  3RDU A;  2BSZ A;  2CBS A;  4OEM A;  4FBR A;  2PI3 O;  1OEJ A;  4FQB B;  2RD7 C;  5JR8 A;  1X8N A;  2AT6 X;  1GT3 A;  2JW1 A;  1HMR A;  4QRL A;  3NQK A;  1QFT A;  5F6Z A;  2FT9 A;  2JMB A;  1DZJ A;  1ICM A;  1TXL A;  3MM0 A;  2IZL B;  1AVG I;  4YKO A;  5EZ2 A;  3UEX A;  1MM9 A;  1QG5 A;  1SY2 A;  1A57 A;  1BM5 A;  2VFC A;  5BVS A;  3ZW0 B;  4B55 A;  2F01 A;  3RDO A;  4TLJ A;  1SWP A;  3PPT A;  1KOI A;  1CBR A;  2A8G A;  4JNJ A;  4NV7 A;  3E3C A;  1UZ2 X;  4YFQ A;  1IFB A;  2ACO A;  2OY1 O;  3VHM A;  4XMG A;  2FR3 A;  4GET A;  2RTB B;  4YCH A;  2BT9 A;  3SLJ A;  5H9A A;  4IB9 A;  3NQ9 A;  1TOW A;  4IB7 A;  2Z4H A;  2RTO B;  2ZAI A;  1N4J A;  1EII A;  1PBY A;  2OFM X;  4FBV A;  1MVG A;  1VWA B;  4HWM A;  4KH8 A;  5FFH A;  5HAE A;  3FA9 A;  5EPQ A;  2G79 A;  4A8Z A;  4BJ8 A;  4CDE A;  1SWS A;  1WBI A;  5BYP A;  3N91 A;  3ZW2 A;  1D2U A;  4BX5 B;  1BWY A;  1STR B;  2A13 A;  3FEK A;  4I9R A;  4Y0P A;  1Y0G A;  4KC8 A;  2IZI A;  2AMM X;  1MX8 A;  2C1Q A;  4MIR A;  4DQ3 A;  2RTN B;  4JGL A;  1SWC A;  1VWO B;  4HFO A;  4NW4 A;  1Y52 X;  3T6F A;  4INN A;  1GX8 A;  1W5R A;  2X8T A;  1LDO A;  4M7M A;  3I17 A;  4TJZ A;  3KFH A;  1IJ8 A;  4GNW A;  1OPB A;  5K68 A;  4COT A;  2AVI A;  1SXY A;  4GDZ A;  4OS3 A;  3P6F A;  2OF9 A;  4HPA A;  2A2G A;  1CBQ A;  3P6C A;  4A1Y A;  5FEN A;  2OY5 O;  3NP1 A;  2Q2M A;  2RCT A;  1TVQ A;  1GXA A;  3O2Y A;  2Q2P A;  5B5F A;  2GTL N;  1I06 A;  4I3C A;  5D8J A;  1QFV A;  4ES7 A;  5L8O A;  5IO6 A;  1RLB E;  2PY1 A;  1RBP A;  4Y0Q A;  1YWC A;  3CBS A;  3SZI A;  5LJH A;  1Y53 X;  2IZF B;  4ON1 A;  3APW A;  1VWH B;  5HTE A;  5CHK A;  4RUU A;  4YDA A;  4KCA A;  5DG4 A;  1VWP B;  1QWD A;  1SXX A;  4ORU A;  4K19 A;  1Y55 X;  1OBQ A;  1SMP I;  3CQN A;  1SRE A;  4GGR A;  2KT4 B;  3HWG A;  1VWC B;  2HYS A;  4IB8 A;  4Y59 A;  2R73 A;  4ZFX A;  1NBX A;  3PK2 A;  3CR6 A;  1ADL A;  2FTB A;  2N93 A;  1T8V A;  1E5P A;  4HPB A;  5F2B A;  3S5V A;  3D95 A;  3FR2 A;  2I5V O;  1N9Y A;  3F6Z B;  4JHQ A;  3ZUI A;  3U03 A;  4TKH A;  4NYR A;  4ORR A;  4GUZ A;  3RY2 A;  2CM4 A;  2CM9 A;  1KL5 A;  1KT6 A;  1RSU B;  3TF6 A;  5HZ5 A;  4U46 A;  3FW4 A;  3WZN A;  1LIC A;  4AZO A;  2A5C A;  2Z4I A;  1IIU A;  2Y3F A;  3Q34 A;  1ZNE A;  4L1N A;  4NNT A; 
#chains in the Genus database with same CATH homology
 3NBX X;  2CZU A;  4U8U N;  4YBU A;  3FA6 A;  3WJE A;  2X46 A;  4IB6 A;  3KFI A;  3I0A A;  3VG2 A;  4TQ2 A;  5HCC C;  1G74 A;  1HN2 A;  2JU7 A;  1DFV A;  3P6H A;  3EM0 A;  2ANS A;  2FS6 A;  4OMX A;  2AT5 X;  3APU A;  3BU1 A;  2W2A A;  5HCE C;  4LQZ A;  4WFV A;  3BX7 A;  4WBK A;  4QNI A;  2POA A;  1DC9 A;  3ELX A;  5FQ8 E;  3ZQ3 A;  4ZJ0 A;  1S7D A;  2NNQ A;  2L9C A;  1D3S A;  4MIS A;  2RCQ A;  1LIF A;  4IAW A;  2BHV A;  2P8G A;  1BSQ A;  1FEN A;  1CBI A;  4LKP A;  3B2L A;  3HK1 A;  2EU7 X;  3PED A;  1EAL A;  2W2F A;  2FRS A;  4ZH6 A;  4QGW A;  3FLL A;  5F58 A;  2DM5 A;  5FQ7 E;  3FEP A;  4ORS A;  5EDC A;  5F6B A;  4ALB A;  3JS1 A;  4MVL A;  3GE2 A;  5F1E A;  2L5P A;  3TGC A;  3UEV A;  1ACD A;  1EI5 A;  3HOE A;  2HZR A;  1KT3 A;  3CWK A;  2FR2 A;  3EBW A;  4I9S A;  3ZW1 B;  5CYB A;  2ACP X;  3WXQ A;  4BVM A;  1EW3 A;  1OPA A;  1SY0 A;  2WQA E;  2WWP A;  4OS0 A;  3D4R A;  3UAQ A;  5B27 A;  3RSW A;  2A2U A;  1ALB A;  3BLG A;  3NX2 A;  2WQ9 A;  3KFG A;  2AT0 X;  1B0O A;  4D6B A;  4NP1 A;  5AQ6 A;  5LJG A;  2WUT A;  1GKA A;  2FLJ A;  1MUP A;  2FS7 A;  1X8P A;  5LJE A;  4N7D A;  1E00 A;  4AYH A;  4QQ1 A;  3KFF A;  3C78 X;  1KZX A;  4YKM A;  3S60 A;  4YMY A;  2WEW A;  4CSB A;  4ZHC A;  4NNS A;  4ID2 A;  1QQS A;  3APX A;  4NLJ A;  1AB0 A;  5L8N A;  1SXW A;  2MM3 A;  1E06 A;  3L4R A;  1NP1 A;  1IKE A;  2Q9S A;  3FEN A;  4KT5 A;  4LZU A;  3FIQ A;  1Z24 A;  4YDB A;  3VG7 A;  3RZY A;  4EEJ A;  1X8U A;  5EDB A;  3BDR A;  3B2K A;  3HOL A;  3RKG A;  5EED A;  4U3Q A;  3STM X;  4I6S A;  1FTP A;  1OBP A;  4XMD A;  1O1V A;  3H3I A;  2X8F A;  5HZ8 A;  1U18 A;  5KIC A;  1T68 X;  2L67 A;  4ML7 B;  3ZW1 A;  1U17 A;  3VPJ E;  1QY2 A;  1DZP A;  1YP6 A;  3PEC A;  3SOT A;  1GM6 A;  2QM9 A;  3VG6 A;  1ZND A;  1KQX A;  1LID A;  1SXU A;  4ZR2 A;  4O3W A;  3ELZ A;  1HBP A;  1LIB A;  4QZU A;  5LJK A;  2WEX A;  4O49 A;  1GT1 A;  4GRJ A;  4IMN A;  2HLV A;  1PM1 X;  2JN3 A;  4A60 A;  3PQU A;  1OBU A;  3MX7 A;  4OS8 A;  1BSY A;  4QZT A;  2MHD A;  1DF3 A;  1EXS A;  1EIO A;  5FQ6 E;  1GX9 A;  3KQ0 A;  1AEL A;  2QO6 A;  4O4S A;  1YIV A;  1S2P A;  2ASN X;  2KW1 A;  1NP4 A;  4QGV A;  1JZU A;  4YBP A;  1NGL A;  3OE3 A;  1CJ5 A;  4ZHH A;  2HMB A;  1G7N A;  2RQ0 A;  5D4A A;  1ZNL A;  1QY1 A;  5HZQ A;  1VYG A;  3TZS A;  3P6G A;  2HNX A;  2AL0 X;  2MJI A;  5HZ6 A;  1TOU A;  5EEE A;  3VG5 A;  4GK9 A;  3Q6L A;  1G5W A;  1JV4 A;  1T0V A;  4AZR A;  4ORY A;  3LV4 A;  2K62 A;  2OFR X;  1JBH A;  5LJD A;  3P6D A;  4U9C A;  1BJ7 A;  3RBY A;  2CZT A;  3BX8 A;  5KID A;  2R74 A;  3D97 A;  2F73 A;  4O4X A;  5H9K A;  3FR5 A;  4D6A A;  2MO5 A;  5K06 A;  1ERX A;  4NLI A;  3UEW A;  3HWD A;  1HMS A;  3FR4 A;  1GGL A;  1BBP A;  1A2D A;  5BVT A;  1HQP A;  4BQU A;  1I05 A;  3BU9 A;  3BSZ E;  1BRP A;  1X89 A;  2LFO A;  2W2B A;  1XCA A;  4EXZ A;  1O8V A;  1ZNG A;  3FYF A;  5IO7 A;  2NNE A;  4M6S A;  1EPA A;  4IBA A;  1GKA B;  3D96 A;  3O22 A;  3F9D A;  4GU8 A;  2YG2 A;  5FAZ A;  5D45 A;  3VU1 A;  2M4L A;  4CV7 A;  3NX1 A;  4YGG A;  1LKE A;  5H8T A;  3G7X A;  3STK A;  1PMP A;  5H9N A;  4CK4 A;  1FEM A;  1DZK A;  3WJB A;  4ZGU A;  1LPJ A;  1BSO A;  3BY0 A;  4K19 A;  2AT3 X;  1YWD A;  2LKK A;  1FE3 A;  4QYN A;  2G7B A;  1BRQ A;  4XME A;  2NP1 A;  4HPC A;  3NPO A;  3BS2 A;  3VE1 A;  2NND A;  1B4M A;  2GTF X;  3FA7 A;  4XMF A;  4UU3 A;  1S44 A;  4LKT A;  3WJG A;  1LF7 A;  3WBG A;  2K23 A;  4XMC A;  3VG3 A;  4YCE A;  4EDE A;  3NQ3 A;  4TKJ A;  2O62 A;  5L8I A;  3NAD A;  3CBC A;  3EYC A;  1IW2 A;  2L68 A;  1KXO A;  2OVE A;  4N7C A;  2BS6 A;  1U0X A;  2F09 A;  5DPQ A;  4GNY A;  5D47 A;  5CE4 A;  1PBO A;  1SY3 A;  2QMI A;  4TNN A;  4FGI B;  3STN A;  4MVI A;  1QAB E;  3TGB A;  1FDQ A;  3P02 A;  1X8Q A;  3NR3 A;  4UU2 A;  5HCD C;  4O9S A;  2LA7 A;  1IFC A;  4DQ4 A;  4Y0R A;  1X8O A;  3P24 A;  2RA6 A;  3UEU A;  1JYJ A;  1I04 A;  3FMZ A;  3VE2 A;  4PJ2 A;  1OEE A;  3FEL A;  4GZV A;  1LIE A;  4IMO A;  3DSZ A;  4L3R A;  1EUO A;  1IKJ A;  1G85 A;  2KTD A;  3AKM A;  3BRN A;  5AEO A;  4AZP A;  1BEB A;  3JSQ A;  3P6E A;  4ORW A;  1MX7 A;  1KZW A;  4BOE A;  1FEL A;  1I4U A;  1X71 A;  2A3F X;  2GTL M;  4NYQ A;  3B2I A;  3WJD A;  1ICN A;  4ZH9 A;  3QKG A;  4WFU A;  3VG4 A;  1XKI A;  1CBS A;  4IAB A;  2XST A;  4YGH A;  5LKF A;  3OJY C;  2BLG A;  1GT4 A;  3KZA A;  2KTS A;  4ZHD A;  4ZGF A;  4ALO A;  1CRB A;  1VPR A;  3EBK A;  2A0A A;  3V8U A;  1YWA A;  5AJC A;  2Q39 A;  1KT7 A;  5HBS A;  4I3B A;  2CBR A;  3IFB A;  5D48 A;  1GT5 A;  2WR6 A;  1VYF A;  3OD9 A;  3U0D A;  3GAQ A;  5LKE A;  1EQD A;  1P6P A;  2X8S A;  2IFB A;  3K3L A;  4GH7 A;  4O3Z A;  4O3Y A;  4ODD A;  4RUN A;  5HTD A;  3PQS A;  4XMH A;  2X45 A;  2RN4 A;  3EMM A;  1YUP A;  1E02 A;  4U8U M;  4ZCB A;  3ZW0 A;  3FA8 A;  1EPB A;  3C76 X;  3S26 A;  4HPD A;  2LB6 A;  2OZQ A;  3OBL A;  3F8A A;  5HWZ A;  4TKB A;  4Y0S A;  3ZUO A;  1HMT A;  4O4U A;  1OEK A;  3WJC A;  3WVM A;  1TW4 A;  4AW8 A;  5IO5 A;  1R0U A;  2JOZ A;  2E4J A;  2HZQ A;  2WSJ A;  4I3D A;  3MBT A;  4FBO A;  1DZM A;  4QGX A;  3T1D A;  1Y9L A;  3FW5 A;  3SAO A;  2GTL O;  2AKQ A;  1N0S A;  2ZAG A;  2AH7 X;  4ZHG A;  1DV9 A;  3IA8 A;  1A3Y A;  4WHI A;  4R0B A;  1ML7 A;  3TGA A;  1PEE A;  2OVA A;  3ZZV A;  5HA1 A;  2JU8 A;  2BS5 A;  1JIW I;  2R56 A;  1ZNH A;  2ALL X;  4YH0 A;  1QY0 A;  1SA8 A;  1ZRY A;  4MVK A;  1AQB A;  4ZHF A;  4LZV A;  1ZNK A;  3CMP A;  3MVF A;  5HZ9 A;  2G78 A;  3JQO A;  2GJ5 A;  4MVE A;  2MWH A;  1A18 A;  1JJJ A;  2XKL A;  4O3X B;  1LFO A;  4A1H A;  1Y9T A;  3HTY A;  2AT8 X;  2Q4N A;  4ORX A;  1KGL A;  4AZQ A;  4O4O A;  1BLR A;  3U9P C;  5AJB A;  3APV A;  4YFP A;  1B8E A;  1YWB A;  1MDC A;  5C0N A;  2OVD A;  1LNM A;  3O19 A;  4U8U O;  2QOS C;  3HWF A;  1H91 A;  4OMW A;  3PH5 A;  4AZM A;  1URE A;  1JYD A;  5B29 A;  5LJB A;  1KT4 A;  4IAX A;  4I95 A;  3PP6 A;  2YMS A;  4EFG A;  5HA0 A;  4PSQ A;  2JU3 A;  4KC7 A;  1KT5 A;  2GC9 A;  1YP7 A;  5KHP A;  2LBA A;  3C77 X;  4QYP A;  5F7G A;  3DTQ A;  4EQA C;  1HBQ A;  3AKN A;  1SY1 A;  3B2H A;  5BVQ A;  1KQW A;  3PH6 A;  3WOV A;  1B56 A;  2FWV A;  4QAE A;  3ZWE A;  2QO4 A;  4YFR A;  4GKC A;  3CQR A;  2QO5 A;  3ZI8 A;  1O1U A;  5LJC A;  4YGZ A;  3S5X A;  3LHN A;  3B2J A;  1JJX A;  4AZN A;  5H9L A;  3RWX A;  3WJF A;  4GE1 A;  4KII A;  4ARH A;  3HWE A;  1ERB A;  1L6M A;  2KD2 A;  2LBV A;  2OVS A;  2CBS A;  4FBR A;  1OEJ A;  4FQB B;  2RD7 C;  5JR8 A;  1X8N A;  2AT6 X;  1GT3 A;  2JW1 A;  1HMR A;  4QRL A;  3NQK A;  1QFT A;  5F6Z A;  2JMB A;  2FT9 A;  1DZJ A;  1ICM A;  1TXL A;  5EZ2 A;  1AVG I;  4YKO A;  3UEX A;  1A57 A;  1QG5 A;  1SY2 A;  1BM5 A;  5BVS A;  3ZW0 B;  4TLJ A;  3PPT A;  1KOI A;  1CBR A;  4YFQ A;  3E3C A;  1UZ2 X;  1IFB A;  2ACO A;  4XMG A;  2FR3 A;  4GET A;  4YCH A;  2BT9 A;  5H9A A;  4IB9 A;  3NQ9 A;  1TOW A;  4IB7 A;  2Z4H A;  2ZAI A;  1EII A;  4FBV A;  2OFM X;  1MVG A;  4HWM A;  4KH8 A;  5FFH A;  5HAE A;  3FA9 A;  5EPQ A;  2G79 A;  4A8Z A;  5BYP A;  3N91 A;  3ZW2 A;  1D2U A;  1BWY A;  2A13 A;  3FEK A;  4I9R A;  4Y0P A;  4KC8 A;  2AMM X;  1MX8 A;  4MIR A;  4DQ3 A;  4JGL A;  4HFO A;  4NW4 A;  4INN A;  1GX8 A;  4M7M A;  2X8T A;  4TJZ A;  3I17 A;  3KFH A;  4GNW A;  1OPB A;  4COT A;  1SXY A;  4GDZ A;  4OS3 A;  3P6F A;  4HPA A;  2A2G A;  1CBQ A;  3P6C A;  4A1Y A;  5FEN A;  3NP1 A;  2Q2M A;  2RCT A;  1TVQ A;  1GXA A;  3O2Y A;  2Q2P A;  2GTL N;  1I06 A;  4I3C A;  5D8J A;  1QFV A;  4ES7 A;  5L8O A;  5IO6 A;  1RLB E;  2PY1 A;  1RBP A;  4Y0Q A;  1YWC A;  3CBS A;  5LJH A;  4ON1 A;  3APW A;  5HTE A;  4RUU A;  4YDA A;  4KCA A;  5DG4 A;  1QWD A;  1SXX A;  4ORU A;  1OBQ A;  1SMP I;  3CQN A;  2KT4 B;  3HWG A;  4IB8 A;  2HYS A;  2R73 A;  4ZFX A;  3CR6 A;  1ADL A;  2FTB A;  2N93 A;  1T8V A;  1E5P A;  4HPB A;  3S5V A;  3D95 A;  3FR2 A;  3U03 A;  3F6Z B;  3ZUI A;  4TKH A;  4NYR A;  4ORR A;  2CM4 A;  2CM9 A;  1KT6 A;  3TF6 A;  5HZ5 A;  3FW4 A;  1LIC A;  4AZO A;  2Z4I A;  1IIU A;  1ZNE A;  4L1N A;  4NNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...