3U03A

The structure of human siderocalin bound to the bacterial siderophore pyochelin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
174
structure length
174
Chain Sequence
SDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Human Siderocalin bound to the bacterial siderophore pyochelin
rcsb
molecule keywords Neutrophil gelatinase-associated lipocalin
molecule tags Antimicrobial protein
source organism Homo sapiens
total genus 42
structure length 174
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3u03A00
4PSQA 4TKHA 4D6AA 4YGHA 1XKIA 3HK1A 1OBUA 2JU3A 3PECA 3TGBA 2RCTA 3GAQA 2JOZA 1MX8A 2GJ5A 1X8OA 3BSZE 2EU7X 4UU2A 4XMFA 1X71A 2FRSA 1D2UA 1YP6A 1QQSA 5HZ9A 3PH5A 3FEKA 1KQXA 1P6PA 4YH0A 4ZHGA 5HZ6A 1TOUA 3KFIA 2K62A 1IW2A 1ZNGA 2Q2MA 2K23A 4AZMA 4DQ4A 1LICA 1GKAA 4MVLA 4ALBA 2AT5X 4WBKA 4XMCA 5JR8A 4TKBA 3T1DA 4IB9A 1GT3A 3NX2A 4LZVA 5FFHA 2L67A 4TKJA 1YWAA 3B2JA 1I4UA 5H9NA 1ZNEA 1U0XA 3QKGA 3VG6A 2Q4NA 5HA0A 1YWDA 1SXXA 1EPAA 3EBKA 4GE1A 5HWZA 2GC9A 2CZTA 4UU3A 2ANSA 1X8UA 4YDAA 4ZHFA 5HCCC 1GT4A 1PMPA 1QWDA 2A2GA 4A8ZA 4AZNA 4QGVA 1O8VA 4YDBA 1ZNDA 2FR3A 1TXLA 5CE4A 2Q9SA 3P6DA 1EQDA 2JN3A 4YCEA 4A60A 4DQ3A 3BS2A 5LJDA 2RCQA 1NGLA 3DTQA 1CBIA 2NNQA 3PPTA 3FR4A 2F73A 3L4RA 1X89A 3O19A 3O2YA 3EMMA 1QY0A 3O22A 1YIVA 3Q6LA 3WXQA 3SAOA 5EEDA 2QM9A 1FENA 3CWKA 2LB6A 4ORRA 1KT4A 4A1YA 3CQNA 2IFBA 1A57A 3WJBA 1VYGA 2FR2A 4I3BA 2O62A 3WBGA 4HPDA 2LKKA 3TGAA 2X46A 3BDRA 3P6EA 5EDBA 1CRBA 4LKTA 5B27A 3APWA 2HYSA 4EFGA 1KZXA 2FLJA 2NNEA 1X8NA 1O1VA 4EDEA 4QGXA 1ICNA 4XMEA 5H8TA 3CMPA 1AELA 3CBCA 5D47A 1ADLA 1S44A 4ZFXA 4YKOA 1R0UA 4KIIA 3ZUOA 2LBAA 3FA6A 1HN2A 2Q39A 2A2UA 1JV4A 1IKJA 1SXWA 1MUPA 2HNXA 5H9KA 1X8QA 1TOWA 2HZRA 5HA1A 4Y0PA 4A1HA 2R74A 1ERBA 1QG5A 1HMSA 1BLRA 2AL0X 4ZH6A 4IAWA 1OEJA 4NYRA 4BOEA 5L8OA 1KOIA 1DF3A 2AH7X 4R0BA 2KT4B 4IMNA 3EYCA 4GNWA 5KICA 2HMBA 2L68A 1QABE 1LPJA 2KTDA 3WVMA 3B2HA 4I9SA 2A0AA 2G7BA 5EPQA 4ZGUA 2QO5A 2MO5A 1DZKA 1XCAA 4GRJA 4QYNA 5DPQA 4LKPA 4AZPA 1ICMA 4AW8A 1FE3A 3NQ9A 3UEXA 4ORYA 3TF6A 1YP7A 4M6SA 5FENA 4IB7A 1UREA 1GX9A 5IO7A 1RBPA 4ZHHA 1NP1A 1BRPA 3MBTA 1HMRA 4ZR2A 3KQ0A 4YFQA 2ACOA 3WJGA 3CR6A 5BVQA 2RA6A 3G7XA 1HBPA 1HMTA 3BU1A 1I06A 3FIQA 4AZQA 5KHPA 2PY1A 3WJEA 1IIUA 3FMZA 3KFHA 5D8JA 3UEUA 3FA7A 3STKA 3CQRA 3STNA 3P6CA 3RSWA 4O9SA 4QZUA 4YCHA 1SXUA 1S7DA 2RQ0A 1KT7A 2OVDA 3APVA 2L9CA 3FA8A 3B2KA 4QZTA 3NP1A 3I0AA 5HZ8A 3PH6A 4EEJA 2HLVA 5D4AA 4AZOA 1EALA 2A13A 4HPCA 3VG5A 3KFFA 4OMWA 1BSQA 1T8VA 1LIFA 3PEDA 2JU8A 1BEBA 4BQUA 1LNMA 1A2DA 1FTPA 1KT5A 3ELZA 1JYJA 2WUTA 3HWFA 3ELXA 4XMGA 3HWEA 1BJ7A 4XMHA 2AT6X 4YGGA 5F6ZA 1QFVA 1OEEA 2XSTA 4D6BA 4Y0QA 3BRNA 5IO6A 2WEWA 5L8NA 1LIBA 2OVAA 1TW4A 5F58A 2AT3X 3BU9A 2X45A 5F1EA 2AMMX 3APUA 3VG7A 2OZQA 2WQAE 2MM3A 5HCEC 3U03A 4AYHA 3P6FA 1GT5A 1Z24A 1RLBE 5LKFA 1NP4A 4WFVA 4NYQA 1OEKA 1CJ5A 4OS3A 1GT1A 1FDQA 1VPRA 3CBSA 4GNYA 1LIEA 5K06A 1CBRA 4IAXA 3K3LA 3I17A 4ORWA 1SXYA 4NNSA 4ZCBA 4QGWA 3AKMA 1T0VA 3ZUIA 5F6BA 4HFOA 2FTBA 4ALOA 4ZJ0A 1GX8A 3WJDA 1SA8A 2OFRX 2XKLA 4I3CA 4LZUA 3FA9A 2WR6A 2FWVA 4YBPA 5D48A 3AKNA 3D95A 4QYPA 1GKAB 1LFOA 1D3SA 1B8EA 2ALLX 4ORXA 4IMOA 1LF7A 1UZ2X 1DV9A 1HQPA 1KQWA 1EPBA 2NNDA 5HBSA 4TQ2A 1IKEA 1CBSA 1YWCA 1EUOA 2Q2PA 5D45A 1FEMA 2ACPX 5H9LA 1T68X 3B2LA 2G79A 3BX7A 3NPOA 5HAEA 1PBOA 3S26A 5C0NA 2RD7C 4GH7A 2BLGA 4I9RA 3D96A 5LJHA 1BBPA 1S2PA 1G5WA 3FENA 3P6HA 3VG4A 4RUNA 4ZHCA 4I3DA 1ML7A 1DZMA 3FW5A 1H91A 3KFGA 1JJXA 1MVGA 1ERXA 1BM5A 3IA8A 4OMXA 1OPAA 4K19A 4NLJA 3NR3A 1SY0A 3NX1A 2NP1A 4GKCA 3JSQA 3VG2A 4M7MA 5B29A 2WWPA 1AQBA 4ARHA 1SY3A 2LBVA 5LJBA 1L6MA 2HZQA 2WEXA 5DG4A 1BSYA 5LJGA 4GETA 2QO6A 4XMDA 1BSOA 3VG3A 3ZQ3A 2LFOA 4YBUA 4N7DA 5AQ6A 1X8PA 1PM1X 3WJFA 1JZUA 3C78X 1BWYA 2YG2A 3U9PC 2L5PA 1OBQA 2N93A 1ZNLA 4N7CA 1AB0A 2OVEA 3BY0A 5F7GA 1N0SA 1SY1A 1A18A 4Y0RA 2AKQA 3HWDA 1ZNHA 1LIDA 3BX8A 5KIDA 1JBHA 3RZYA 3TZSA 3FR5A 3FW4A 1GXAA 1ACDA 3STMX 1GGLA 2W2BA 1G74A 1EXSA 1OPBA 2G78A 1IFCA 3F8AA 4AZRA 2QO4A 5HCDC 1B4MA 5HZ5A 2CM9A 5LKEA 3EBWA 1PEEA 4TJZA 2E4JA 3C77X 1DC9A 3NADA 4Y0SA 5FAZA 1B0OA 1U18A 2POAA 1G85A 1MX7A 2R56A 4OS8A 1BRQA 5HTDA 4RUUA 3U0DA 4MVKA 2A3FX 5EZ2A 1CBQA 1YWBA 5LJKA 1SY2A 3F9DA 5LJCA 2CM4A 1VYFA 1EIOA 1E02A 1LKEA 4ODDA 1MDCA 1QY1A 4HPAA 5IO5A 3UEVA 2FS6A 2QOSC 4BVMA 1DZJA 4MVIA 1A3YA 1KGLA 1QFTA 1DFVA 1AVGI 1E00A 2R73A 4HPBA 3TGCA 1YUPA 3B2IA 2WQ9A 5BVSA 1FELA 3JS1A 5H9AA 2JU7A 5EEEA 4ES7A 1EW3A 5HTEA 4ZHDA 1QY2A 2P8GA 4YGZA 2WSJA 4IB6A 2GTFX 1EIIA 3HWGA 3FLLA 4NNTA 1U17A 3NQ3A 3P6GA 2W2AA 3IFBA 2DM5A 5BVTA 4ZH9A 1JJJA 2ASNX 3FR2A 4NP1A 4CK4A 1GM6A 1KT3A 2OFMX 3DSZA 5EDCA 1ZNKA 1B56A 3C76X 4QAEA 1KT6A 1E5PA 1OBPA 3MVFA 4TLJA 1ZRYA 1KXOA 2AT0X 2W2FA 1O1UA 2CBRA 1E06A 5LJEA 3PP6A 1ALBA 3D97A 3UEWA 2AT8X 4YKMA 3FEPA 1HBQA 2FT9A 1I04A 3BLGA 3KZAA 3WJCA 4WFUA 1JYDA 3OJYC 4IB8A 4OS0A 4NLIA 4YFRA 1IFBA 2FS7A 4IBAA 1TVQA 3APXA 4EXZA 1KZWA 5HZQA 2MJIA 2CZUA 1DZPA 4ORUA 4YFPA 3FELA 1I05A 4YMYA 1G7NA 5L8IA 4ORSA 4TNNA 3EM0A 2CBSA
chains in the Genus database with same CATH superfamily
4PSQA 4TKHA 4D6AA 4O49A 4YGHA 1XKIA 2OY7A 2OVSA 3HK1A 1OBUA 2IZJA 2IZIA 2JU3A 2RCTA 1SLEB 3PECA 2A5CA 3GAQA 2RTMA 4INNA 1SWHA 1MOYA 2JOZA 2OFBA 1NC9A 1MX8A 2GJ5A 4Y59A 1X8OA 2RTQB 2EU7X 3BSZE 4UU2A 1X71A 2FRSA 4XMFA 3VU1A 1D2UA 1YP6A 1QQSA 5HZ9A 2JMBA 3PH5A 2BS5A 3FEKA 3EC5A 1KQXA 1P6PA 1NDJA 1SWCA 4YH0A 4ZHGA 3N91A 1LDQA 1TOUA 1VWOB 3KFIA 4CV7A 5HZ6A 1GX3A 2K62A 2OF9A 2KW1A 3VE1A 1IW2A 1ZNGA 2Q2MA 2K23A 3FIDA 1LUQA 4AZMA 4DQ4A 1LICA 1JMXA 1GKAA 4MVLA 4ALBA 1SWPA 2Z4HA 2AT5X 4WBKA 4XMCA 5JR8A 4O3XB 4U46A 4TKBA 4IABA 2RTNB 4IB9A 1GT3A 3NX2A 4LZVA 5FFHA 3T1DA 2L67A 4MEEA 4TKJA 1YWAA 1SRFA 3B2JA 1I4UA 4CPIA 5H9NA 4Z2VA 1ZNEA 1U0XA 3QKGA 3VG6A 2Q4NA 5HA0A 3V8UA 1YWDA 1SXXA 1EPAA 3EBKA 4GE1A 1PTSA 1UYOX 2CZTA 2GC9A 4UU3A 2ANSA 2BS6A 1X8UA 4YDAA 4ZHFA 5HCCC 4O3YA 1GT4A 3H3IA 1PMPA 1QWDA 2A2GA 4U8UO 4A8ZA 4AZNA 1SLDB 1SRGA 4QGVA 1O8VA 4YDBA 3ZWEA 1ZNDA 2FR3A 1TXLA 5CE4A 1VWBB 2Q9SA 3P6DA 4FBOA 1EQDA 2JN3A 1VWPB 4YCEA 4A60A 4DQ3A 3BS2A 5LJDA 2RCQA 3T6FA 1NGLA 3DTQA 1CBIA 2NNQA 3PPTA 3FR4A 2BC3A 2F73A 3RDMA 1WUBA 2IZBA 1VYOA 3L4RA 2OFAA 4ON1A 3RKGA 3VGWA 1X89A 3O19A 3O2YA 3RY2A 3EMMA 1QY0A 3O22A 3WZQA 1YIVA 3Q6LA 4MIRA 2RTOB 3WXQA 3SAOA 5EEDA 2QM9A 1KFFA 1FENA 3CWKA 2LB6A 2PI3O 3KVNA 4ORRA 4O3ZA 1KT4A 3RDXA 4A1YA 3CQNA 1VWIB 1N9MA 2IFBA 1A57A 2ZSCA 3WJBA 1VYGA 2FR2A 4I3BA 1RXHA 2O62A 4MVEA 4KT5A 4HPDA 3WBGA 2LKKA 3TGAA 2X46A 3BDRA 3P6EA 5EDBA 1CRBA 1NQMA 4LKTA 5B27A 1SMPI 3APWA 2HYSA 3LHNA 4EFGA 1KZXA 3TGBA 2FLJA 2NNEA 3WZNA 1X8NA 3X00A 1O1VA 4EDEA 4QGXA 1SWJA 3CKFA 1ICNA 4XMEA 3PQUA 5H8TA 3CMPA 1AELA 3CBCA 5D47A 1ADLA 1S44A 1SWRA 3HOLA 4ZFXA 3GE2A 4YKOA 1R0UA 3SLTA 4KIIA 2VFBA 2UYWA 3ZUOA 2LBAA 3FA6A 1HN2A 2Q39A 2DJFA 5JD2A 3VHMA 2A2UA 1JV4A 1IKJA 1SXWA 2Y3EA 1K24A 1MUPA 4JNJA 2HNXA 1Y53X 1NQNA 5H9KA 4GU8A 1X8QA 1TOWA 2HZRA 5HA1A 4Y0PA 4A1HA 3S5VA 4BJ8A 3HPEA 2R74A 2RN4A 4BBOA 3HTYA 1ERBA 1QG5A 3MX7A 5B3MO 1HMSA 1STRB 1VWRB 1BLRA 2AL0X 4ZH6A 4U8UN 4FBVA 1OEJA 4IAWA 4GJVA 4NYRA 4Y5DA 4BOEA 4CPHB 5L8OA 1KOIA 1DF3A 1MM9A 1WBIA 3HOEA 5B11O 2IZFB 2OF8A 3OE3A 4GDZA 2AH7X 4R0BA 2KT4B 4CDEA 4IMNA 3EYCA 4GNWA 5KICA 2HMBA 1W4TA 2L68A 1QABE 2ZAGA 1LPJA 2KTDA 3WVMA 4DCBA 3B2HA 1SWTA 4CSBA 4I9SA 2A0AA 2G7BA 5EPQA 2G8CO 2OL6O 4ZGUA 1HY2A 2QO5A 1DF8A 1VWKB 2MO5A 1DZKA 2GH7A 1VWHB 1XCAA 4GRJA 4QYNA 5DPQA 4LKPA 5B2AO 3RBYA 4AZPA 4BX5A 4EKVA 1ICMA 2CAMA 2JW1A 4AW8A 1I78A 1FE3A 3NQ9A 4I95A 4O4SA 5IRAA 3UEXA 1RXJA 3ZI8A 3LV4A 4ORYA 3RDQA 3TF6A 2X34A 1HXLA 1YP7A 4M6SA 5FENA 4IB7A 1UREA 1GX9A 1JQPA 1RBPA 4ZHHA 5IO7A 1NP1A 2RTRB 1BRPA 3MBTA 1HMRA 4ZR2A 4EQAC 3KQ0A 4FQBB 3SOTA 4YFQA 2ACOA 4O3WA 3CR6A 5BVQA 2RA6A 3G7XA 3WJGA 1HBPA 1HMTA 3BU1A 1I06A 3FIQA 4AZQA 5KHPA 2PY1A 3MM0A 5IXGA 3WJEA 1IIUA 2RTGB 3FMZA 3KFHA 5D8JA 3UEUA 2MF6A 3FA7A 5IRUA 3STKA 4CPFA 4PJ2A 2IZHB 3CQRA 3STNA 3P6CA 3RSWA 4O9SA 2X32A 4QZUA 4YCHA 4Z6JA 1SXUA 1S7DA 2BSZA 2RQ0A 1KT7A 2OVDA 3APVA 2L9CA 4BX7B 3FA8A 3B2KA 1Y52X 2RTHB 3RDOA 4QZTA 3NP1A 3I0AA 5HZ8A 1SRHA 3PH6A 3RDSA 5B5FA 4EEJA 2HLVA 2IZGB 5D4AA 4AZOA 3OD9A 1EALA 2A13A 4HPCA 3VG5A 3KFFA 5CYBA 3RDUA 4OMWA 1BSQA 5FQ6E 1T8VA 1LIFA 3PEDA 2JU8A 1BEBA 1VWGB 2GTLM 1LNMA 1KL3A 1A2DA 1FTPA 2KD2A 1KT5A 4QQ1A 3ELZA 4BQUA 5CSEA 1JYJA 2WUTA 3VE2A 4LQZA 3HWFA 3ELXA 4XMGA 3Q34A 3HWEA 1BJ7A 4GD9A 3ZW1A 4NV8A 4XMHA 2AT6X 2MHDA 4YGGA 3NBXX 5F6ZA 1QFVA 2FKGA 1SWOA 1OEEA 4QRLA 2XSTA 4D6BA 4Y0QA 3BRNA 1SWBA 5IO6A 2WEWA 1OSPO 5L8NA 4WHIA 3D9WA 1LIBA 2OVAA 1TW4A 2IZLB 5F58A 1FJ1E 4L3RA 2X56A 4CPHA 2AT3X 3BU9A 2X45A 5F1EA 2AMMX 3APUA 2X8SA 3VG7A 1PBYA 2OZQA 2WQAE 2MM3A 5HCEC 4BX6A 1SWDA 3U03A 2QMIA 4GDAA 4AYHA 3P6FA 1GT5A 2VDFA 2OL7A 1VWEB 4NV7A 1Z24A 1AVDA 4L1NA 1HQQA 4ML7B 1RLBE 3WZPA 4GGZA 5LKFA 1NP4A 1SWFA 4WFVA 2X8TA 4NW4A 3S60A 4NYQA 1OEKA 1CJ5A 3P24A 4OS3A 1GT1A 1VWQB 1FDQA 1VPRA 3CBSA 4OELA 1SRIA 1LIEA 4GNYA 4KH8A 5K06A 2FHLA 2JGSA 5F2BA 1CBRA 1E2TA 3K3LA 4IAXA 3I17A 4ORWA 1SXYA 4NNSA 4ZCBA 2OY1O 4QGWA 3AKMA 1T0VA 2WPUA 1Y0GA 3ZUIA 5F6BA 4HFOA 1JIWI 4CDCA 2FTBA 4ALOA 1LCVA 3VHHA 2A5BA 1VWMB 4ZJ0A 2M4LA 3T6LA 1GX8A 3WJDA 1SA8A 2OFRX 2XKLA 4I3CA 4LZUA 3FA9A 1SLGB 2FWVA 1EI5A 2WR6A 1VWCB 4YBPA 2UZ2A 5D48A 2QOMA 3AKNA 3D95A 4QYPA 4FBRA 3SZIA 5AJBA 1GKAB 1LFOA 1D3SA 1B8EA 2ALLX 2FKJA 4ORXA 4IMOA 2OYBO 1LF7A 2C1SA 1UZ2X 1DV9A 2C1QA 2IZAA 1HQPA 1KQWA 1EPBA 2NNDA 1KL4A 5HBSA 1LCZA 1VWDB 4KCAA 4TQ2A 1IKEA 4TNNA 1CBSA 4YVBA 1YWCA 1EUOA 3JQOA 2Q2PA 5D45A 1FEMA 2ACPX 4Z2PA 4O4XA 2Y3FA 1T68X 5H9LA 4JHQA 3B2LA 2G79A 3BX7A 3NPOA 4B55A 5HAEA 1PBOA 1SWEA 3S26A 3AEHA 5C0NA 2RTKA 2RD7C 4GH7A 2BLGA 2IZDB 4I9RA 3D96A 4U3QA 5LJHA 1BBPA 1S2PA 1G5WA 1MEPA 3FENA 3P6HA 3VG4A 4RUNA 4ZHCA 1UYNX 2VFCA 4I3DA 1ML7A 1DZMA 3FW5A 1H91A 3CKGA 2RTJA 1MVGA 1ERXA 3KFGA 1BM5A 1JJXA 3IA8A 3PQSA 4I60A 4OMXA 1OPAA 4K19A 4NLJA 3NR3A 3PK2A 3QQ2A 4FGIB 4C5PA 4QNIA 1SY0A 3NX1A 2NP1A 4GKCA 3JSQA 3VG2A 1STPA 4M7MA 1JJUA 2WWPA 5B29A 1AQBA 4ARHA 1SY3A 2LBVA 5LJBA 4GUZA 2AF5A 1IJ8A 1L6MA 2HZQA 2WEXA 3NQKA 5DG4A 1BSYA 1Y55X 2ZAIA 5LJGA 4GETA 2QO6A 4XMDA 1BSOA 3VG3A 3ZQ3A 2IZEB 2LFOA 4YBUA 4N7DA 3D4RA 5B5GA 2X4MA 3P02A 1X8PA 1PM1X 5AQ6A 3WJFA 3WYQA 1JZUA 3C78X 1BWYA 1Y9TA 2AVIA 2L5PA 1OBQA 2YG2A 4KC8A 3U9PC 4IRWA 2N93A 2RTEB 4U8UM 3VHIA 4CPEA 5IRWA 3LTWA 2BHVA 1ZNLA 1RXKA 1SRJA 3EW2A 1LDOA 3E3CA 4N7CA 1AB0A 3ZW0B 5AEOA 2OVEA 3BY0A 3OBLA 5F7GA 4GZVA 1N0SA 1RSUB 1SY1A 1A18A 4Y0RA 2AKQA 2FGSA 1Y9LA 3HWDA 2I5ZO 1ZNHA 1LIDA 3BX8A 3SZJA 3ZW2A 1LELA 5KIDA 1JBHA 1VWLB 2RTBB 3MG5A 3RZYA 3TZSA 2YMSA 3FR5A 1VWJB 3FW4A 1GXAA 1ACDA 3STMX 1GGLA 1G74A 1EXSA 2W2BA 1OPBA 3WZOA 2FHNX 4COTA 2G78A 1IFCA 3F8AA 4AZRA 2BT9A 2QO4A 5HCDC 3FYFA 4GGRA 2HKDA 1B4MA 5HZ5A 1SWUA 2CM9A 4ID2A 3EBWA 5LKEA 1PEEA 4TJZA 2E4JA 3C77X 2X8FA 1DC9A 3NADA 4Y0SA 5FAZA 1B0OA 1U18A 2MWHA 2POAA 3T2XA 1G85A 1MX7A 3RY1A 1N9YA 2R56A 4OS8A 2Z4IA 1BRQA 2I5VO 3AUMO 4Z2OA 3T2WA 5HTDA 4RUUA 4O4UA 4I6SA 1N7YA 3U0DA 3PDFA 4Z27A 1N4JA 3FDCA 2OL8O 4MVKA 2A3FX 1W6FA 5EZ2A 5L3YA 1SWLA 4BX5B 1CBQA 1JMZA 1YWBA 4CDDA 4BGFA 5LJKA 1SY2A 3EW1A 3F9DA 2CM4A 2OY8A 5LJCA 4OEMA 4HWMA 3SLOA 2RTIB 1VYFA 4O4OA 3RE6A 1EIOA 1E02A 1LKEA 4ODDA 2DJGA 4JO6A 1MDCA 1QY1A 2GTLO 1SWSA 4HPAA 1SWGA 3VPJE 5IO5A 3UEVA 2FS6A 1W5RA 3WOVA 2QOSC 5FQ7E 1AVEA 4BVMA 1DZJA 4MVIA 1A3YA 1KGLA 1QFTA 5CHKA 1DFVA 1MK5A 1AVGI 1SWQA 1E00A 1RSTB 2R73A 5FQ8E 4HPBA 5BYPA 3TGCA 1YUPA 3B2IA 2WQ9A 3ZZVA 1NBXA 2G5LA 5BVSA 1FELA 4GK9A 3JS1A 5K68A 1VWAB 5H9AA 2JU7A 5EEEA 3S5XA 4ES7A 2QCBA 1SWAA 2Y32A 1KL5A 1EW3A 5HTEA 1VWFB 2RTFB 3ZW0A 4BX7A 4ZHDA 1QY2A 2A8GA 2P8GA 2RTDB 2X55A 4YGZA 3RE5A 2F09A 2F01A 2GTFX 2WSJA 4GJSA 4IB6A 1EIIA 1SWNA 3HWGA 3FLLA 1K3BA 2RTAA 4NNTA 4U9CA 1U17A 3NQ3A 3P6GA 4Z28A 2W2AA 4CDFA 3IFBA 2DM5A 1RAVA 5BVTA 4ZH9A 1JJJA 2ASNX 3FR2A 4NP1A 2RTCB 4JGLA 4CK4A 4MISA 1GM6A 4ZGFA 1KT3A 2OFMX 4GGTA 3DSZA 3ZW1B 5EDCA 1ZNKA 4KC7A 1B56A 3F6ZB 3C76X 4QAEA 2IZCB 1KT6A 2RTPB 1E5PA 1OBPA 1LCWA 2RTLA 3MVFA 4TLJA 1ZRYA 1KXOA 2AT0X 2W2FA 2LA7A 3SZHA 1KZWA 3SLJA 1O1UA 2CBRA 1E06A 3UAQA 5LJEA 5B10O 3PP6A 1ALBA 3D97A 3UEWA 2AT8X 4OKAA 5AJCA 4BX6B 4YKMA 3FEPA 1HBQA 2FT9A 1I04A 3WYPA 3BLGA 3KZAA 3WJCA 4WFUA 1JYDA 4DNEA 5K67A 3OJYC 4IB8A 1STSB 4NLIA 2IZKA 4OS0A 1IFBA 2FS7A 2OY5O 4IBAA 1TVQA 4YFRA 3RWXA 1HXZA 3APXA 1SWKA 4EXZA 1I9HA 2C4IA 2MJIA 2CZUA 1DZPA 1VWNB 4ORUA 2KTSA 5HZQA 4YFPA 2GTLN 3FELA 4BCSA 1I05A 1SREA 4YMYA 5HWZA 1G7NA 5L8IA 4ORSA 1SLFB 1N43A 3EM0A 2CBSA
chains in the Genus database with same CATH topology
4PSQA 4TKHA 4D6AA 4O49A 4YGHA 1XKIA 2OVSA 3HK1A 1OBUA 2JU3A 3PECA 3TGBA 2RCTA 3GAQA 4INNA 2JOZA 1MX8A 2GJ5A 1X8OA 3BSZE 2EU7X 4UU2A 4XMFA 1X71A 2FRSA 3VU1A 1D2UA 1YP6A 1QQSA 5HZ9A 2JMBA 3PH5A 2BS5A 3FEKA 1KQXA 1P6PA 4YH0A 4ZHGA 3N91A 5HZ6A 1TOUA 4CV7A 3KFIA 2K62A 2KW1A 3VE1A 1IW2A 1ZNGA 2Q2MA 2K23A 4AZMA 4DQ4A 1LICA 1GKAA 4MVLA 4ALBA 2Z4HA 2AT5X 4WBKA 4XMCA 5JR8A 4O3XB 4TKBA 4IABA 3T1DA 4IB9A 1GT3A 3NX2A 4LZVA 5FFHA 2L67A 4TKJA 1YWAA 3B2JA 1I4UA 5H9NA 1ZNEA 1U0XA 3QKGA 3VG6A 2Q4NA 5HA0A 3V8UA 1YWDA 1SXXA 1EPAA 3EBKA 4GE1A 5HWZA 2GC9A 2CZTA 4UU3A 2ANSA 2BS6A 1X8UA 4YDAA 4ZHFA 5HCCC 4O3YA 1GT4A 3H3IA 1PMPA 1QWDA 2A2GA 4U8UO 4A8ZA 4AZNA 4QGVA 1O8VA 4YDBA 3ZWEA 1ZNDA 2FR3A 1TXLA 5CE4A 2Q9SA 3P6DA 4FBOA 1EQDA 2JN3A 4YCEA 4A60A 4DQ3A 3BS2A 5LJDA 2RCQA 1NGLA 3DTQA 1CBIA 2NNQA 3PPTA 3FR4A 2F73A 3L4RA 4ON1A 3RKGA 1X89A 3O19A 3O2YA 3EMMA 1QY0A 3O22A 1YIVA 3Q6LA 4MIRA 3WXQA 3SAOA 5EEDA 2QM9A 1FENA 3CWKA 2LB6A 4ORRA 4O3ZA 1KT4A 4A1YA 3CQNA 2IFBA 1A57A 3WJBA 1VYGA 2FR2A 4I3BA 2O62A 4MVEA 4KT5A 4HPDA 3WBGA 2LKKA 3TGAA 2X46A 3BDRA 3P6EA 5EDBA 1CRBA 4LKTA 5B27A 1SMPI 3APWA 2HYSA 3LHNA 4EFGA 1KZXA 2FLJA 2NNEA 1X8NA 1O1VA 4EDEA 4QGXA 1ICNA 4XMEA 3PQUA 5H8TA 3CMPA 1AELA 3CBCA 5D47A 1ADLA 1S44A 3HOLA 4ZFXA 3GE2A 4YKOA 1R0UA 4KIIA 3ZUOA 2LBAA 3FA6A 1HN2A 2Q39A 2A2UA 1JV4A 1IKJA 1SXWA 1MUPA 2HNXA 5H9KA 4GU8A 1X8QA 1TOWA 2HZRA 5HA1A 4Y0PA 4A1HA 3S5VA 2R74A 2RN4A 3HTYA 1ERBA 1QG5A 3MX7A 1HMSA 1BLRA 2AL0X 4ZH6A 4U8UN 4FBVA 1OEJA 4IAWA 4NYRA 4BOEA 5L8OA 1KOIA 1DF3A 3HOEA 4GDZA 3OE3A 2AH7X 4R0BA 2KT4B 4IMNA 3EYCA 4GNWA 5KICA 2HMBA 2L68A 1QABE 2ZAGA 1LPJA 2KTDA 3WVMA 3B2HA 4CSBA 4I9SA 2A0AA 2G7BA 5EPQA 4ZGUA 2QO5A 2MO5A 1DZKA 1XCAA 4GRJA 4QYNA 5DPQA 4LKPA 3RBYA 4AZPA 1ICMA 2JW1A 4AW8A 1FE3A 3NQ9A 4I95A 4O4SA 3UEXA 3ZI8A 3LV4A 4ORYA 3TF6A 1YP7A 4M6SA 5FENA 4IB7A 1UREA 1GX9A 5IO7A 1RBPA 4ZHHA 1NP1A 1BRPA 3MBTA 1HMRA 4ZR2A 4EQAC 3KQ0A 4FQBB 3SOTA 4YFQA 2ACOA 4O3WA 3CR6A 5BVQA 2RA6A 3G7XA 3WJGA 1HBPA 1HMTA 3BU1A 1I06A 3FIQA 4AZQA 5KHPA 2PY1A 3WJEA 1IIUA 3FMZA 3KFHA 5D8JA 3UEUA 3FA7A 3STKA 4PJ2A 3CQRA 3STNA 3P6CA 3RSWA 4O9SA 4QZUA 4YCHA 1SXUA 1S7DA 2RQ0A 1KT7A 2OVDA 3APVA 2L9CA 3FA8A 3B2KA 4QZTA 3NP1A 3I0AA 5HZ8A 3PH6A 4EEJA 2HLVA 5D4AA 4AZOA 3OD9A 1EALA 2A13A 4HPCA 3VG5A 3KFFA 5CYBA 4OMWA 1BSQA 5FQ6E 1T8VA 1LIFA 3PEDA 2JU8A 1BEBA 2GTLM 4BQUA 1LNMA 1A2DA 1FTPA 2KD2A 1KT5A 4QQ1A 3ELZA 1JYJA 2WUTA 3VE2A 4LQZA 3HWFA 3ELXA 4XMGA 3HWEA 1BJ7A 3ZW1A 4XMHA 2AT6X 2MHDA 4YGGA 3NBXX 5F6ZA 1QFVA 1OEEA 4QRLA 2XSTA 4D6BA 4Y0QA 3BRNA 5IO6A 2WEWA 5L8NA 4WHIA 1LIBA 2OVAA 1TW4A 5F58A 4L3RA 2AT3X 3BU9A 2X45A 5F1EA 2AMMX 3APUA 2X8SA 3VG7A 2OZQA 2WQAE 2MM3A 5HCEC 3U03A 2QMIA 4AYHA 3P6FA 1GT5A 1Z24A 4L1NA 4ML7B 1RLBE 5LKFA 1NP4A 4WFVA 2X8TA 4NW4A 3S60A 4NYQA 1OEKA 1CJ5A 3P24A 4OS3A 1GT1A 1FDQA 1VPRA 3CBSA 4GNYA 1LIEA 4KH8A 5K06A 1CBRA 4IAXA 3K3LA 3I17A 4ORWA 1SXYA 4NNSA 4ZCBA 4QGWA 3AKMA 1T0VA 3ZUIA 5F6BA 4HFOA 1JIWI 2FTBA 4ALOA 4ZJ0A 2M4LA 1GX8A 3WJDA 1SA8A 2OFRX 2XKLA 4I3CA 4LZUA 3FA9A 2WR6A 2FWVA 1EI5A 4YBPA 5D48A 3AKNA 3D95A 4QYPA 4FBRA 5AJBA 1GKAB 1LFOA 1D3SA 1B8EA 2ALLX 4ORXA 4IMOA 1LF7A 1UZ2X 1DV9A 1HQPA 1KQWA 1EPBA 2NNDA 5HBSA 4KCAA 4TQ2A 1IKEA 1CBSA 1YWCA 1EUOA 3JQOA 2Q2PA 5D45A 1FEMA 2ACPX 4O4XA 5H9LA 1T68X 3B2LA 2G79A 3BX7A 3NPOA 5HAEA 1PBOA 3S26A 5C0NA 2RD7C 4GH7A 2BLGA 4I9RA 3D96A 4U3QA 5LJHA 1BBPA 1S2PA 1G5WA 3FENA 3P6HA 3VG4A 4RUNA 4ZHCA 4I3DA 1ML7A 1DZMA 3FW5A 1H91A 3KFGA 1JJXA 1MVGA 1ERXA 1BM5A 3IA8A 3PQSA 4OMXA 1OPAA 4K19A 4NLJA 3NR3A 4FGIB 4QNIA 1SY0A 3NX1A 2NP1A 4GKCA 3JSQA 3VG2A 4M7MA 5B29A 2WWPA 1AQBA 4ARHA 1SY3A 2LBVA 5LJBA 1L6MA 2HZQA 2WEXA 3NQKA 5DG4A 1BSYA 2ZAIA 5LJGA 4GETA 2QO6A 4XMDA 1BSOA 3VG3A 3ZQ3A 2LFOA 4YBUA 4N7DA 3D4RA 5AQ6A 3P02A 1X8PA 1PM1X 3WJFA 1JZUA 3C78X 1BWYA 1Y9TA 2YG2A 2L5PA 1OBQA 3U9PC 4KC8A 4U8UM 2N93A 2BHVA 1ZNLA 4N7CA 3ZW0B 3E3CA 5AEOA 1AB0A 2OVEA 3BY0A 3OBLA 5F7GA 4GZVA 1N0SA 1SY1A 1A18A 4Y0RA 2AKQA 3HWDA 1Y9LA 1ZNHA 1LIDA 3BX8A 3ZW2A 5KIDA 1JBHA 3RZYA 3TZSA 2YMSA 3FR5A 3FW4A 1GXAA 1ACDA 3STMX 1GGLA 1G74A 1EXSA 2W2BA 1OPBA 4COTA 2G78A 1IFCA 3F8AA 4AZRA 2BT9A 2QO4A 5HCDC 3FYFA 1B4MA 5HZ5A 2CM9A 4ID2A 3EBWA 5LKEA 1PEEA 4TJZA 2E4JA 3C77X 2X8FA 1DC9A 3NADA 4Y0SA 5FAZA 1B0OA 1U18A 2MWHA 2POAA 1G85A 1MX7A 2R56A 4OS8A 2Z4IA 1BRQA 5HTDA 4RUUA 4O4UA 4I6SA 3U0DA 4MVKA 2A3FX 5EZ2A 1CBQA 1YWBA 5LJKA 1SY2A 3F9DA 5LJCA 2CM4A 4HWMA 1VYFA 4O4OA 1EIOA 1E02A 1LKEA 4ODDA 1MDCA 1QY1A 2GTLO 4HPAA 3VPJE 5IO5A 3UEVA 2FS6A 3WOVA 2QOSC 5FQ7E 4BVMA 1DZJA 4MVIA 1A3YA 1KGLA 1QFTA 1DFVA 1AVGI 1E00A 2R73A 5FQ8E 4HPBA 5BYPA 3TGCA 1YUPA 3B2IA 2WQ9A 3ZZVA 5BVSA 1FELA 4GK9A 3JS1A 5H9AA 2JU7A 5EEEA 3S5XA 4ES7A 1EW3A 5HTEA 3ZW0A 4ZHDA 1QY2A 2P8GA 4YGZA 2F09A 2WSJA 2GTFX 4IB6A 1EIIA 3HWGA 3FLLA 4NNTA 4U9CA 1U17A 3NQ3A 3P6GA 2W2AA 3IFBA 2DM5A 5BVTA 4ZH9A 1JJJA 2ASNX 3FR2A 4NP1A 4JGLA 4CK4A 4MISA 1GM6A 4ZGFA 1KT3A 2OFMX 3ZW1B 3DSZA 5EDCA 1ZNKA 4KC7A 1B56A 3F6ZB 3C76X 4QAEA 1KT6A 1E5PA 1OBPA 3MVFA 4TLJA 1ZRYA 1KXOA 2AT0X 2W2FA 2LA7A 1O1UA 2CBRA 1E06A 3UAQA 5LJEA 3PP6A 1ALBA 3D97A 3UEWA 2AT8X 5AJCA 4YKMA 3FEPA 1HBQA 2FT9A 1I04A 3BLGA 3KZAA 3WJCA 4WFUA 1JYDA 3OJYC 4IB8A 4OS0A 4NLIA 4YFRA 1IFBA 2FS7A 4IBAA 1TVQA 3RWXA 3APXA 4EXZA 1KZWA 5HZQA 2MJIA 2CZUA 1DZPA 4ORUA 2KTSA 4YFPA 2GTLN 3FELA 1I05A 4YMYA 1G7NA 5L8IA 4ORSA 4TNNA 3EM0A 2CBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PSQ A;  4TKH A;  4D6A A;  4YGH A;  1XKI A;  3HK1 A;  1OBU A;  2JU3 A;  3PEC A;  3TGB A;  2RCT A;  3GAQ A;  2JOZ A;  1MX8 A;  2GJ5 A;  1X8O A;  3BSZ E;  2EU7 X;  4UU2 A;  4XMF A;  1X71 A;  2FRS A;  1D2U A;  1YP6 A;  1QQS A;  5HZ9 A;  3PH5 A;  3FEK A;  1KQX A;  1P6P A;  4YH0 A;  4ZHG A;  5HZ6 A;  1TOU A;  3KFI A;  2K62 A;  1IW2 A;  1ZNG A;  2Q2M A;  2K23 A;  4AZM A;  4DQ4 A;  1LIC A;  1GKA A;  4MVL A;  4ALB A;  2AT5 X;  4WBK A;  4XMC A;  5JR8 A;  4TKB A;  3T1D A;  4IB9 A;  1GT3 A;  3NX2 A;  4LZV A;  5FFH A;  2L67 A;  4TKJ A;  1YWA A;  3B2J A;  1I4U A;  5H9N A;  1ZNE A;  1U0X A;  3QKG A;  3VG6 A;  2Q4N A;  5HA0 A;  1YWD A;  1SXX A;  1EPA A;  3EBK A;  4GE1 A;  5HWZ A;  2GC9 A;  2CZT A;  4UU3 A;  2ANS A;  1X8U A;  4YDA A;  4ZHF A;  5HCC C;  1GT4 A;  1PMP A;  1QWD A;  2A2G A;  4A8Z A;  4AZN A;  4QGV A;  1O8V A;  4YDB A;  1ZND A;  2FR3 A;  1TXL A;  5CE4 A;  2Q9S A;  3P6D A;  1EQD A;  2JN3 A;  4YCE A;  4A60 A;  4DQ3 A;  3BS2 A;  5LJD A;  2RCQ A;  1NGL A;  3DTQ A;  1CBI A;  2NNQ A;  3PPT A;  3FR4 A;  2F73 A;  3L4R A;  1X89 A;  3O19 A;  3O2Y A;  3EMM A;  1QY0 A;  3O22 A;  1YIV A;  3Q6L A;  3WXQ A;  3SAO A;  5EED A;  2QM9 A;  1FEN A;  3CWK A;  2LB6 A;  4ORR A;  1KT4 A;  4A1Y A;  3CQN A;  2IFB A;  1A57 A;  3WJB A;  1VYG A;  2FR2 A;  4I3B A;  2O62 A;  3WBG A;  4HPD A;  2LKK A;  3TGA A;  2X46 A;  3BDR A;  3P6E A;  5EDB A;  1CRB A;  4LKT A;  5B27 A;  3APW A;  2HYS A;  4EFG A;  1KZX A;  2FLJ A;  2NNE A;  1X8N A;  1O1V A;  4EDE A;  4QGX A;  1ICN A;  4XME A;  5H8T A;  3CMP A;  1AEL A;  3CBC A;  5D47 A;  1ADL A;  1S44 A;  4ZFX A;  4YKO A;  1R0U A;  4KII A;  3ZUO A;  2LBA A;  3FA6 A;  1HN2 A;  2Q39 A;  2A2U A;  1JV4 A;  1IKJ A;  1SXW A;  1MUP A;  2HNX A;  5H9K A;  1X8Q A;  1TOW A;  2HZR A;  5HA1 A;  4Y0P A;  4A1H A;  2R74 A;  1ERB A;  1QG5 A;  1HMS A;  1BLR A;  2AL0 X;  4ZH6 A;  4IAW A;  1OEJ A;  4NYR A;  4BOE A;  5L8O A;  1KOI A;  1DF3 A;  2AH7 X;  4R0B A;  2KT4 B;  4IMN A;  3EYC A;  4GNW A;  5KIC A;  2HMB A;  2L68 A;  1QAB E;  1LPJ A;  2KTD A;  3WVM A;  3B2H A;  4I9S A;  2A0A A;  2G7B A;  5EPQ A;  4ZGU A;  2QO5 A;  2MO5 A;  1DZK A;  1XCA A;  4GRJ A;  4QYN A;  5DPQ A;  4LKP A;  4AZP A;  1ICM A;  4AW8 A;  1FE3 A;  3NQ9 A;  3UEX A;  4ORY A;  3TF6 A;  1YP7 A;  4M6S A;  5FEN A;  4IB7 A;  1URE A;  1GX9 A;  5IO7 A;  1RBP A;  4ZHH A;  1NP1 A;  1BRP A;  3MBT A;  1HMR A;  4ZR2 A;  3KQ0 A;  4YFQ A;  2ACO A;  3WJG A;  3CR6 A;  5BVQ A;  2RA6 A;  3G7X A;  1HBP A;  1HMT A;  3BU1 A;  1I06 A;  3FIQ A;  4AZQ A;  5KHP A;  2PY1 A;  3WJE A;  1IIU A;  3FMZ A;  3KFH A;  5D8J A;  3UEU A;  3FA7 A;  3STK A;  3CQR A;  3STN A;  3P6C A;  3RSW A;  4O9S A;  4QZU A;  4YCH A;  1SXU A;  1S7D A;  2RQ0 A;  1KT7 A;  2OVD A;  3APV A;  2L9C A;  3FA8 A;  3B2K A;  4QZT A;  3NP1 A;  3I0A A;  5HZ8 A;  3PH6 A;  4EEJ A;  2HLV A;  5D4A A;  4AZO A;  1EAL A;  2A13 A;  4HPC A;  3VG5 A;  3KFF A;  4OMW A;  1BSQ A;  1T8V A;  1LIF A;  3PED A;  2JU8 A;  1BEB A;  4BQU A;  1LNM A;  1A2D A;  1FTP A;  1KT5 A;  3ELZ A;  1JYJ A;  2WUT A;  3HWF A;  3ELX A;  4XMG A;  3HWE A;  1BJ7 A;  4XMH A;  2AT6 X;  4YGG A;  5F6Z A;  1QFV A;  1OEE A;  2XST A;  4D6B A;  4Y0Q A;  3BRN A;  5IO6 A;  2WEW A;  5L8N A;  1LIB A;  2OVA A;  1TW4 A;  5F58 A;  2AT3 X;  3BU9 A;  2X45 A;  5F1E A;  2AMM X;  3APU A;  3VG7 A;  2OZQ A;  2WQA E;  2MM3 A;  5HCE C;  3U03 A;  4AYH A;  3P6F A;  1GT5 A;  1Z24 A;  1RLB E;  5LKF A;  1NP4 A;  4WFV A;  4NYQ A;  1OEK A;  1CJ5 A;  4OS3 A;  1GT1 A;  1FDQ A;  1VPR A;  3CBS A;  4GNY A;  1LIE A;  5K06 A;  1CBR A;  4IAX A;  3K3L A;  3I17 A;  4ORW A;  1SXY A;  4NNS A;  4ZCB A;  4QGW A;  3AKM A;  1T0V A;  3ZUI A;  5F6B A;  4HFO A;  2FTB A;  4ALO A;  4ZJ0 A;  1GX8 A;  3WJD A;  1SA8 A;  2OFR X;  2XKL A;  4I3C A;  4LZU A;  3FA9 A;  2WR6 A;  2FWV A;  4YBP A;  5D48 A;  3AKN A;  3D95 A;  4QYP A;  1GKA B;  1LFO A;  1D3S A;  1B8E A;  2ALL X;  4ORX A;  4IMO A;  1LF7 A;  1UZ2 X;  1DV9 A;  1HQP A;  1KQW A;  1EPB A;  2NND A;  5HBS A;  4TQ2 A;  1IKE A;  1CBS A;  1YWC A;  1EUO A;  2Q2P A;  5D45 A;  1FEM A;  2ACP X;  5H9L A;  1T68 X;  3B2L A;  2G79 A;  3BX7 A;  3NPO A;  5HAE A;  1PBO A;  3S26 A;  5C0N A;  2RD7 C;  4GH7 A;  2BLG A;  4I9R A;  3D96 A;  5LJH A;  1BBP A;  1S2P A;  1G5W A;  3FEN A;  3P6H A;  3VG4 A;  4RUN A;  4ZHC A;  4I3D A;  1ML7 A;  1DZM A;  3FW5 A;  1H91 A;  3KFG A;  1JJX A;  1MVG A;  1ERX A;  1BM5 A;  3IA8 A;  4OMX A;  1OPA A;  4K19 A;  4NLJ A;  3NR3 A;  1SY0 A;  3NX1 A;  2NP1 A;  4GKC A;  3JSQ A;  3VG2 A;  4M7M A;  5B29 A;  2WWP A;  1AQB A;  4ARH A;  1SY3 A;  2LBV A;  5LJB A;  1L6M A;  2HZQ A;  2WEX A;  5DG4 A;  1BSY A;  5LJG A;  4GET A;  2QO6 A;  4XMD A;  1BSO A;  3VG3 A;  3ZQ3 A;  2LFO A;  4YBU A;  4N7D A;  5AQ6 A;  1X8P A;  1PM1 X;  3WJF A;  1JZU A;  3C78 X;  1BWY A;  2YG2 A;  3U9P C;  2L5P A;  1OBQ A;  2N93 A;  1ZNL A;  4N7C A;  1AB0 A;  2OVE A;  3BY0 A;  5F7G A;  1N0S A;  1SY1 A;  1A18 A;  4Y0R A;  2AKQ A;  3HWD A;  1ZNH A;  1LID A;  3BX8 A;  5KID A;  1JBH A;  3RZY A;  3TZS A;  3FR5 A;  3FW4 A;  1GXA A;  1ACD A;  3STM X;  1GGL A;  2W2B A;  1G74 A;  1EXS A;  1OPB A;  2G78 A;  1IFC A;  3F8A A;  4AZR A;  2QO4 A;  5HCD C;  1B4M A;  5HZ5 A;  2CM9 A;  5LKE A;  3EBW A;  1PEE A;  4TJZ A;  2E4J A;  3C77 X;  1DC9 A;  3NAD A;  4Y0S A;  5FAZ A;  1B0O A;  1U18 A;  2POA A;  1G85 A;  1MX7 A;  2R56 A;  4OS8 A;  1BRQ A;  5HTD A;  4RUU A;  3U0D A;  4MVK A;  2A3F X;  5EZ2 A;  1CBQ A;  1YWB A;  5LJK A;  1SY2 A;  3F9D A;  5LJC A;  2CM4 A;  1VYF A;  1EIO A;  1E02 A;  1LKE A;  4ODD A;  1MDC A;  1QY1 A;  4HPA A;  5IO5 A;  3UEV A;  2FS6 A;  2QOS C;  4BVM A;  1DZJ A;  4MVI A;  1A3Y A;  1KGL A;  1QFT A;  1DFV A;  1AVG I;  1E00 A;  2R73 A;  4HPB A;  3TGC A;  1YUP A;  3B2I A;  2WQ9 A;  5BVS A;  1FEL A;  3JS1 A;  5H9A A;  2JU7 A;  5EEE A;  4ES7 A;  1EW3 A;  5HTE A;  4ZHD A;  1QY2 A;  2P8G A;  4YGZ A;  2WSJ A;  4IB6 A;  2GTF X;  1EII A;  3HWG A;  3FLL A;  4NNT A;  1U17 A;  3NQ3 A;  3P6G A;  2W2A A;  3IFB A;  2DM5 A;  5BVT A;  4ZH9 A;  1JJJ A;  2ASN X;  3FR2 A;  4NP1 A;  4CK4 A;  1GM6 A;  1KT3 A;  2OFM X;  3DSZ A;  5EDC A;  1ZNK A;  1B56 A;  3C76 X;  4QAE A;  1KT6 A;  1E5P A;  1OBP A;  3MVF A;  4TLJ A;  1ZRY A;  1KXO A;  2AT0 X;  2W2F A;  1O1U A;  2CBR A;  1E06 A;  5LJE A;  3PP6 A;  1ALB A;  3D97 A;  3UEW A;  2AT8 X;  4YKM A;  3FEP A;  1HBQ A;  2FT9 A;  1I04 A;  3BLG A;  3KZA A;  3WJC A;  4WFU A;  1JYD A;  3OJY C;  4IB8 A;  4OS0 A;  4NLI A;  4YFR A;  1IFB A;  2FS7 A;  4IBA A;  1TVQ A;  3APX A;  4EXZ A;  1KZW A;  5HZQ A;  2MJI A;  2CZU A;  1DZP A;  4ORU A;  4YFP A;  3FEL A;  1I05 A;  4YMY A;  1G7N A;  5L8I A;  4ORS A;  4TNN A;  3EM0 A;  2CBS A; 
#chains in the Genus database with same CATH topology
 4PSQ A;  4TKH A;  4D6A A;  4O49 A;  4YGH A;  1XKI A;  2OY7 A;  2OVS A;  3HK1 A;  1OBU A;  2IZJ A;  2IZI A;  2JU3 A;  2RCT A;  1SLE B;  3PEC A;  2A5C A;  3GAQ A;  2RTM A;  4INN A;  1SWH A;  1MOY A;  2JOZ A;  2OFB A;  1NC9 A;  1MX8 A;  2GJ5 A;  4Y59 A;  1X8O A;  2RTQ B;  2EU7 X;  3BSZ E;  4UU2 A;  1X71 A;  2FRS A;  4XMF A;  3VU1 A;  1D2U A;  1YP6 A;  1QQS A;  5HZ9 A;  2JMB A;  3PH5 A;  2BS5 A;  3FEK A;  3EC5 A;  1KQX A;  1P6P A;  1NDJ A;  1SWC A;  4YH0 A;  4ZHG A;  3N91 A;  1LDQ A;  1TOU A;  1VWO B;  3KFI A;  4CV7 A;  5HZ6 A;  1GX3 A;  2K62 A;  2OF9 A;  2KW1 A;  3VE1 A;  1IW2 A;  1ZNG A;  2Q2M A;  2K23 A;  3FID A;  1LUQ A;  4AZM A;  4DQ4 A;  1LIC A;  1JMX A;  1GKA A;  4MVL A;  4ALB A;  1SWP A;  2Z4H A;  2AT5 X;  4WBK A;  4XMC A;  5JR8 A;  4O3X B;  4U46 A;  4TKB A;  4IAB A;  2RTN B;  4IB9 A;  1GT3 A;  3NX2 A;  4LZV A;  5FFH A;  3T1D A;  2L67 A;  4MEE A;  4TKJ A;  1YWA A;  1SRF A;  3B2J A;  1I4U A;  4CPI A;  5H9N A;  4Z2V A;  1ZNE A;  1U0X A;  3QKG A;  3VG6 A;  2Q4N A;  5HA0 A;  3V8U A;  1YWD A;  1SXX A;  1EPA A;  3EBK A;  4GE1 A;  1PTS A;  1UYO X;  2CZT A;  2GC9 A;  4UU3 A;  2ANS A;  2BS6 A;  1X8U A;  4YDA A;  4ZHF A;  5HCC C;  4O3Y A;  1GT4 A;  3H3I A;  1PMP A;  1QWD A;  2A2G A;  4U8U O;  4A8Z A;  4AZN A;  1SLD B;  1SRG A;  4QGV A;  1O8V A;  4YDB A;  3ZWE A;  1ZND A;  2FR3 A;  1TXL A;  5CE4 A;  1VWB B;  2Q9S A;  3P6D A;  4FBO A;  1EQD A;  2JN3 A;  1VWP B;  4YCE A;  4A60 A;  4DQ3 A;  3BS2 A;  5LJD A;  2RCQ A;  3T6F A;  1NGL A;  3DTQ A;  1CBI A;  2NNQ A;  3PPT A;  3FR4 A;  2BC3 A;  2F73 A;  3RDM A;  1WUB A;  2IZB A;  1VYO A;  3L4R A;  2OFA A;  4ON1 A;  3RKG A;  3VGW A;  1X89 A;  3O19 A;  3O2Y A;  3RY2 A;  3EMM A;  1QY0 A;  3O22 A;  3WZQ A;  1YIV A;  3Q6L A;  4MIR A;  2RTO B;  3WXQ A;  3SAO A;  5EED A;  2QM9 A;  1KFF A;  1FEN A;  3CWK A;  2LB6 A;  2PI3 O;  3KVN A;  4ORR A;  4O3Z A;  1KT4 A;  3RDX A;  4A1Y A;  3CQN A;  1VWI B;  1N9M A;  2IFB A;  1A57 A;  2ZSC A;  3WJB A;  1VYG A;  2FR2 A;  4I3B A;  1RXH A;  2O62 A;  4MVE A;  4KT5 A;  4HPD A;  3WBG A;  2LKK A;  3TGA A;  2X46 A;  3BDR A;  3P6E A;  5EDB A;  1CRB A;  1NQM A;  4LKT A;  5B27 A;  1SMP I;  3APW A;  2HYS A;  3LHN A;  4EFG A;  1KZX A;  3TGB A;  2FLJ A;  2NNE A;  3WZN A;  1X8N A;  3X00 A;  1O1V A;  4EDE A;  4QGX A;  1SWJ A;  3CKF A;  1ICN A;  4XME A;  3PQU A;  5H8T A;  3CMP A;  1AEL A;  3CBC A;  5D47 A;  1ADL A;  1S44 A;  1SWR A;  3HOL A;  4ZFX A;  3GE2 A;  4YKO A;  1R0U A;  3SLT A;  4KII A;  2VFB A;  2UYW A;  3ZUO A;  2LBA A;  3FA6 A;  1HN2 A;  2Q39 A;  2DJF A;  5JD2 A;  3VHM A;  2A2U A;  1JV4 A;  1IKJ A;  1SXW A;  2Y3E A;  1K24 A;  1MUP A;  4JNJ A;  2HNX A;  1Y53 X;  1NQN A;  5H9K A;  4GU8 A;  1X8Q A;  1TOW A;  2HZR A;  5HA1 A;  4Y0P A;  4A1H A;  3S5V A;  4BJ8 A;  3HPE A;  2R74 A;  2RN4 A;  4BBO A;  3HTY A;  1ERB A;  1QG5 A;  3MX7 A;  5B3M O;  1HMS A;  1STR B;  1VWR B;  1BLR A;  2AL0 X;  4ZH6 A;  4U8U N;  4FBV A;  1OEJ A;  4IAW A;  4GJV A;  4NYR A;  4Y5D A;  4BOE A;  4CPH B;  5L8O A;  1KOI A;  1DF3 A;  1MM9 A;  1WBI A;  3HOE A;  5B11 O;  2IZF B;  2OF8 A;  3OE3 A;  4GDZ A;  2AH7 X;  4R0B A;  2KT4 B;  4CDE A;  4IMN A;  3EYC A;  4GNW A;  5KIC A;  2HMB A;  1W4T A;  2L68 A;  1QAB E;  2ZAG A;  1LPJ A;  2KTD A;  3WVM A;  4DCB A;  3B2H A;  1SWT A;  4CSB A;  4I9S A;  2A0A A;  2G7B A;  5EPQ A;  2G8C O;  2OL6 O;  4ZGU A;  1HY2 A;  2QO5 A;  1DF8 A;  1VWK B;  2MO5 A;  1DZK A;  2GH7 A;  1VWH B;  1XCA A;  4GRJ A;  4QYN A;  5DPQ A;  4LKP A;  5B2A O;  3RBY A;  4AZP A;  4BX5 A;  4EKV A;  1ICM A;  2CAM A;  2JW1 A;  4AW8 A;  1I78 A;  1FE3 A;  3NQ9 A;  4I95 A;  4O4S A;  5IRA A;  3UEX A;  1RXJ A;  3ZI8 A;  3LV4 A;  4ORY A;  3RDQ A;  3TF6 A;  2X34 A;  1HXL A;  1YP7 A;  4M6S A;  5FEN A;  4IB7 A;  1URE A;  1GX9 A;  1JQP A;  1RBP A;  4ZHH A;  5IO7 A;  1NP1 A;  2RTR B;  1BRP A;  3MBT A;  1HMR A;  4ZR2 A;  4EQA C;  3KQ0 A;  4FQB B;  3SOT A;  4YFQ A;  2ACO A;  4O3W A;  3CR6 A;  5BVQ A;  2RA6 A;  3G7X A;  3WJG A;  1HBP A;  1HMT A;  3BU1 A;  1I06 A;  3FIQ A;  4AZQ A;  5KHP A;  2PY1 A;  3MM0 A;  5IXG A;  3WJE A;  1IIU A;  2RTG B;  3FMZ A;  3KFH A;  5D8J A;  3UEU A;  2MF6 A;  3FA7 A;  5IRU A;  3STK A;  4CPF A;  4PJ2 A;  2IZH B;  3CQR A;  3STN A;  3P6C A;  3RSW A;  4O9S A;  2X32 A;  4QZU A;  4YCH A;  4Z6J A;  1SXU A;  1S7D A;  2BSZ A;  2RQ0 A;  1KT7 A;  2OVD A;  3APV A;  2L9C A;  4BX7 B;  3FA8 A;  3B2K A;  1Y52 X;  2RTH B;  3RDO A;  4QZT A;  3NP1 A;  3I0A A;  5HZ8 A;  1SRH A;  3PH6 A;  3RDS A;  5B5F A;  4EEJ A;  2HLV A;  2IZG B;  5D4A A;  4AZO A;  3OD9 A;  1EAL A;  2A13 A;  4HPC A;  3VG5 A;  3KFF A;  5CYB A;  3RDU A;  4OMW A;  1BSQ A;  5FQ6 E;  1T8V A;  1LIF A;  3PED A;  2JU8 A;  1BEB A;  1VWG B;  2GTL M;  1LNM A;  1KL3 A;  1A2D A;  1FTP A;  2KD2 A;  1KT5 A;  4QQ1 A;  3ELZ A;  4BQU A;  5CSE A;  1JYJ A;  2WUT A;  3VE2 A;  4LQZ A;  3HWF A;  3ELX A;  4XMG A;  3Q34 A;  3HWE A;  1BJ7 A;  4GD9 A;  3ZW1 A;  4NV8 A;  4XMH A;  2AT6 X;  2MHD A;  4YGG A;  3NBX X;  5F6Z A;  1QFV A;  2FKG A;  1SWO A;  1OEE A;  4QRL A;  2XST A;  4D6B A;  4Y0Q A;  3BRN A;  1SWB A;  5IO6 A;  2WEW A;  1OSP O;  5L8N A;  4WHI A;  3D9W A;  1LIB A;  2OVA A;  1TW4 A;  2IZL B;  5F58 A;  1FJ1 E;  4L3R A;  2X56 A;  4CPH A;  2AT3 X;  3BU9 A;  2X45 A;  5F1E A;  2AMM X;  3APU A;  2X8S A;  3VG7 A;  1PBY A;  2OZQ A;  2WQA E;  2MM3 A;  5HCE C;  4BX6 A;  1SWD A;  3U03 A;  2QMI A;  4GDA A;  4AYH A;  3P6F A;  1GT5 A;  2VDF A;  2OL7 A;  1VWE B;  4NV7 A;  1Z24 A;  1AVD A;  4L1N A;  1HQQ A;  4ML7 B;  1RLB E;  3WZP A;  4GGZ A;  5LKF A;  1NP4 A;  1SWF A;  4WFV A;  2X8T A;  4NW4 A;  3S60 A;  4NYQ A;  1OEK A;  1CJ5 A;  3P24 A;  4OS3 A;  1GT1 A;  1VWQ B;  1FDQ A;  1VPR A;  3CBS A;  4OEL A;  1SRI A;  1LIE A;  4GNY A;  4KH8 A;  5K06 A;  2FHL A;  2JGS A;  5F2B A;  1CBR A;  1E2T A;  3K3L A;  4IAX A;  3I17 A;  4ORW A;  1SXY A;  4NNS A;  4ZCB A;  2OY1 O;  4QGW A;  3AKM A;  1T0V A;  2WPU A;  1Y0G A;  3ZUI A;  5F6B A;  4HFO A;  1JIW I;  4CDC A;  2FTB A;  4ALO A;  1LCV A;  3VHH A;  2A5B A;  1VWM B;  4ZJ0 A;  2M4L A;  3T6L A;  1GX8 A;  3WJD A;  1SA8 A;  2OFR X;  2XKL A;  4I3C A;  4LZU A;  3FA9 A;  1SLG B;  2FWV A;  1EI5 A;  2WR6 A;  1VWC B;  4YBP A;  2UZ2 A;  5D48 A;  2QOM A;  3AKN A;  3D95 A;  4QYP A;  4FBR A;  3SZI A;  5AJB A;  1GKA B;  1LFO A;  1D3S A;  1B8E A;  2ALL X;  2FKJ A;  4ORX A;  4IMO A;  2OYB O;  1LF7 A;  2C1S A;  1UZ2 X;  1DV9 A;  2C1Q A;  2IZA A;  1HQP A;  1KQW A;  1EPB A;  2NND A;  1KL4 A;  5HBS A;  1LCZ A;  1VWD B;  4KCA A;  4TQ2 A;  1IKE A;  4TNN A;  1CBS A;  4YVB A;  1YWC A;  1EUO A;  3JQO A;  2Q2P A;  5D45 A;  1FEM A;  2ACP X;  4Z2P A;  4O4X A;  2Y3F A;  1T68 X;  5H9L A;  4JHQ A;  3B2L A;  2G79 A;  3BX7 A;  3NPO A;  4B55 A;  5HAE A;  1PBO A;  1SWE A;  3S26 A;  3AEH A;  5C0N A;  2RTK A;  2RD7 C;  4GH7 A;  2BLG A;  2IZD B;  4I9R A;  3D96 A;  4U3Q A;  5LJH A;  1BBP A;  1S2P A;  1G5W A;  1MEP A;  3FEN A;  3P6H A;  3VG4 A;  4RUN A;  4ZHC A;  1UYN X;  2VFC A;  4I3D A;  1ML7 A;  1DZM A;  3FW5 A;  1H91 A;  3CKG A;  2RTJ A;  1MVG A;  1ERX A;  3KFG A;  1BM5 A;  1JJX A;  3IA8 A;  3PQS A;  4I60 A;  4OMX A;  1OPA A;  4K19 A;  4NLJ A;  3NR3 A;  3PK2 A;  3QQ2 A;  4FGI B;  4C5P A;  4QNI A;  1SY0 A;  3NX1 A;  2NP1 A;  4GKC A;  3JSQ A;  3VG2 A;  1STP A;  4M7M A;  1JJU A;  2WWP A;  5B29 A;  1AQB A;  4ARH A;  1SY3 A;  2LBV A;  5LJB A;  4GUZ A;  2AF5 A;  1IJ8 A;  1L6M A;  2HZQ A;  2WEX A;  3NQK A;  5DG4 A;  1BSY A;  1Y55 X;  2ZAI A;  5LJG A;  4GET A;  2QO6 A;  4XMD A;  1BSO A;  3VG3 A;  3ZQ3 A;  2IZE B;  2LFO A;  4YBU A;  4N7D A;  3D4R A;  5B5G A;  2X4M A;  3P02 A;  1X8P A;  1PM1 X;  5AQ6 A;  3WJF A;  3WYQ A;  1JZU A;  3C78 X;  1BWY A;  1Y9T A;  2AVI A;  2L5P A;  1OBQ A;  2YG2 A;  4KC8 A;  3U9P C;  4IRW A;  2N93 A;  2RTE B;  4U8U M;  3VHI A;  4CPE A;  5IRW A;  3LTW A;  2BHV A;  1ZNL A;  1RXK A;  1SRJ A;  3EW2 A;  1LDO A;  3E3C A;  4N7C A;  1AB0 A;  3ZW0 B;  5AEO A;  2OVE A;  3BY0 A;  3OBL A;  5F7G A;  4GZV A;  1N0S A;  1RSU B;  1SY1 A;  1A18 A;  4Y0R A;  2AKQ A;  2FGS A;  1Y9L A;  3HWD A;  2I5Z O;  1ZNH A;  1LID A;  3BX8 A;  3SZJ A;  3ZW2 A;  1LEL A;  5KID A;  1JBH A;  1VWL B;  2RTB B;  3MG5 A;  3RZY A;  3TZS A;  2YMS A;  3FR5 A;  1VWJ B;  3FW4 A;  1GXA A;  1ACD A;  3STM X;  1GGL A;  1G74 A;  1EXS A;  2W2B A;  1OPB A;  3WZO A;  2FHN X;  4COT A;  2G78 A;  1IFC A;  3F8A A;  4AZR A;  2BT9 A;  2QO4 A;  5HCD C;  3FYF A;  4GGR A;  2HKD A;  1B4M A;  5HZ5 A;  1SWU A;  2CM9 A;  4ID2 A;  3EBW A;  5LKE A;  1PEE A;  4TJZ A;  2E4J A;  3C77 X;  2X8F A;  1DC9 A;  3NAD A;  4Y0S A;  5FAZ A;  1B0O A;  1U18 A;  2MWH A;  2POA A;  3T2X A;  1G85 A;  1MX7 A;  3RY1 A;  1N9Y A;  2R56 A;  4OS8 A;  2Z4I A;  1BRQ A;  2I5V O;  3AUM O;  4Z2O A;  3T2W A;  5HTD A;  4RUU A;  4O4U A;  4I6S A;  1N7Y A;  3U0D A;  3PDF A;  4Z27 A;  1N4J A;  3FDC A;  2OL8 O;  4MVK A;  2A3F X;  1W6F A;  5EZ2 A;  5L3Y A;  1SWL A;  4BX5 B;  1CBQ A;  1JMZ A;  1YWB A;  4CDD A;  4BGF A;  5LJK A;  1SY2 A;  3EW1 A;  3F9D A;  2CM4 A;  2OY8 A;  5LJC A;  4OEM A;  4HWM A;  3SLO A;  2RTI B;  1VYF A;  4O4O A;  3RE6 A;  1EIO A;  1E02 A;  1LKE A;  4ODD A;  2DJG A;  4JO6 A;  1MDC A;  1QY1 A;  2GTL O;  1SWS A;  4HPA A;  1SWG A;  3VPJ E;  5IO5 A;  3UEV A;  2FS6 A;  1W5R A;  3WOV A;  2QOS C;  5FQ7 E;  1AVE A;  4BVM A;  1DZJ A;  4MVI A;  1A3Y A;  1KGL A;  1QFT A;  5CHK A;  1DFV A;  1MK5 A;  1AVG I;  1SWQ A;  1E00 A;  1RST B;  2R73 A;  5FQ8 E;  4HPB A;  5BYP A;  3TGC A;  1YUP A;  3B2I A;  2WQ9 A;  3ZZV A;  1NBX A;  2G5L A;  5BVS A;  1FEL A;  4GK9 A;  3JS1 A;  5K68 A;  1VWA B;  5H9A A;  2JU7 A;  5EEE A;  3S5X A;  4ES7 A;  2QCB A;  1SWA A;  2Y32 A;  1KL5 A;  1EW3 A;  5HTE A;  1VWF B;  2RTF B;  3ZW0 A;  4BX7 A;  4ZHD A;  1QY2 A;  2A8G A;  2P8G A;  2RTD B;  2X55 A;  4YGZ A;  3RE5 A;  2F09 A;  2F01 A;  2GTF X;  2WSJ A;  4GJS A;  4IB6 A;  1EII A;  1SWN A;  3HWG A;  3FLL A;  1K3B A;  2RTA A;  4NNT A;  4U9C A;  1U17 A;  3NQ3 A;  3P6G A;  4Z28 A;  2W2A A;  4CDF A;  3IFB A;  2DM5 A;  1RAV A;  5BVT A;  4ZH9 A;  1JJJ A;  2ASN X;  3FR2 A;  4NP1 A;  2RTC B;  4JGL A;  4CK4 A;  4MIS A;  1GM6 A;  4ZGF A;  1KT3 A;  2OFM X;  4GGT A;  3DSZ A;  3ZW1 B;  5EDC A;  1ZNK A;  4KC7 A;  1B56 A;  3F6Z B;  3C76 X;  4QAE A;  2IZC B;  1KT6 A;  2RTP B;  1E5P A;  1OBP A;  1LCW A;  2RTL A;  3MVF A;  4TLJ A;  1ZRY A;  1KXO A;  2AT0 X;  2W2F A;  2LA7 A;  3SZH A;  1KZW A;  3SLJ A;  1O1U A;  2CBR A;  1E06 A;  3UAQ A;  5LJE A;  5B10 O;  3PP6 A;  1ALB A;  3D97 A;  3UEW A;  2AT8 X;  4OKA A;  5AJC A;  4BX6 B;  4YKM A;  3FEP A;  1HBQ A;  2FT9 A;  1I04 A;  3WYP A;  3BLG A;  3KZA A;  3WJC A;  4WFU A;  1JYD A;  4DNE A;  5K67 A;  3OJY C;  4IB8 A;  1STS B;  4NLI A;  2IZK A;  4OS0 A;  1IFB A;  2FS7 A;  2OY5 O;  4IBA A;  1TVQ A;  4YFR A;  3RWX A;  1HXZ A;  3APX A;  1SWK A;  4EXZ A;  1I9H A;  2C4I A;  2MJI A;  2CZU A;  1DZP A;  1VWN B;  4ORU A;  2KTS A;  5HZQ A;  4YFP A;  2GTL N;  3FEL A;  4BCS A;  1I05 A;  1SRE A;  4YMY A;  5HWZ A;  1G7N A;  5L8I A;  4ORS A;  1SLF B;  1N43 A;  3EM0 A;  2CBS A; 
#chains in the Genus database with same CATH homology
 4PSQ A;  4TKH A;  4D6A A;  4O49 A;  4YGH A;  1XKI A;  2OVS A;  3HK1 A;  1OBU A;  2JU3 A;  3PEC A;  3TGB A;  2RCT A;  3GAQ A;  4INN A;  2JOZ A;  1MX8 A;  2GJ5 A;  1X8O A;  3BSZ E;  2EU7 X;  4UU2 A;  4XMF A;  1X71 A;  2FRS A;  3VU1 A;  1D2U A;  1YP6 A;  1QQS A;  5HZ9 A;  2JMB A;  3PH5 A;  2BS5 A;  3FEK A;  1KQX A;  1P6P A;  4YH0 A;  4ZHG A;  3N91 A;  5HZ6 A;  1TOU A;  4CV7 A;  3KFI A;  2K62 A;  2KW1 A;  3VE1 A;  1IW2 A;  1ZNG A;  2Q2M A;  2K23 A;  4AZM A;  4DQ4 A;  1LIC A;  1GKA A;  4MVL A;  4ALB A;  2Z4H A;  2AT5 X;  4WBK A;  4XMC A;  5JR8 A;  4O3X B;  4TKB A;  4IAB A;  3T1D A;  4IB9 A;  1GT3 A;  3NX2 A;  4LZV A;  5FFH A;  2L67 A;  4TKJ A;  1YWA A;  3B2J A;  1I4U A;  5H9N A;  1ZNE A;  1U0X A;  3QKG A;  3VG6 A;  2Q4N A;  5HA0 A;  3V8U A;  1YWD A;  1SXX A;  1EPA A;  3EBK A;  4GE1 A;  5HWZ A;  2GC9 A;  2CZT A;  4UU3 A;  2ANS A;  2BS6 A;  1X8U A;  4YDA A;  4ZHF A;  5HCC C;  4O3Y A;  1GT4 A;  3H3I A;  1PMP A;  1QWD A;  2A2G A;  4U8U O;  4A8Z A;  4AZN A;  4QGV A;  1O8V A;  4YDB A;  3ZWE A;  1ZND A;  2FR3 A;  1TXL A;  5CE4 A;  2Q9S A;  3P6D A;  4FBO A;  1EQD A;  2JN3 A;  4YCE A;  4A60 A;  4DQ3 A;  3BS2 A;  5LJD A;  2RCQ A;  1NGL A;  3DTQ A;  1CBI A;  2NNQ A;  3PPT A;  3FR4 A;  2F73 A;  3L4R A;  4ON1 A;  3RKG A;  1X89 A;  3O19 A;  3O2Y A;  3EMM A;  1QY0 A;  3O22 A;  1YIV A;  3Q6L A;  4MIR A;  3WXQ A;  3SAO A;  5EED A;  2QM9 A;  1FEN A;  3CWK A;  2LB6 A;  4ORR A;  4O3Z A;  1KT4 A;  4A1Y A;  3CQN A;  2IFB A;  1A57 A;  3WJB A;  1VYG A;  2FR2 A;  4I3B A;  2O62 A;  4MVE A;  4KT5 A;  4HPD A;  3WBG A;  2LKK A;  3TGA A;  2X46 A;  3BDR A;  3P6E A;  5EDB A;  1CRB A;  4LKT A;  5B27 A;  1SMP I;  3APW A;  2HYS A;  3LHN A;  4EFG A;  1KZX A;  2FLJ A;  2NNE A;  1X8N A;  1O1V A;  4EDE A;  4QGX A;  1ICN A;  4XME A;  3PQU A;  5H8T A;  3CMP A;  1AEL A;  3CBC A;  5D47 A;  1ADL A;  1S44 A;  3HOL A;  4ZFX A;  3GE2 A;  4YKO A;  1R0U A;  4KII A;  3ZUO A;  2LBA A;  3FA6 A;  1HN2 A;  2Q39 A;  2A2U A;  1JV4 A;  1IKJ A;  1SXW A;  1MUP A;  2HNX A;  5H9K A;  4GU8 A;  1X8Q A;  1TOW A;  2HZR A;  5HA1 A;  4Y0P A;  4A1H A;  3S5V A;  2R74 A;  2RN4 A;  3HTY A;  1ERB A;  1QG5 A;  3MX7 A;  1HMS A;  1BLR A;  2AL0 X;  4ZH6 A;  4U8U N;  4FBV A;  1OEJ A;  4IAW A;  4NYR A;  4BOE A;  5L8O A;  1KOI A;  1DF3 A;  3HOE A;  4GDZ A;  3OE3 A;  2AH7 X;  4R0B A;  2KT4 B;  4IMN A;  3EYC A;  4GNW A;  5KIC A;  2HMB A;  2L68 A;  1QAB E;  2ZAG A;  1LPJ A;  2KTD A;  3WVM A;  3B2H A;  4CSB A;  4I9S A;  2A0A A;  2G7B A;  5EPQ A;  4ZGU A;  2QO5 A;  2MO5 A;  1DZK A;  1XCA A;  4GRJ A;  4QYN A;  5DPQ A;  4LKP A;  3RBY A;  4AZP A;  1ICM A;  2JW1 A;  4AW8 A;  1FE3 A;  3NQ9 A;  4I95 A;  4O4S A;  3UEX A;  3ZI8 A;  3LV4 A;  4ORY A;  3TF6 A;  1YP7 A;  4M6S A;  5FEN A;  4IB7 A;  1URE A;  1GX9 A;  5IO7 A;  1RBP A;  4ZHH A;  1NP1 A;  1BRP A;  3MBT A;  1HMR A;  4ZR2 A;  4EQA C;  3KQ0 A;  4FQB B;  3SOT A;  4YFQ A;  2ACO A;  4O3W A;  3CR6 A;  5BVQ A;  2RA6 A;  3G7X A;  3WJG A;  1HBP A;  1HMT A;  3BU1 A;  1I06 A;  3FIQ A;  4AZQ A;  5KHP A;  2PY1 A;  3WJE A;  1IIU A;  3FMZ A;  3KFH A;  5D8J A;  3UEU A;  3FA7 A;  3STK A;  4PJ2 A;  3CQR A;  3STN A;  3P6C A;  3RSW A;  4O9S A;  4QZU A;  4YCH A;  1SXU A;  1S7D A;  2RQ0 A;  1KT7 A;  2OVD A;  3APV A;  2L9C A;  3FA8 A;  3B2K A;  4QZT A;  3NP1 A;  3I0A A;  5HZ8 A;  3PH6 A;  4EEJ A;  2HLV A;  5D4A A;  4AZO A;  3OD9 A;  1EAL A;  2A13 A;  4HPC A;  3VG5 A;  3KFF A;  5CYB A;  4OMW A;  1BSQ A;  5FQ6 E;  1T8V A;  1LIF A;  3PED A;  2JU8 A;  1BEB A;  2GTL M;  4BQU A;  1LNM A;  1A2D A;  1FTP A;  2KD2 A;  1KT5 A;  4QQ1 A;  3ELZ A;  1JYJ A;  2WUT A;  3VE2 A;  4LQZ A;  3HWF A;  3ELX A;  4XMG A;  3HWE A;  1BJ7 A;  3ZW1 A;  4XMH A;  2AT6 X;  2MHD A;  4YGG A;  3NBX X;  5F6Z A;  1QFV A;  1OEE A;  4QRL A;  2XST A;  4D6B A;  4Y0Q A;  3BRN A;  5IO6 A;  2WEW A;  5L8N A;  4WHI A;  1LIB A;  2OVA A;  1TW4 A;  5F58 A;  4L3R A;  2AT3 X;  3BU9 A;  2X45 A;  5F1E A;  2AMM X;  3APU A;  2X8S A;  3VG7 A;  2OZQ A;  2WQA E;  2MM3 A;  5HCE C;  3U03 A;  2QMI A;  4AYH A;  3P6F A;  1GT5 A;  1Z24 A;  4L1N A;  4ML7 B;  1RLB E;  5LKF A;  1NP4 A;  4WFV A;  2X8T A;  4NW4 A;  3S60 A;  4NYQ A;  1OEK A;  1CJ5 A;  3P24 A;  4OS3 A;  1GT1 A;  1FDQ A;  1VPR A;  3CBS A;  4GNY A;  1LIE A;  4KH8 A;  5K06 A;  1CBR A;  4IAX A;  3K3L A;  3I17 A;  4ORW A;  1SXY A;  4NNS A;  4ZCB A;  4QGW A;  3AKM A;  1T0V A;  3ZUI A;  5F6B A;  4HFO A;  1JIW I;  2FTB A;  4ALO A;  4ZJ0 A;  2M4L A;  1GX8 A;  3WJD A;  1SA8 A;  2OFR X;  2XKL A;  4I3C A;  4LZU A;  3FA9 A;  2WR6 A;  2FWV A;  1EI5 A;  4YBP A;  5D48 A;  3AKN A;  3D95 A;  4QYP A;  4FBR A;  5AJB A;  1GKA B;  1LFO A;  1D3S A;  1B8E A;  2ALL X;  4ORX A;  4IMO A;  1LF7 A;  1UZ2 X;  1DV9 A;  1HQP A;  1KQW A;  1EPB A;  2NND A;  5HBS A;  4KCA A;  4TQ2 A;  1IKE A;  1CBS A;  1YWC A;  1EUO A;  3JQO A;  2Q2P A;  5D45 A;  1FEM A;  2ACP X;  4O4X A;  5H9L A;  1T68 X;  3B2L A;  2G79 A;  3BX7 A;  3NPO A;  5HAE A;  1PBO A;  3S26 A;  5C0N A;  2RD7 C;  4GH7 A;  2BLG A;  4I9R A;  3D96 A;  4U3Q A;  5LJH A;  1BBP A;  1S2P A;  1G5W A;  3FEN A;  3P6H A;  3VG4 A;  4RUN A;  4ZHC A;  4I3D A;  1ML7 A;  1DZM A;  3FW5 A;  1H91 A;  3KFG A;  1JJX A;  1MVG A;  1ERX A;  1BM5 A;  3IA8 A;  3PQS A;  4OMX A;  1OPA A;  4K19 A;  4NLJ A;  3NR3 A;  4FGI B;  4QNI A;  1SY0 A;  3NX1 A;  2NP1 A;  4GKC A;  3JSQ A;  3VG2 A;  4M7M A;  5B29 A;  2WWP A;  1AQB A;  4ARH A;  1SY3 A;  2LBV A;  5LJB A;  1L6M A;  2HZQ A;  2WEX A;  3NQK A;  5DG4 A;  1BSY A;  2ZAI A;  5LJG A;  4GET A;  2QO6 A;  4XMD A;  1BSO A;  3VG3 A;  3ZQ3 A;  2LFO A;  4YBU A;  4N7D A;  3D4R A;  5AQ6 A;  3P02 A;  1X8P A;  1PM1 X;  3WJF A;  1JZU A;  3C78 X;  1BWY A;  1Y9T A;  2YG2 A;  2L5P A;  1OBQ A;  3U9P C;  4KC8 A;  4U8U M;  2N93 A;  2BHV A;  1ZNL A;  4N7C A;  3ZW0 B;  3E3C A;  5AEO A;  1AB0 A;  2OVE A;  3BY0 A;  3OBL A;  5F7G A;  4GZV A;  1N0S A;  1SY1 A;  1A18 A;  4Y0R A;  2AKQ A;  3HWD A;  1Y9L A;  1ZNH A;  1LID A;  3BX8 A;  3ZW2 A;  5KID A;  1JBH A;  3RZY A;  3TZS A;  2YMS A;  3FR5 A;  3FW4 A;  1GXA A;  1ACD A;  3STM X;  1GGL A;  1G74 A;  1EXS A;  2W2B A;  1OPB A;  4COT A;  2G78 A;  1IFC A;  3F8A A;  4AZR A;  2BT9 A;  2QO4 A;  5HCD C;  3FYF A;  1B4M A;  5HZ5 A;  2CM9 A;  4ID2 A;  3EBW A;  5LKE A;  1PEE A;  4TJZ A;  2E4J A;  3C77 X;  2X8F A;  1DC9 A;  3NAD A;  4Y0S A;  5FAZ A;  1B0O A;  1U18 A;  2MWH A;  2POA A;  1G85 A;  1MX7 A;  2R56 A;  4OS8 A;  2Z4I A;  1BRQ A;  5HTD A;  4RUU A;  4O4U A;  4I6S A;  3U0D A;  4MVK A;  2A3F X;  5EZ2 A;  1CBQ A;  1YWB A;  5LJK A;  1SY2 A;  3F9D A;  5LJC A;  2CM4 A;  4HWM A;  1VYF A;  4O4O A;  1EIO A;  1E02 A;  1LKE A;  4ODD A;  1MDC A;  1QY1 A;  2GTL O;  4HPA A;  3VPJ E;  5IO5 A;  3UEV A;  2FS6 A;  3WOV A;  2QOS C;  5FQ7 E;  4BVM A;  1DZJ A;  4MVI A;  1A3Y A;  1KGL A;  1QFT A;  1DFV A;  1AVG I;  1E00 A;  2R73 A;  5FQ8 E;  4HPB A;  5BYP A;  3TGC A;  1YUP A;  3B2I A;  2WQ9 A;  3ZZV A;  5BVS A;  1FEL A;  4GK9 A;  3JS1 A;  5H9A A;  2JU7 A;  5EEE A;  3S5X A;  4ES7 A;  1EW3 A;  5HTE A;  3ZW0 A;  4ZHD A;  1QY2 A;  2P8G A;  4YGZ A;  2F09 A;  2WSJ A;  2GTF X;  4IB6 A;  1EII A;  3HWG A;  3FLL A;  4NNT A;  4U9C A;  1U17 A;  3NQ3 A;  3P6G A;  2W2A A;  3IFB A;  2DM5 A;  5BVT A;  4ZH9 A;  1JJJ A;  2ASN X;  3FR2 A;  4NP1 A;  4JGL A;  4CK4 A;  4MIS A;  1GM6 A;  4ZGF A;  1KT3 A;  2OFM X;  3ZW1 B;  3DSZ A;  5EDC A;  1ZNK A;  4KC7 A;  1B56 A;  3F6Z B;  3C76 X;  4QAE A;  1KT6 A;  1E5P A;  1OBP A;  3MVF A;  4TLJ A;  1ZRY A;  1KXO A;  2AT0 X;  2W2F A;  2LA7 A;  1O1U A;  2CBR A;  1E06 A;  3UAQ A;  5LJE A;  3PP6 A;  1ALB A;  3D97 A;  3UEW A;  2AT8 X;  5AJC A;  4YKM A;  3FEP A;  1HBQ A;  2FT9 A;  1I04 A;  3BLG A;  3KZA A;  3WJC A;  4WFU A;  1JYD A;  3OJY C;  4IB8 A;  4OS0 A;  4NLI A;  4YFR A;  1IFB A;  2FS7 A;  4IBA A;  1TVQ A;  3RWX A;  3APX A;  4EXZ A;  1KZW A;  5HZQ A;  2MJI A;  2CZU A;  1DZP A;  4ORU A;  2KTS A;  4YFP A;  2GTL N;  3FEL A;  1I05 A;  4YMY A;  1G7N A;  5L8I A;  4ORS A;  4TNN A;  3EM0 A;  2CBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...