1A97A

Xprtase from e. coli complexed with gmp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
144
Chain Sequence
EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVAISSYDRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
publication title Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphoribosyltransferase
total genus 42
structure length 144
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a97A00
1DKRA 1J7JA 3OHPA 4RHUA 1ECFA 2HCRA 5ESXA 4JITA 4PAWA 1I14A 1A96A 1G2QA 3G6WA 3LPNA 1NONA 1XZ8A 2JKZA 1I13A 2WNSA 1ECGA 4F8EA 4P80A 3GGJA 1DQNA 1QK5A 1IBSA 1UPUA 3DAHA 4PFQA 3DMPA 3QW4B 1DQPA 5HIAA 1D6NA 1QCCA 4IJQA 4QYIA 4X45A 4X44A 5HKLA 5E38A 1U9ZA 4Z1OA 2PRYA 3LRTA 4RACA 4M0KA 1P4AA 1I0IA 4MB6A 2PRZA 1JLRA 3H83A 1A95A 1XTVA 2JI4A 5KAPA 2XBUA 1QK3A 1YFZA 1QK4A 1L1RA 5K51A 1A97A 1G9TA 5IAOA 4P81A 4LZNA 1DKUA 1VCHA 4QRIA 5EUCA 1MZVA 1TC1A 3HVUA 4WMLA 1GRVA 1OREA 1O57A 3O7MA 1V9SA 1BZYA 4RANA 4LZOA 4RV4A 4LYGA 2DY0A 2GEBA 1CJBA 4M0UA 4M0PA 5BQPA 3OZFA 4JLSA 4P86A 3ACBA 1LH0A 1ZN8A 4P83A 2YZKA 3GGCA 1BD3A 1PZMA 4P82A 1P18A 4S2UA 2JBHA 1A3CA 2JKYA 4WN3A 1QCDA 4ZFNA 1NULA 1QB7A 2P1ZA 4OHCA 5BQOA 4FYMA 4RQBA 4LZAA 1O5OA 1STOA 1HMPA 4KN6A 1R3UA 2C4KA 1ECJA 4P84A 4RHTA 5BRNA 2EHJA 3N2LA 5ESWA 1VSTA 3MJDA 4TWBA 1I5EA 1BD4A 1ECBA 1QB8A 1JLSA 2AEEA 3GEPA 1XZNA 3EFHA 3KB8A 1A98A 4LYYA 1L1QA 4QYIB 1Y0BA 4RADA 4RAOA 1OROA 3OZGA 5IPFA 1XTTA 1UPFA 3MBIA 1FSGA 4RHXA 5BSKA 2H06A 2H07A 1U9YA 4RQAA 4RABA 4P3KA 2FXVA 1AO0A 1I0LA 3DEZA 1G9SA 3ACCA 3NAGA 4RHYA 2PS1A 1ZN7A 1A4XA 1P19A 1WD5A 1G2PA 2H08A 1DBRA 1Z7GA 1P17A 2IGBA 1HGXA 1OPRA 1TC2A 5KAMA 1ZN9A 3M3HA 2VFAA 1ECCA 2E55A 5JSQA 4RAQA 1UFRA 1VDMA 3S5JA 3ACDA 1XTUA 1GPH1 1W30A 5JV5A
chains in the Genus database with same CATH superfamily
4CTMA 4PLZA 1E1CA 3BBLA 1BE1A 4JVOA 5HCIA 3DV2A 3L7JA 1P5RA 2FYTA 3B9PA 1CJCA 4RV5A 1P80A 4N12A 3UG6A 1VSVA 2UZ1A 3PQDA 3ITDA 3P2OA 4JCOA 1P3Y1 4JD5A 4K3VA 3PI7A 4ENRA 1DV1A 1V1RB 4AYXA 1K7FB 3MGBA 3VKUA 4D9EA 4EAAA 3FLBA 4DOMA 3F49S 4MR7B 4E46A 1DQPA 1PEKE 2FVXA 1XYGA 3QKUA 3DMNA 4C7VA 1EQAA 1XRMA 1EBBA 1SXJB 3Q11A 4F5ZA 4ENQA 4DSTA 4CM1A 5T4HA 1NQTA 4XD7D 2W2KA 1E5QA 4BVJA 3VPDA 5M34A 5LNK1 4QGAA 5JDCA 3AUFA 3MMSA 2NWQA 1GNVA 5AKHA 5ALYA 5CBPB 4QOIA 1SVIA 5H70A 2L69A 2X9GA 3P2KA 3Q8MA 1LS1A 2WHYA 5AVRA 3RJ5A 3B53X 2B4RO 5C0OE 4KO1S 2VPIA 4RVCA 1KGDA 3WGYA 3DOCA 2H7VA 3FMIA 3X1DA 1WXHA 4EO4A 2REQA 1GPBA 3OZCA 3PGA1 5CGZA 5GM1A 4DSOA 1BS1A 1XDBA 2H63A 4DMKA 2OSBA 1O57A 1AZTA 1PG2A 1QRAA 3AY7A 3L6OO 4RZXA 5DI3B 5ALLA 3W1EA 3W8EA 1ADJA 4BAUA 4E11A 4IIEA 2OC9A 4MCHA 1RI4A 3WHIA 1P5HA 1LCIA 1RADA 1QYDA 1I3NA 1MHPA 2HMYB 4ITRC 4CIWA 3IDZA 1YFLA 1H42A 4PF1A 2W2MA 4KAAA 2QTLA 3ZIDA 4ECEA 5A4MS 3NC0C 5J47A 4E3ZA 3SJBA 4MP8A 5K3FA 3RVBA 3Q9SA 3TQCA 1QR2A 3ZZ0A 2ZULA 4MV8A 5CA1A 3A6HA 3KWJA 1Y4UA 1QB7A 3RE1A 1Q1ZA 4DSUA 3CZRA 1QG2A 5AM5A 3TNYA 1HXHA 1RXUA 2R97A 1CTQA 2HL6A 3IP5A 4BVFA 3MMPA 2ZI7A 4RU1A 1HE8B 1NP6A 1QF7A 4PLWA 4CBVA 5LM3A 3NIGB 5BOSB 1W4BA 3FPKA 5ILOA 1ZISA 1W581 4M1MA 2WUVA 1SOVA 3MJDA 2ODQA 2XVXA 2QUKA 1KDRA 1TA0A 1ZVKA 4E14A 4MJ3A 1RQLA 1GTSA 2X6QA 1RWWA 3O2NA 4LWQA 3SQMA 1JA0A 4BCDA 4EB6A 1JIJA 2VDWB 2ACKA 1AKWA 4QHSA 5AKGA 2PL9A 4MWGA 1XJ0A 2D0IA 3KIPA 3L79A 4I1IA 1O6GA 4JA0A 1USUA 1NTRA 1JEDA 1MORA 2TRSB 3UO8B 4BJ1A 2VP4A 3LTEA 2YL2A 4XXHA 3I2YX 4M46A 4YRJA 3T54A 4HV4A 4G5RA 1DEXA 2PX3A 4CLOA 2GCOB 5JAQA 3RG8A 3H9QA 3TR6A 3VGJA 3FCCA 4PAOA 3EVAA 3RC1A 1U0HC 3HS3A 3HYNA 5TJ9A 4D9JA 1WHSB 1NI4A 4MPPA 4RPCA 2QW0X 3QOFA 4FI3C 3WHLA 4DRZA 4ON9A 5AKZA 3A6DA 5DTEA 2XUJA 3U4CA 4B5LA 1J2TA 4NI5A 1V6CA 3VU9B 4DJDC 3CO0S 4KUGA 3OHMA 1XNQB 2RBEA 2YFHA 2X6TA 3BCUA 3U0VA 3IRUA 4D9IA 2FGKA 4EEXA 4NICA 4BFTA 4CQJA 8ATCA 4UE2A 3ZX5A 3FFAA 3CEMA 2IGTA 3VUEA 2GZRA 5HK9A 4D79A 1W5EA 4R2JA 5A71A 1K97A 2HOQA 3R5FA 4HPWA 1G6Q1 1F0NA 4NWIA 2OUKA 3H9UA 1LPNA 1ULZA 2IKSA 1IWOA 1P9OA 1Q83A 3GC6A 4KDFA 4MW6A 4Q9KA 4B7AA 4B3CA 2HN9A 1UR5A 3CFYA 3F7MA 2QA5A 5CH5A 2KQUA 3UB3A 4CNBA 1B15A 4MKGA 4ZI7A 2DR2A 3NJRA 4YPFA 2FZWA 5JEEA 2CVPA 3T5GA 4J2HA 3UK0A 4L6CA 4BO6A 3WWPA 4DARA 2HBZA 5C32A 2ZPUA 3CCCA 3ZN2A 2VN8A 2P2SA 4OQPA 3BWCA 1BVRA 1UC8A 5EUBA 3PE4A 2JH8A 1YZTA 5HIAA 2V7QA 4C2BA 1V16B 3FSGD 5LCXA 4JHLA 4E1BA 2F3TA 3C1TA 4GP6A 5BN5B 3EPJA 2JAUA 1VPLA 3BCRA 4YFYA 3UCXA 5EJ9A 4QU9A 7GPBA 2R8BA 3KD3A 1JEAA 1FFCA 3EGVA 2XA1A 5DEIA 5F2NA 2I6FA 3PU6A 1G8SA 1M67A 3EQ9A 4OM7A 4E08A 2YS6A 1H0KA 4YAGA 4J7UA 4KQEA 4TM8A 3DEKA 3H5VA 1FFAA 3OO0A 4MKFA 2I3DA 4X85A 4HVLA 4YCJA 4R1OA 3RVMA 2FJ0A 4WGFA 4EG6A 4HS4A 3RC8A 1GZHB 2R7KA 3GVIA 4ND6A 2ATEA 2GF2A 2IYQA 4O4LA 5EYPB 3A37A 3H04A 3RWBA 1W7AA 5HP4A 4H59A 1X19A 3BHNA 3W6NA 4MV0A 2QUHA 2PSEA 4IUCS 4KOAA 4UU7A 3INNA 5IJZA 2AI2A 3L8MA 4PWZA 5FTLA 3ER9A 3G0DA 3BE4A 4BN5A 3EE6A 1GDTA 5HUJA 1I6WA 2Z95A 3DTVB 1QQ7A 4IIDA 4DKXA 4DV4B 2FEOA 4NR0A 1QDEA 2BF4A 3IPAA 3K2IA 3WL7A 1EKXA 2BUBA 1C30B 4J2OA 1FW8A 4J1TA 2IUSA 5DX0A 3ZCUA 1OZHA 4CM4B 2HCTA 3N76A 2MSLA 3PQEA 4RF3A 3A27A 5KEIA 4RD4A 1A77A 1JR4A 2IPXA 5EP4A 1W1WA 2C3UA 3L6BA 1ZH8A 1ZW6A 1ODSA 4M99A 4UOEA 1W1IA 2VJMA 1RJEA 2GD2A 3F90A 2LDXA 4ENWA 5KTMA 5AW3A 4CGZA 4WNAB 3LHDA 1EX6A 1X15A 1Z2NX 1CQIB 2PMDA 3KQMA 1IN5A 4LECA 3TFWA 1E92A 4LJSA 2B35A 1GNRA 2Z08A 6YASA 1U04A 1L4GA 1OXKB 1UZMA 4H6VA 4AKIA 1D4OA 5AVXA 3N8NA 4W5OA 1NXQA 1X74A 3BIOA 4OL0A 4ER7A 1AUPA 2F3QA 4ZI5A 1XRRA 2WHPA 3E8SA 3UFXA 2XCRB 1CW2B 1J70A 1D09A 2BFDB 3BORA 3NEJA 4M7PA 2O4UX 3BUSA 5DW3A 5NULA 1OZAA 1J0XO 3GLTA 1O6FA 4MINA 5JXHA 5CDUA 3V1LA 2NYUA 4DNXA 4YP1A 4BP8A 4TKLA 3OQIB 3OD5A 3LGSA 2RAPA 2WOJA 3GJ5A 1AKRA 3OIFA 2MSKA 4KLCA 2E2WA 4PO3X 4U2BA 1M66A 4XJSA 1WB9A 3B13B 1XAGA 2WAMA 4QEZA 1I5RA 2Y1EA 2IHKA 2JAPA 2ZTSA 4UUBA 4HHEA 2YN0A 1W44A 3QIVA 4P3XA 2EL7A 2RC5A 4R41A 4H7IA 4A6DA 1LFAA 2HV8A 3VA7A 4ZT7A 1WV0A 3EGDA 1OASA 1PTKA 2OYRA 3W05A 3ZZTA 1M6HA 5CM2Z 4EITA 3V6MA 1HFWA 1JU3A 1VLMA 3D3KA 3GJRA 4JWTA 1KI9A 1EGMB 2J3JA 1M7BA 4PG6A 4YJ2B 3KHSA 4DEYA 1Y7TA 1UBNA 3ISJA 4DPMA 1EVIA 1WMBA 2W2LA 4D96A 2IKQA 5TS2A 3ASUA 3B51X 4EX7A 1GFWA 2YNMD 2JLYA 4PLCA 1Y8CA 2ZRAA 3AH8A 3OT1A 5IAJA 4GMFA 1FDSA 1H1DA 3I30X 4BEJA 2DCMA 5F12A 1NRWA 3S44A 2P2GA 4NVRA 5FFNA 1YJXA 1EBFA 3K32A 5B57C 4NJMA 1YDFA 4DNOA 3L0SA 2IUEA 3IIMA 1Z83A 4I4TF 3C0KA 4YLGA 1EGAA 1OJLA 1XJQA 2ZUFA 3OOYA 1CS0A 2WF5A 3I9JA 2HV9A 4YO7A 1ETHA 3E48A 4G67A 3GLGB 5JDIC 2AMFA 2C20A 2BEVA 4CV2A 4N0QA 3QXCA 3R3YA 1L5OA 4P3PA 2ZT7A 4BB9A 2PA0A 3W8FA 5KWSA 2J41A 4PRLA 4I1PA 1Y3IA 1T25A 1KQGA 4IRXA 4AQYB 1JHOA 3MTDA 1NI3A 4ZA2A 4MVXA 5HK8A 5DPMA 1NY5A 1X9IA 5HZHA 2ZROA 3GIDA 3I61A 1SVKA 5CJPA 3U7FB 1YE8A 4L5BA 3QHQA 4ENTA 3MT0A 4KU4A 4REQA 2J48A 3MWJA 3WSWA 5FPTA 4EO7A 3ZV5A 4CL8A 3IESA 1SQFA 1PVVA 3HUDA 3MAGA 4BS9A 1RWVA 2DB3A 1DXHA 4X1KA 4W4TA 2F6RA 2XOKD 3TE7A 3HFGA 5ALZA 3RBZA 3STUA 3SZRA 4RLFA 5KB3A 4BNWA 3OTWA 1QIDA 3EVBA 1KY5A 2BMDA 1WEKA 2H0RA 1GQYA 1GFZA 2QV7A 3RSSA 8ABPA 2GGSA 2OBXA 4LHEA 3TRIA 3OO1A 1WDLA 3D8BA 1U3GA 3V5NA 3TRFA 3LY5A 1Y9AA 2X7JA 4CMAA 1J24A 1W94A 2D3WA 3IMCA 3NVAA 4JDPA 4R9SA 2C3OA 1U31A 4MIYA 4WKNA 5IKEA 1B93A 1EJ0A 3L04A 2VHEA 3BTSA 1NQOA 4GNRA 4X5OA 1VL1A 5TQ2A 2P68A 3AINA 4ND8B 1C3JA 2DKFA 4MEAA 3RC9A 3WK6A 5JPCA 2W6QA 2NMVA 1Y4DE 2FRDA 1Y8QA 4TWAA 2UVPA 1O4VA 2QG6A 3ZGYA 5THQA 2AN4A 5DI9A 3U4DA 1JDBB 1XEAA 2GXQA 3AHCA 3C45A 3RKUA 2ZBPA 3HLYA 3G8CA 4BEVA 2KW5A 2A0UA 1PKEA 4EKIA 2FU5C 4BNHA 3L7LA 1V26A 4MVJM 5KJ6A 4KUHA 2B1JA 3D0QA 4JK3A 5HIKA 1PUIA 3RK0A 5EJMA 4JV5B 1F2TB 2ONYA 5CGQB 1JFLA 4E1AA 3TLGA 1L4UA 1PQPA 4Y6RA 3QFFA 4A26A 5ALVA 1N6NA 3T5MA 5G1NA 4BLTA 2IH4A 2AOTB 1M34E 3AKZA 1V0JA 3ENKA 3RYIB 3TDMA 1OFGA 2HDNB 2X0EA 3GLFB 1DAEA 2GTIA 3L0ZA 2RH8A 5HSGA 3W5BA 4EA7A 3THXA 4FS8A 2HSEA 2Y2VA 3KU4A 2QP9X 4BKPA 3QF4A 3CVOA 2WJ6A 2ORIA 1DX4A 4IHQA 3B52X 3L05A 2B3TA 4R3UC 3DMFA 3QI7A 3WL6A 5L4NA 2EP7A 4CMGA 2VYND 4JROA 1UBTS 3M1YA 3Q9UA 2JFOA 2UYQA 1CERA 4JQOA 2HT1A 2C2BA 2F3RA 4R7GA 3I62A 3MN1A 1NMSA 2ENWA 3IEPA 3M2PA 4PQRA 4Q1DA 2A7QA 4Z1OA 4G41A 1CPYA 2XGSA 2GQ0A 4JLJA 2H00A 3CTMA 3RYHA 5GZ1A 1R18A 4MUFA 3T5BA 1U5BB 4E4YA 3VOSA 2IYEA 2AOXA 3P32A 5JDIA 4XCVA 5TARA 5F9MA 2YC2C 2VZLA 3G9UA 2B7LA 1FRQA 4RNDB 3WGTA 2Q2OA 4ZO8A 3A6EA 3OU2A 3GA7A 1R0XA 5KQLA 1IJKA 2XE8A 3BPSA 4M9UA 3EWSA 5HCUA 3RV3A 2VPYA 2Y1DA 1IK6A 1S7CA 3BD6A 2IWHA 2ZYWX 3UV3A 1D0SA 1Z36A 2PLNA 2DULA 4PZUA 4JBGA 5CW2A 4BNJA 3L7AA 2X8AA 1KL7A 1CUZA 1PWXA 3FCAA 3QE4A 3VPXA 2GD0A 4Q3BA 4N7BA 3WADA 1QBKC 4FMCF 2AOUA 4FBGA 4FK8A 1EXVA 1FX0B 1YQXA 1U28A 4DBLE 1ZCBA 3TBKA 1CT9A 3H2SA 3QLVA 4M9XA 2QTHA 1CR6A 2XYRA 3ZDYB 4WFQA 5LQAA 4F8JA 3FYCA 4CZ2A 4XLLA 1YB4A 2AG5A 2NQ8A 1Y5RA 3ZDEA 1QO0A 2ZR7A 5F51A 3E70C 1W6RA 3D8UA 4GSLA 3SHTA 5B1EA 4LOKA 1CWUA 5LQCA 3BCSA 1SOUA 2X2EA 2ZJ7A 3BVPA 1KYIA 2PT6A 4LJYA 2P9BA 1CE8B 4I7EA 3UVEA 1ZZGA 2IY8A 3R7NA 1G8HA 3G23A 4L07A 1UP7A 4MHOA 1Q0PA 4M6WB 1NQXA 1U3FA 3MEQA 1UWKA 1SIOA 1Z74A 2HK9A 1E3IA 3NC1C 4GICA 1QQ5A 2BTQB 1CB7A 1O58A 4EQ6A 1U1IA 4CUJA 5JI3E 3H6KA 1RI1A 2AIRA 2C95A 3PKJA 3R6DA 2I54A 1Z28A 2O3JA 3HO6A 1JWAB 3I64A 4OU5A 2JLXA 3B8EA 1LDEA 1OC2A 4A4DA 4H7FA 2BIFA 4JJEA 1U0SY 2G36A 4X8OA 5IU6A 1CJMA 2V97A 4YYEA 4KO3S 1IOZA 1T1EA 1M8JA 4FT4A 1YR1A 1DHTA 2MT9A 4K86A 1K7EB 5HUQA 2AFIA 3HYRA 4IDEA 1CY4A 1EFAA 1PJBA 5AKLA 2AV6A 2DUMA 3QPAA 3D6AA 5K45A 4J4HA 5KOYA 2C9ZA 1IB0A 4FONA 1AA9A 1YZFA 3ADOA 4KMMA 4B35A 4B4OA 1RAGA 1QVRA 1UIMA 2C82A 1X2BA 1Y3BE 4NOJA 4YMWA 4NZNA 2FW6A 1OCEA 2Y1GA 3DG9A 4ERXA 3DHWC 1RLOA 2I2AA 3AF0A 2R5NA 4FFSA 4Y9TA 2Y8EA 1CB0A 1YBMA 5FTMA 1KYXA 1FK8A 4TT3D 4B3MB 3UUGA 4GAEA 1UBEA 3OKCA 2JCXA 2VUUA 4BECA 1Y8RA 3ZHZA 5BSHA 2QZSA 1V3VA 2Y1WA 1KTVA 5CR9A 4S12A 5E9QA 2VRNA 4DR6B 4E22A 4FDLA 3OZWA 1I2MA 1L9XA 1PZGA 4KIUA 5ARCA 4QBGB 3HU3A 1LJ8A 1FJGB 3W3ZB 4G65A 1P2FA 2IT1A 3CRRA 3VDXA 3S8MA 2E87A 2H2AA 2RH5A 4PRZA 4CM3A 4DV3B 1P29A 4BNVA 3J81k 4QICA 3LKVA 3GFSA 5JJIA 2V65A 2VRCD 2BBTA 4FX5A 1HE4A 4QPDA 4XB6B 3EEOA 1JHUA 1TJ4A 4IYRA 5IMSA 4HT3B 1JGTA 2F7SA 2YXDA 2B25A 3PPXA 5IBRA 2O7SA 2I8CA 3LH5A 1UC4B 3P4YA 1L4BA 3ZHYA 4I8DA 4AL4A 1F7UA 1JHPA 2QSUA 2BGWA 3VJRA 2EFGA 3MUFA 1H23A 1YFZA 2YJTD 3GZ4A 1H22A 3ZWOA 4EUEA 3BMCA 4ZEMA 4NECA 1XJCA 2QN6A 3KZMA 4FDVA 3VOAA 4BB0A 2MDTA 3A3YA 2GRAA 4ZAXA 1B76A 1V9SA 3NP9A 4O1IA 2ODAA 1L5HB 1Q77A 2QUAA 4B4WA 4B3IA 2QLNA 4EMUA 3FTDA 4G37A 2VDLB 4RV4A 2FMFA 1IUKA 4BQFA 1N2SA 3I04M 4BX2A 5JFGA 4DV0B 2AN9A 3BD9A 1CYDA 1E6CA 2CD9A 3P0RA 5HJ7A 1ISGA 2ZTLA 5KOJB 2GZAA 2J4CA 4N0MA 2C2XA 3DULA 2E37A 4EF4A 3ZBPA 4WJKB 4QOSA 1JDTA 1WR8A 2CJWA 2JBAA 1DQRA 5ALDA 5CITA 3IEIA 2IIQA 2I8LA 2P1ZA 2YXEA 3FYUA 1W4CA 3N8GA 3CLUD 1NHGA 5BSGA 5JCOC 5TPWA 4N6NA 4Q9IA 3MK31 2B0JA 1LPPA 4PU0A 3EA0A 4M86A 4U2KA 4ZALA 3UOGA 4XRGA 2IU3A 4YJKA 3CEHA 4B2LA 3CUWA 2EV9A 4KMOA 2ZSUA 4LJ5A 1TRHA 1U7DA 1ZOSA 1U0BB 2YOFA 5C5CA 4UHBA 1AH2A 4HZGA 1VJCA 3LP5A 1N9ZA 5FV7A 1N33B 1ESDA 1GPWB 2AXQA 5EE3A 2WWYA 3EDYA 8OHMA 3WB2A 4EKGA 1FQOA 1DJLA 3E9QA 3HZOA 1T1IA 2PBFA 4LYJA 4P4GA 2CYCA 3QU9A 1AHIA 1XZHA 4TYMA 3HNRA 3FOFC 3DKIA 1KY2A 2HXYA 1Q0LA 4NZ9A 1NMYA 3OCVA 1OAAA 1J99A 3A04A 5AM0A 5D7BA 1AKEA 2CXUA 1TU3A 4WADA 2Q5HA 1Y6QA 2BEUB 3V1UA 1P1JA 2C98A 2OD2A 5CLIA 3JQQA 1GXSA 4PZDA 3RRBA 2ZQYA 2QRVB 3VSAA 4GKKB 2F48A 1GL7A 3DE7X 3N6VA 3O9MA 2GHIA 1CF2O 1GUYA 3QV1A 1NXSA 5JEDA 1KY4A 2BGIA 3ZLVA 5DTIA 1M1XB 3IO3A 5ADHA 2QI9C 1JKIA 1B6RA 2FSUA 4B7UA 4L72A 3VH4A 3ZC3A 4R8MA 4ZHQA 1M0TA 1LW7A 2WF9A 4JJ4A 5COQA 1G64A 1Q20A 2OWDA 3FDXA 4JEMA 4Y9RA 1UL1X 2NV0A 2O2GA 4Y2RA 3SF8A 1Z5NA 4C21A 4ZV4A 1Z35A 1L5SA 5I5GA 5KNDD 1GSOA 5FPSA 4F2WA 2WWFA 4DSZA 5L7WA 1OLXB 3MQ2A 4WESA 1UOEA 2NO6A 3DONA 3PWSA 2F2TA 5IP5A 2WYIA 2W6OA 2LE0A 4Z0HO 4BQNA 3PUZA 3KTFA 3TSCA 1JA1A 3G2KA 1LW6E 2GBLA 2F9MA 2JATA 4LZJA 3UV7A 4PN7A 3ZWWA 4HGQA 3IUNA 5I7SA 2FW9A 3HXPA 3NHBA 1CX9B 3NETA 5HIIA 4RGQA 2IH5A 1CQPA 3V46A 4MKZA 5I7UA 1UF9A 5HQ3A 2HXGA 3GOHA 2VP0A 3M1LA 3B6JA 3GQVA 2YHIA 4V2UA 3ZPXA 4IFEA 4RXTA 4U5XA 4D4HA 3AWIA 2VZ8A 5J5VA 5KQSA 3U4QB 3AWDA 2O0MA 5DGDA 5HIJA 1VL5A 1P3JA 1W2WB 3PA8A 2BHTA 4HLUC 2XMPA 5FHRA 5CCBA 2FEXA 2YJNA 3EPKA 1ZA1A 5F9FA 4JP5A 1T0IA 1T2EA 3C4JA 1YBAA 4YBZA 1X77A 3GRAA 1Y98A 2WSMA 3Q2OA 1BDHA 2Q1XA 3B9RA 5SZHB 1OXMA 4XDHA 1TT7A 3KP1A 2AEJA 1QHHA 5JECA 3WK4A 3FOAA 4YV7A 2V9PA 1XNJA 1M1NB 3F5QA 1QANA 4MR8B 3U56A 4KFRA 3JY6A 1W49A 4I3GA 4LNUA 1CY2A 3EBOA 1GTG1 6ABPA 4F9FA 2ISCA 4TM7A 4DZRA 2C5SA 2HWWA 4GYKA 4IDPA 1E2KA 3RQIA 4WJLA 1P9WA 3U1VA 2ZJFA 4O4HA 4XFJA 1QG0A 5FT9A 1X3SA 3ND8A 1RYMA 2PZEA 2RHOA 3WKDA 4ZN6A 2IX3A 2QGZA 3HJAA 5F1YA 4WEQA 1ANKA 3CZCA 1CDZA 3OY2A 2HEIA 1HLGA 4JKOA 4L50A 4UHJA 3MWYW 3UENA 4DA7A 1EK2A 4FYXA 2MSCB 2BTOA 4BBPA 3RIYA 2LBPA 1X0VA 3HGMA 4W6ZA 1JFVA 4Y2QA 2OV2A 2PE5A 4JB0A 1Q15A 2QD1A 3W9UA 5B3KA 1RVV1 1HRKA 1HC7A 1RPTA 2HA5A 1U2DA 1ZRMA 2JJ2D 1MA3A 1FNMA 2PHZA 1N0VC 1SUSA 3VZCA 4EELA 3DOIA 5AD1A 4ZAFA 1IH8A 1JJAA 1LVUA 3K15A 3BDAA 5C8YB 1MPXA 4BKMA 4KPFC 4KDCA 2WWVD 4EFDA 1Y4ZA 2BM9A 2QUBA 1HSZA 3CRZA 3DXFA 3OECA 4IXDA 3TL3A 1XO1A 1B1CA 4I1VA 1UC5B 1PNOA 2DPLA 1G98A 2EKLA 4R1UA 1Y7LA 3QP9A 2X13A 2RGNA 3EFOA 3F3SA 3I9LA 3NBYC 3TLEA 3ZW9A 3JSAA 4IDQA 4CKWB 4ZDIA 3AOEA 4PCAA 2REBA 1RC0A 5CK4A 4RA9A 2BMFA 3B1XA 2NNWB 1K27A 2O3QA 4RFSA 4G0QA 3RLIA 4ZJPA 1G55A 3URMA 1WCXA 5B64A 1HZZA 4KTVE 4ND1A 4RD3A 1HYQA 1K1EA 1XZCA 2Q3JA 3GEGA 4H4EA 4OQMA 4ZMSA 2FRXA 1JHQA 1NQAO 1X7WA 3KZOA 4A91A 2EJWA 2IE8A 3BYZA 3W8DA 4BYGA 5JSYA 3H18A 1UT8A 3K0EA 1W46A 2N47A 2P7HA 1IG0A 3B5EA 4WLOA 3EG5A 5F33A 2Q50A 4L4YA 3ETLA 3M5DA 2MMGA 3EA4A 4LVUA 2MTBA 4DRXB 4LF7B 1WETA 1H5NA 3ZVNA 4BNKA 1G2QA 3QXJA 1KVUA 1YL7A 2I1LA 3RTAA 3DE1X 1XRNA 2J09A 2ZP1A 3O3OB 4AB1A 4XVCA 5B1DA 4OM8A 3PHHA 1D03A 1EFHA 3S1LA 2XOXA 1XVAA 3EBPA 4RTLA 3IBGA 1JIUA 1JG3A 1RAFA 1VBKA 2FZ4A 2ZSAA 3PEUA 3EAGA 1AMNA 2WT4A 3UOWA 4A0FA 1UCFA 2H51A 3RDPA 4P0TA 2NU6A 2PRYA 5LMUB 4MR9B 3A11A 4HPXB 4YBRA 5FIUA 2FN9A 3DDNA 4BGDA 3THYB 5IVPA 2GPTA 2ECQA 2L0XA 4PR3A 4BGIA 1ZL0A 3ZEIA 5F23A 3T6KA 2CVZA 3OCCA 1HF3A 2HJVA 1RWKA 4ZOBA 3VHLB 2FR8C 1NZDA 3NBUA 1Z38A 4FDUA 4HK4A 5DWDA 1UPCA 4A8JA 3O7MA 1HMYA 1OXUA 2WU0A 3HKCA 2IS1A 2XMGA 3KD2A 1V4NA 4BRUA 5DYYA 1HH4A 3VTKA 2J3HA 5FCDA 5JALA 3EMBA 1Z0UA 2GILA 3NEYA 5FADA 5ARBA 3FVVA 1JEOA 1T0HB 1G5IA 2CF5A 1E2BA 3TOXA 4HB2A 2ZREA 3FJYA 3TUZC 4BXOB 4OHWA 3ZU5A 2EZ9A 2JBHA 2JEOA 1S3SA 3OP4A 1D6SA 1SD2A 1UMCA 3CH6A 2Q4TA 3EZ2A 3IQGX 3MD9A 3OLWA 3P1JA 3F71A 3LCMA 4DWWA 1THTA 4XWOA 4G23A 3CRW1 2GBIA 2WAXA 3UOAB 3BKWA 2HSGA 1RRVA 1XZFA 4X71A 3WBJA 2WEKA 5J4HA 3KXKA 4FHCA 1IYZA 3MSCA 3VDRA 4JOSA 1GZ4A 3GI1A 4YB8A 1NNEA 2P5TB 5PGMA 4LZLA 2XE7A 3IP3A 1MGPA 4FILA 4Q9LA 1XF9A 1Q92A 1R8SA 4BB6A 2G4CA 1JKMA 3NBAA 1X1TA 5L3RA 2JHCA 1HQDA 4EO9A 1QHFA 2VAMA 3ZZNA 3ZV7A 1PTJC 4MGKR 4HJRA 2NVBA 2CFTA 1XQYA 2YMQA 3I6YA 3DZDA 4FGUA 3JZFA 2O23A 4NYIR 5G0UA 1M2GA 4MLPA 3TRJA 4LY0A 3ONWA 4RVDA 2H07A 2CHEA 2XQVA 1N7GA 2XITA 1QE0A 3F7TA 3DYBA 3QPVA 1VKNA 2PIAA 5IFLA 3TR0A 1W4AA 3PWZA 5A3SA 4TWRA 1XXHA 1PJ4A 4JR1A 1CIVA 4KR7A 2D2VA 3GG9A 1FSSA 2FHSA 3FVTA 4UUOA 3ELWA 1PFGA 1ULAA 3G8BA 5AK6A 3BB4A 2ZB2A 2DJIA 4WW0A 3VMMA 5C5DA 2DFPA 4IEFB 1EE2A 4BL5A 4Y2TA 3JD4A 3LDHA 2GPYA 5TEWA 1SH7A 4F5WA 1KC1A 3A9RA 3KOMA 3PICA 4L8WB 4RAQA 4S24A 2WSLA 4PN3A 3CC8A 4IIJA 1CF9A 3E1SA 2RHRA 4PZLA 1A7AA 5HTKA 3ZCSA 1NVFA 5SZIA 3SY8A 3A6PC 3FROA 4U3JA 4KFTA 1J0DA 1I14A 4GLBA 1OH5A 4KBGA 2V5AA 1RWXA 4KIWA 1JJBA 4FGZA 2Q9AA 3JAKB 2J0UA 1JJVA 2X8WA 4J0HA 1LX7A 3AT1A 3HA5A 3HB4X 3Q98A 4NXNB 2BEJA 3N7AA 1U98A 1UQRA 4UMVA 3VX3A 4KW7A 4ZICA 2WW8A 4LDPA 1IZ7A 1IWPB 4QATA 4EB0A 4MLDA 1EM6A 2BR4A 3C1UA 5KMGA 4B75A 3TRHA 3L49A 5EMLA 3R7DA 1H2HA 2AFHA 3O1IC 4G8CA 3S2UA 2BHNA 3C3XA 4I5EA 1BCRA 1SY7A 4F84A 2PKRA 3H2BA 3ZXUB 1UUFA 1IXRC 3LT0A 1ORRA 2TSYB 4NHEA 1E1NA 4CN8A 4OHXA 1LSSA 1WLSA 4G84A 5FNVF 4ZREA 4AZ0A 4YT8A 4LZPA 3VU8A 7ABPA 4YCBA 3BSFA 5SZJA 1RLUA 1Q7EA 3REFA 2P6PA 5EZYF 2C4WA 1DADA 1RJ9A 4JASB 3JTEA 4N8DA 5KKAA 2EATA 2NO0A 4QDKA 1EFPB 3C48A 5E1OA 5FUMA 3N6XA 4KKVA 1KPIA 2B21A 2B34A 4K28A 2DFDA 5LA6F 2QMUA 3L93A 3SKVA 3ESDA 4BZWA 3FFWA 1XK6A 6CHYA 5ICMA 3U13A 4CCSA 5KPDA 2BMWA 4G0MA 3IV9A 2G72A 3QLVC 4BHTA 1OLUA 3HDVA 1FDVA 3M83A 4D9BA 1EDDA 1SB8A 1XTZA 2GD6A 4B79A 5JQWA 3ASYA 4URXR 4TXNA 2ZYDA 3JZMA 1GGJA 1F8GA 2CB0A 3FPHA 3QMWA 1T4DA 1Y6RA 5CU7A 3V4PB 4EPVA 1BXRA 5REQA 1S8FA 4OGWA 4AAYA 4CF3A 1ZD9A 3O73A 3CH5A 4LVOA 5C5IA 1B73A 5ES4B 2FX3A 3IV6A 4YAWA 5JVDB 1AM4D 2RMKA 3LHSA 4TT3A 4WERA 3RSHA 1UK9A 2W6JA 4ALNA 1YGPA 5IF3A 1K9SA 2QZPA 2NUAB 2PUDA 2CE7A 4QGFA 3GCDA 3SFTA 1X7YA 3WDLA 1U1EA 1US8B 4KE8A 1N6LA 4R8SA 3NEAA 4QXQA 3SKXA 1F2UB 3A9TA 2QJTA 4QOGA 2JGIA 3QU2A 4D97A 1QP7A 1MRSA 2FWNA 2RGEA 3PSHA 4CEJB 2EJBA 1PLLA 1DWUA 1I7LA 3HGQA 3PJEA 1UXKA 4IX1A 4TYWA 2XMQA 1M7GA 5E6RA 1JEQB 3M2TA 4LDAA 3GGGA 2IHNA 1YMUA 1GQQA 1R1DA 3SG0A 3TEFA 1U9JA 3M9LA 3AEUA 1ZVMA 1DAKA 2RK6A 4GR9A 3ZWKA 5FUWA 2IXDA 1MAWA 1EG7A 3OQ1A 3QUBA 4J76A 4L0DA 1ZUWA 2C9YA 4QEKA 4TTQA 4E4TA 2ZR9A 2B36A 1YZQA 2I3GA 3H87A 4MMXB 4ARZA 4EQZA 4OJTA 1B6TA 4XYGA 5A5DA 2AB0A 3TFOA 2WD8A 1LSOA 3COVA 2WP0A 4R81A 3WGGA 4QUDA 3UQYS 4H7KA 4Y2GA 4B40A 2FOLA 3M6WA 3DHEA 2O8CB 2Q49A 1KZ7B 1P75A 3MRTA 5CFPA 1MCZA 2ZITA 3ACDA 3Q85A 1AQNA 1PR9A 2CXRA 1V5WA 1DKQA 4BNLA 2FK8A 3EZYA 1LFDB 3OX3A 4MW2A 1IXYA 1JR3A 3T1TA 1J97A 1O9HA 3RHSA 2P69A 3UYLA 2EVWX 2ATCA 2AX4A 3DTNA 4LMRA 3QG5A 2GEDA 2I4TA 1J9EA 2ZWPA 1KDPA 1FUIA 1V1JA 3ENZA 1JXAA 3M82A 3OUTA 4UCFA 3TQQA 3WKAA 1A5SB 1RSZA 1ZD2P 3ZGNA 1N5OX 5A1JA 3HZZA 4DQKA 1TMOA 2AZXA 1ZNWA 3H9JA 1F3OA 3K5HA 4D41A 2NZUG 3MJ4A 1EFCA 5ELMA 1QF6A 5CJ2A 3EIFA 1U0GA 3ZVLA 3ENQA 1YUNA 5HKLA 2YJ3A 2V0NA 4HRYA 1PEDA 4QXOA 3DMTC 5TQVA 5AW8A 1V8FA 2CL6X 1XPRA 1TI7A 2CLSA 4OQQA 3PNLA 1T4BA 3VNQA 2GZSA 2AG0A 3ECCA 1N2CB 3TIVA 5JU6A 2REQB 4FLFA 4CXMA 3NOVA 1IQRA 5C1PA 1XA0A 5AK3A 2ZLBA 3MINB 5HFNA 1PX0A 1I1QB 2GPBA 3A9CA 3AVPA 1Q1EA 1O97C 3UATA 2PV0A 5B7PA 3TD9A 3TKAA 3ND6A 1T91A 5CFNA 2ZS9A 2HRCA 2MYUA 3VH2A 4F4IA 2G09A 4HGZA 4JYBA 3WV4A 3ZIAA 4FHEA 5DSZA 5DTJA 4C05A 3S5UA 3T5PA 1O95C 1Z4NA 2Z8ZA 4XAQA 4XCQA 5D6OA 4WY5A 4GX1A 2RBKA 2VDJA 2EW2A 1L7XA 4QNNA 4G4IA 3PG5A 4RJIA 2A0KA 1U5AA 3RAJA 3TZLA 4AJLA 4OAOA 4AY3A 1N25A 2F8MA 2H3EA 2RB5A 3KJQA 3FR8A 3KYIB 4OL9A 3E5MA 2GN6A 3F6SA 4CEIA 4B7CA 4BNDB 3F5DA 3WY9A 4I81A 2VAXA 2O1SA 1DUVG 1U3CA 2QBYA 1M34A 3L8CA 4G5HA 4QTTB 4YAEA 2XHZA 3ZGVA 1BWRA 4AZ3A 1PW5A 4MUHA 4DIMA 4RL6A 4ZZIA 3GFOA 3ET5A 2P5YA 5IUNC 3HCWA 2VAPA 2P2DA 5LLSA 3D3WA 1YRLA 4OMDA 4WKPA 3SXUA 1SU7A 5ESWA 5BVGA 2HQSA 4GXTA 1TW3A 1ZRNA 2EFDB 2V7QD 3D81A 3WAJA 1TTTA 2P9TA 4HUQA 4C4OA 2BHSA 4V0ME 3U2QA 4DF3A 2BISA 5J2TF 1N0IA 5GADl 3TYXA 3K09A 2Q1YA 4BVAA 5KX5A 2NV6A 1JXMA 2ET6A 1DINA 3FSGA 4MZDA 3J81A 3FHTA 1M1YE 2GCOA 4PZCA 4W6QA 3RS8A 2VKQA 5CVEA 3RJMA 3KR9A 4DLYA 2CVOA 1WY7A 4PFSA 2IYUA 3L0DA 3OETA 4LDJA 4LQ4A 4RHXA 4YI5A 5FYDA 1UEJA 4L02A 4F45A 5A4AA 1PBTA 3UCEA 4OHPA 3N5CA 1SWVA 4YRIA 5CIQA 1KK1A 1EP3B 2ZXEA 3NPMA 2F43B 4PYMA 2R6HA 2P3QA 3K0SA 3Q6IA 1GYPA 3R9XB 4DSNA 5IN4A 4RK5A 2OBMA 1O96B 3FB4A 3TEMA 3TLBA 4Q9AA 4C7JA 2FY8A 3QVJA 4D57A 3NOQA 4NFHA 3MGCA 2FHPA 3V7NA 1VBFA 1CFJA 3KO8A 2L82A 4S1VA 1ILWA 3CVJA 4PICA 3OOEA 3AFHA 2DETA 4PSAA 3BX1A 4IDCA 5JS7A 1BYIA 5JV5A 1RI3A 5T57A 3RFVA 4PYRA 1ODCA 2R86A 4AS2A 5LIPA 4DVGA 2PJZA 4QD3A 1JKXA 5LUBA 4W82A 4PFJA 4ZDJA 1L4FA 4X8HA 1MQSA 1UZNA 4I1SA 5F76A 4KIFA 3K16A 3Q3GE 2J4DA 1X1BA 3W79A 1NBAA 4ZJYA 1JP7A 1Q16A 3NUZA 3F46A 4WBNA 1A9YA 2NX2A 4P9NA 2QT9A 1R50A 4GYJA 2GEKA 4L16A 5A05A 3FCSB 3BERA 5MDHA 5CT5A 1OXVA 1XNGA 1PFWA 2OORC 2RAVA 2VDNB 2WYVA 3RUDA 1M6VB 2H1LA 3AEZA 4Z0NA 3C3MA 2OBBA 5CA1F 4K9OA 2GOYA 1T9GR 4MLZA 4LZWA 1LV7A 1OQAA 4BMXA 4YMGA 1QIMA 4Y6QA 1MGOA 1C3OA 1PQWA 4LQLA 1I4OA 4ICIA 3KJXA 4Q1VA 1GFSA 4P7GA 4CR6A 1P1IA 4M1YA 5J9FA 2XZOA 2C4MA 1JE0A 1JDZA 1AXRA 4PLPA 3FOCA 4WZZA 1WULS 4JI7B 4UM5A 1ZEMA 4LISA 1TYAE 1FUEA 5DXFA 2IBTA 2ONKA 1XDZA 4QULA 3IP1A 5DGCA 1Q2UA 2NACA 2QYOA 4OATA 3O6VA 3CUEF 1QVVA 1EQUA 2H85A 4OYRA 2D2IA 5LYJB 3DDOA 1K6XA 2WV9A 2ZCVA 3G49A 1GAJA 5AJYA 5JNLA 1HT2E 1KEEB 2QL7A 4Z3OA 4E07A 2BMJA 2GMWA 3JR7A 3QBDA 3IDAA 4HQ6A 4TL7A 2IPMA 5F78A 4DJFC 3R5HA 2OBNA 2ZJ8A 5DP2A 5LD2C 4TV8A 4HO1X 4HX2A 1AK2A 1SOMA 4PXYA 3R41A 5AQ1A 1KQ3A 1G2OA 4P7JA 4LXUA 1JSLA 1WPGA 4CKXA 2BGRA 2P9HA 4YRNA 1TIPA 2R62A 4WNAA 5IW8A 4Z1MD 2EX0A 1RZRA 3JTMA 3MNFA 4ZCLA 2OCDA 3BGSA 4CT4B 1JAIA 3O8BA 1CEQA 2JLRA 2Q2QA 1ZD3A 5NLLA 1J42A 3GV0A 3NYQA 5AMXA 3W3AD 3JQBC 2O59A 5TXGA 2ODPA 1EBUA 2PPVA 1DRWA 1SXQA 2ISQA 5BN1A 3A1SA 1QONA 4AMBA 2F9LA 2QTVA 4NQZA 4R2LA 3ZWVA 3T4EA 4BNTA 1S3IA 2ZBRA 2A3RA 3UKDA 2CLLB 3H9BA 2JGMA 2HZ7A 1GZ6A 2GI4A 2R8RA 1W9HA 3Q2IA 1YWGO 4X1IA 2GCNA 1IHXA 3S7ZA 1BKSB 1LS6A 1SWWA 1TYZA 3H11A 3R23A 5HOQA 1QX3A 2XRZA 1TE2A 4B2PA 3IBTA 2XDAA 4YMLA 4ZOEA 2O8BA 1QMPA 2PL1A 1P6XA 2OO7A 1FMLA 4V38A 1EXDA 3IC5A 3QUQA 4G0XA 1N92A 4Y7CA 3ZNOA 1QRSA 3SD7A 3T9BA 3V2IA 5I45A 1R10A 2C8JA 1OPRA 1GLVA 4O0LA 2F1HA 5E7JA 5IN5A 2ZXFA 1VSQA 4R83A 4ZYYA 5TPZA 5IAOA 3QEAZ 1N0WA 1NNUA 2L2QA 4WXEA 1OYYA 4RL4A 5B2ZA 4HMQA 3NCTA 1WXWA 3Q15C 1GL9B 4Q4AB 5LPNA 1QQBA 2YHBA 3VVBA 4HAXA 3NW9A 2ZBVA 2GBFA 4J91A 5CVCA 1QOQB 5HPYB 1OVMA 1EFLA 3KRTA 1JB1A 1G1MA 1QFMA 2PSSA 3KCNA 3NVMB 3PDIA 1KJZA 4H27A 4TL8A 1JHDA 1FCJA 1KDTA 1S0UA 1WXQA 3QY9A 3DTYA 3R3JA 4B8YA 4YAOA 5I4KA 1OB5A 2PBZA 3SWWA 5K3EA 1U8ZA 3HP1A 1KFBB 1U1GA 2IEZA 3NVDA 3OT1B 1YI1A 4BBZA 1Z7YA 3H0KA 4UEJA 3KKQA 3EMKA 4AZWA 2CLFB 1KJQA 1SO8A 5DT2A 3PNBA 1TL7C 3VISA 1PGJA 3C2QA 1C3EA 2HA0A 3MBOA 3DXZA 1U02A 4M7OA 1J7KA 2XYHA 3GBVA 4UJ5A 2CMDA 4NNPA 4FUTA 1QDUA 4EHAA 4R05A 1XMVA 3KBOA 1XZJA 1SHKA 2NOAA 1L6RA 5IVIA 1M5RA 1X8LA 1XT6A 5FFFA 1L8OA 2WMNB 4FMDF 1XLVA 4BO0A 4HAVA 3RT9A 1M1UA 1DUIA 3PQ4A 1QZ3A 3BREA 3DKKA 3UEOA 3NO4A 4G8BA 2CXNA 2HDHA 3SEAA 2OHVA 4B46A 2CCKA 3GARA 1U6IA 2MSNA 4I08A 5EXPA 1R88A 3UWKA 4D5EA 1ATIA 1LJLA 1SKQA 4X93A 1CHNA 1XKQA 2SECE 1GNPA 2W2PA 4CQMB 3RJ9A 1KWKA 1EVQA 5T41A 3ZD9A 2KS6A 1WUJS 3ICEA 5TT0A 4B48A 4UHEA 5IUKC 4EHIA 4WBNF 4V1CA 4A7PA 3DVAA 5K4HA 3I23A 3V4OA 1OH7A 2BGNA 4WCVA 4HG2A 4GM1A 3MB5A 4RVGA 4IKEA 3SP1A 3IHKA 4X1KB 1UP6A 4MIKA 3O5AA 1CKEA 5ALMA 4ZANA 3KR1A 5CJJA 1CUFA 1CRWG 2P62A 1KQPA 1WQ3A 2DECA 3WE7A 4DL9A 3CSUA 4KPGA 4JMPA 1NG9A 3FF1A 2YHAA 3D31A 4AURA 3MCWA 2VH1A 4CM8A 1W47A 2BEWB 3LT1A 1Z0AA 2F8SA 1SUPA 5DHFA 4PSDA 2XMDA 4DC1A 1IN1A 2HC9A 3NGLA 3NANA 1OFUX 5C8ZA 3FD8A 1IZYA 1T3ZA 4XVQA 1KORA 4TKZA 3HHEA 5CVVA 4AXBA 1XJWA 3F9RA 2PSDA 2YH2A 1DT3A 3C6XA 3FZGA 3MILA 5TQ2B 1MDFA 1R6UA 3K0BA 1NXWA 3KV3O 1E5XA 3GZNB 4MAFA 5EJ7A 3OE7D 3NHWA 1ONBA 2JI7A 3GJQA 3UXHA 1M5TA 1RW4A 3A06A 1SQ6A 1I51A 1QP0A 5AVJA 1PYOA 2P78A 5THXA 3A7DA 4HAUA 4HDNA 3SBXA 1GHTA 2REXB 4J03A 1Z2EA 3NTXA 2EBWA 2MIIA 3DUFB 3X2SA 1U28C 5H3LA 4OP2A 2J5RA 4AF6A 4OLHA 1W0JA 2W70A 2ACEA 1F2TA 3MT8A 3HPRA 3BMNB 1BS9A 2PS1A 3M3PA 2HY7A 3M4ZA 1OGJA 2VEOA 2C4VA 4PYIA 4IJWA 3RABA 1H4VB 4DCCA 3A25A 4EPXA 5JAOA 3GG2A 3E15A 1U94A 4Y6GB 1QP4A 1BRTA 1T29A 2AOWA 4IX9A 3LX6A 2VFAA 1QOPB 2R8OA 3CR3C 1FTQA 1WKVA 2IEGA 1T4MA 1PWHA 1FFSA 2QHXA 4KACA 4IXWA 2ILTA 1GPAA 4JLAA 1JRLA 3MWGA 2PSJA 3KV1A 5IX8A 1Q21A 3M49A 4AXXA 4V0MA 1J7JA 3DM9B 2UYOA 2YQZA 4QBFA 4ZYLA 4PAWA 3FTFA 3A2KA 4ETIA 4OH1A 1P9RA 4D4LA 5A5EA 4F5YA 1MMFB 3DBRB 1XTSA 4QFCA 1AXEA 2ODEA 4G01B 3GRFA 1JMVA 3SSAA 5A9SB 2O2XA 3AESA 4EVQA 3WKEA 2AW3A 3CN7A 3GMSA 5DCWA 1CVRA 2V8OA 5DULA 4DUYB 1N1DA 5C31A 3HKBB 1VI5A 3ZE2B 1FB5A 1D2MA 3ZKWB 1W6UA 4ZCQA 1CY1A 1ZS9A 2DWOA 4EX6A 4D8XA 2XUZA 3M4JA 2GFQA 4PYQA 3BEOA 4YRSA 1Z0ZA 4MVWA 2C7VA 4RDIA 1X13A 3V34A 5KYXB 1HDZA 3VR2A 1KGSA 4BKUA 2EBFX 3UJNA 4FM9A 1UMKA 2W2TA 3ZDAA 3DVSX 1Z0IA 5FWAA 1SCUA 3I1FA 2PJDA 3WISA 1ITZA 3EIXA 5TJHA 4C4TA 2IQ5A 3PC4A 4DLWA 1Y9DA 3CMMA 1L1RA 3Q0IA 1U3TA 2J67A 1HDOA 3MUEA 4LX0A 2BFEB 1C0LA 1VCHA 3O75A 4OJQA 4BJ6A 1AB5A 2ODNA 4PONA 2OHGA 3OSZA 1T2DA 2JL1A 1RMQA 1N0UA 1NURA 2Y9PB 3JQDA 1FUYB 2QMQA 1IZ8A 3IR5A 4I5GA 1LWNA 3WGHA 4CG2A 3B20A 1DAOA 2NZVG 2VJKA 4GDMA 2O2SA 5ALUA 1KEZA 3LCVB 3SBOA 4EYQA 4EPYA 2I29A 4F93B 2VJDA 1EWRA 4UFNA 3RJTA 2D1YA 1TQDA 2OZLB 3EHEA 2GXUA 1KK3A 3RUIA 2QTFA 1GY8A 2NT3A 3RQSA 3UZUA 3NUQA 2CSUA 4KYUA 2GH1A 4KXMA 4OKIA 2HF9A 3IKVA 1QFJA 3GJ8A 5DSXA 1CEEA 4IBOA 1CE8A 4F6RA 2JFNA 1IY9A 1ZJ6A 2NAPA 1EFTA 4KN6A 1QRUA 4ARVA 3UMFA 5LWHA 4E2YA 1BU8A 2H57A 1XQ6A 4L3WA 3THWA 5ER9A 5B58C 2NXJA 4UHCA 4XWGA 3UGJA 1I5EA 3AP1A 3ZTWA 3HVJA 2X8JB 3QVXA 1R9MA 4YP6A 4N5MA 3ANSA 3QTTA 2OAQ1 4BQPA 4KLRA 4EF6A 4I36A 4DB4A 1VL6A 4LBYA 1Y1LA 2QR2A 2PGAA 3G2QA 4PPGA 4DLVA 4YWHA 5TT1A 3ZVKA 1SKUA 3P71T 2O0KA 1PGQA 4W5TA 4WCFA 3DL0A 2XUAA 2A0YA 2H06A 4CKEA 4JYZA 1E6EA 3DQQA 3BWYA 5HF9A 2DBVO 1IC6A 1TO6A 2C5EA 1UAYA 3A3KA 1T0UA 5GVRA 4RSHA 4P98A 4AKEA 5IABA 2QSJA 4BTEA 4Z2YA 1MAHA 4HDSB 3TMKA 4C78A 2ZVQX 4LDRA 4DWJA 2D2XA 4Q37A 2PGDA 4OQEA 4F3NA 2C61A 4P0QB 3R7WB 4HLUA 1RCUA 1SKYB 1DC5A 3LDAA 5CK5A 2VO1A 1V8ZA 3DCIA 5EPEA 1TM7E 2HRQA 1FTGA 3RTBA 4AX4A 3HR7A 1B74A 3MWFA 3G82C 2ROQA 4D56A 1ID8A 3U3KA 1E9RA 1ZYUA 3RYFB 2WUWE 1NASA 3KT8A 3E22B 3UUFA 2EWWA 2DPMA 3PT5A 1GNLA 3B2EA 2GCPA 3I4FA 3N8KA 2OESA 3OQHA 2H5JA 3OF5A 5IAAA 4CQMD 1ZM2A 2FGJA 3FRHA 2LP4Y 3LDUA 1JAHA 4OQ4A 5AJVB 2D7JA 4JIGA 3FNFA 2B9VA 3JWIA 2ZIXB 2VYQA 2DE0X 4P4NA 1WCWA 1PK8A 3QHAA 2PR7A 1ZH0A 2DPHA 5FLYA 4DJJA 5LZ4A 4UEQA 4GF5A 5K3BA 2I6SA 3HJTA 1S4MA 8GPBA 1DSSG 5TQJA 1UOPA 2XD4A 1U3WA 3KKZA 3WLMA 5CA0B 2WSBA 3EDRA 1CRPA 5COAA 3GJ0A 3JQBA 4AF8A 3FI0A 2W2OA 3BMCB 3OT5A 4XDGA 5F4BA 4QT4A 1VHJA 2ZB3A 3HNOA 3ONNA 4RLHA 1M83A 2AI3A 4XRRA 3FTCA 3GT0A 4WASA 1QO0D 2A5JA 5GONA 4FFLA 5AKXA 3S28A 3R75A 4O4IF 3ME5A 2ZSJA 3T3EA 4A0RA 1P4HA 4IFBA 4NY1A 3GJ3A 4TLAA 1E1LA 3KLPX 4OVKA 4IAOA 2PUEA 4CCYA 5DK4A 4XDYA 2GEBA 1BWPA 4AKHA 3A9VA 2H2GA 5EQJB 1EK5A 2JDID 3F96A 3HB7A 3SX2A 4LF5B 1R0YA 2PFKA 3ONVA 5H81A 3BL6A 3V8NA 3TF5A 4PZ9A 1TM2A 2X4DA 1OBCA 5GZ6A 2PLWA 1SHZA 1L3BA 3QY0A 1Z63A 2CHGA 3QMMA 5IBCA 1PJ2A 1JAYA 2QD5A 2Y2UA 3OE1A 3QKRB 5TPWB 2VSQA 1QZUA 2PKEA 4QPNA 4KR2A 1J2YA 4JZKA 4EUSA 4IDDA 3QBTA 1H0SA 2AYZA 1IZZA 4DPLA 5BUCA 3Q3CA 3U4MA 1VHQA 4KVZA 5KS2A 2WQ6A 3G5MA 1O6ZA 4P5DA 4B3HA 4QQFA 4W5JA 4WJZA 5EC8A 1LEHA 1OX4B 2YFKA 3FFBA 3KQHA 1UM8A 3HY3A 1U6KA 3IP9A 4FZVA 4Y2VA 2JVJA 4FDMA 1Z6TA 1RM5A 2GCEA 1GP2A 3AKEA 1E9CA 2CFSA 2EU8A 3KXIA 2QMOA 4HC4A 3HP4A 2A35A 4ARSA 1ZH6A 4MVYA 3EFHA 4MVJF 4G07A 1W73A 1WUKS 1ZH4A 1NJ6A 4K6GA 2WD7A 1KXZA 4KVFA 1RBQA 2C42A 4BBJA 1GQRA 1QKKA 1Z25A 3FPEA 2EDAA 4O5OA 4YT4A 2QRVA 3J7TA 4QU8A 1CJKC 2LVBA 4HQRA 3OPYI 3JASB 1NM5C 2QVBA 2E4WA 5H3CA 1P7ZA 4JLOA 4F2HA 5LOVF 2VHWA 3KTOA 1UBGA 3KFVA 1KKUA 4ND7A 5IAEA 2QUIA 4U7WA 1JH9A 1JHXA 2J7PD 3NU1A 4Q21A 1C81A 1E6UA 2QLJA 5TDHA 2EIHA 1BMFD 3BA6A 5CX1B 2O5VA 2XOKA 1IXZA 3PYXA 3Q5EA 4FYIA 3QJGA 4C20A 3ZE6A 2J9XB 4UTZA 4MZXA 4MAMA 2FW8A 5KOHB 1C7FA 1TKBA 3H4TA 4LJ9A 2OHHA 1OGYA 1VFPA 3HRKA 1LJUA 2VDOB 3W9YA 5L3VA 2WIGA 3VV3A 2A9RA 2GN2A 3GP8A 1HYEA 4PW0A 2DT5A 1YKFA 5FNVA 3H2HA 5JXJA 1A9RA 1FNDA 4L9WA 1P1BA 2BM1A 3WQBA 4C0WA 1NVBA 5FAXA 1E0DA 2HH9A 4WFJA 3ZLJA 1ZIDA 4DG5A 3M4YA 4Q3OA 1YI8A 5J2UB 4LGVA 4ZP1A 3U4QA 4IKPA 4KRFA 3KQQA 3N53A 3LY7A 5BOSA 3UGKA 3NAZA 2A3NA 2JF0A 2W98A 4QGHA 4KQ2A 4M0KA 1RHJA 3HH8A 3PFNA 1A27A 3JVEA 3OBIA 1Y34E 3DR3A 3RVPA 2EBHX 1C0KA 4M0EA 1CY7A 5ICGA 3H83A 1ZHOA 3A4MA 2JLSA 4J16C 4KQMA 1R4MB 2VSOA 3Q8KA 2CN1A 1TMYA 2FP4B 3H6GA 1MH9A 4I1YA 4AZSA 1A97A 1BEUB 3G1TA 1JJ7A 2GRUA 2I67A 2W2LD 2VHJA 4ID9A 4J0DA 4JWKA 5KNBA 4P2BA 4AM8A 3FG9A 4CLOB 1SB9A 3FNBA 1THMA 3OAAA 2WYHA 5GV8A 2ATVA 5LVAA 4JUIA 2WINI 2C04A 4NU6A 2MR6A 3CJRA 2ZRGA 4ONEA 3D4PA 3LLMA 4KWHA 2E3JA 2ZKIA 4RIHA 5FI0B 4ER3A 3N9IA 1E6LA 2C92A 3HDTA 1TYCA 2P5UA 3ZHXA 1XA4A 1KMMA 2OVFA 1VA5A 1Z7BA 3WA6A 3PNQA 1HL3A 3W4KA 4NV1A 1RXCA 2XQKA 2DJ5A 3P9QA 4L5YA 2WMDA 1NJSA 2D5CA 3IJ5A 4MULA 4EHNA 5IDWA 3F5MA 3P5BA 1K8XB 2Q0SA 1WB4A 2GR9A 4QGBA 4CM6A 4CKCB 3BDVA 3PEVA 5K3OA 3ABSB 4P84A 1M1YB 2HIMA 4US2R 4EGAA 1KEKA 2V6MA 4HDMB 1RQ7A 2E4AA 3SZOA 1FF9A 2QTMA 3P26A 2C54A 1VKHA 3UAOA 5FBZA 5JBNA 1KOGA 3AOEC 1RP1A 3WSVA 1IL0A 2R7AA 4KXVA 3H75A 5A03A 1JLSA 4OJMX 5CFMA 5KZMB 1V16A 1F5NA 2AJBA 3EZLA 3D3JA 2BFCB 4LC1A 2X0FA 1QCZA 2BJWA 4XQEA 3TQRA 4CQLA 4X94A 1I33A 3BB3A 3GXBA 3SC6A 1EI9A 1THGA 1WCV1 5IDVA 1NR5A 1I8TA 3MJSA 3KELA 4PO9A 5E4YA 1CG6A 5EA2A 4RFSB 4TXJA 1Z37A 2XB9A 2PWAA 5EKSA 4BFUA 3Q7PA 3TJZA 4MV9A 1NUUA 1I0LA 1K3FA 5KKCA 2B8TA 1KPGA 1MG5A 3OZVA 5EMNA 2C88A 3KTDA 3OZUA 4X7RA 4NSNA 1JSZA 4G36A 2GTHA 2P3LA 2AKYA 4P31A 5AVUA 3A7EA 2I2BA 3ZGLA 1M2VA 3E84A 2BYTA 1ZLXA 4ZOAA 1O8CA 1O0BA 4KIGA 1ZRSA 4HRVA 1ACMA 2GN1A 3FVQA 2KLBA 1TO1E 3KE8A 4L08A 5EWMB 1KRXA 1A72A 4BJHB 2Q2NA 2W00A 2XVMA 4DQVA 4JL8A 2GPAA 3JQ8A 2WPDD 1K3UB 4II2A 3H13A 3LUBA 3CW2A 4CCAA 3JATA 3EVTA 1DBPA 3DTVA 1LF5A 3NBQA 2CDNA 1H2FA 4JIMA 4MV6A 4NZMA 4CDGA 1EMDA 4D43A 5MFZA 1Q3HA 2VDKB 1H6DA 1JVBA 1VJ1A 1KP2A 3AHFA 4PSKA 1UPUA 3U5TA 1TLLA 1ZK4A 1YZUA 2WU3A 5U1PA 2X9NA 2DQYA 2NTYC 4Y1EA 2FEPA 3KEOA 4L0MA 3C16C 5CHYA 1E3MA 3E9DA 1LPBB 1OXTA 4UARA 3SQNA 1XC7A 1Y8ZA 2FRVA 4MQ6A 5AW7A 2VYVD 4FKMA 3NBFA 1V41E 1XCJA 1ODIA 4JBNA 5EINA 3ZDCA 1UEXC 4ZT6A 2CBXA 2RD2A 1ENOA 4HGYA 2A8YA 4AD8A 5HG0A 5L7TA 1KR2A 4GMKA 4R6XA 1H3EA 2FWMX 1N4DA 1FS5A 1LSUA 4KO2S 5GJVC 4QOHA 4WUVA 4M8NE 3JD2A 3JRWA 1ESZA 2YJ6A 3AHHA 1DZIA 1FYEA 1UJ5A 4KGVA 4LZNA 1ZOPA 2H7YA 4PIVA 3LLSA 1OMOA 2CMKA 4QQNA 3ZHVA 5I6DA 2PUVA 3OJ0A 4P35A 3TUIC 3VR1A 1VLQA 1VYUA 1P0CA 2HNAA 3QMPA 2V96A 5KKNB 1KSJA 2FJUA 2V5VA 4F7WA 1G8AA 1N2IA 3ORQA 3KKNA 4YHBA 4HXYA 3GR6A 1P2SA 2W8ZA 2HRBA 1NVTA 5FXMA 1WPRA 2IBMA 3D59A 4NJEB 5G4LA 4JOCA 1VKZA 4P86A 3ZNQA 4A73A 2CLKB 4G25A 3BWMA 4PYJA 2DR0A 2C2ZA 4EGCB 4FSHA 1EWVA 2QPTA 1UMCB 1WZEA 4TSRA 2FA9A 2KE5A 3NFYA 5KYKA 2VAWA 2PD3A 2KLHA 4KQHA 1FTSA 5EY5B 2AZDA 4NH4A 4MLCA 5IKMA 2H5EA 1IVSA 2OV3A 2GESA 1RACA 1QM5A 1ZIPA 2XJ9A 5LA6B 1X1DA 3C6MA 4NZPA 4RVHA 4TX1A 3V33A 3DAYA 4XB1A 3FHJA 3SE7A 4BMOB 4X41A 5K2OA 1C7RA 1FP4B 4FHGA 1IY1A 2XYPA 4IS3A 2FOIA 5FEMA 4YO8A 4QWMA 1LBQA 1VSTA 3VHRA 4A1FA 2ECFA 4Z0PA 1J07A 2ZSIA 1GCOA 2C2GA 3LFHA 3MTIA 3T4PA 1V7PC 1G5TA 1JN0A 1XLUA 3TZQA 1DTSA 1TX4B 3K6RA 1VA4A 1WAMA 3UNXA 1H9AA 1HDCA 2R6GA 1YS7A 3HJBA 3VI3B 3EXIB 4GP9A 1H1LB 4ARUA 4F4JA 4KFUA 3ESQA 1PSDA 3OEWA 4MEJA 1XTTA 5ULLA 1QYIA 1TUBB 2PANA 4BPRA 2HX1A 3HWWA 1QTQA 3I6QA 5TVKA 1FDTA 5GQSA 2A1UB 6PFKA 2IK8A 4R40A 3U26A 4O2AA 3EYAA 5K20A 5G53C 1N2GA 3IS3A 4CF4A 5E9WA 3INYA 2PGNA 3GRPA 3IRVA 1BXZA 3KHKA 3FGOA 3EZNA 1OGIA 1P9LA 2OGUA 4OHBA 4I46A 3VKHA 1TVMA 2G83A 5KAMA 1COZA 4GW3A 5IJAA 4FEAA 4H4CA 1GRCA 1MIHA 5AI5A 3IVAA 4C89A 4MI9A 1I7NA 2W43A 4U39A 1U8FO 2FXIA 4XLZA 1DG3A 3AF3A 3LXRA 5BSFA 1QPGA 2EQ5A 1YJ5A 2J0UB 4P1ZA 3SJAA 1O94D 2HCRA 5LDHA 5DOZA 1A4UA 2KB0A 3F47A 4KI7A 1NONA 2L19A 4PNZA 3CNQS 1ORHA 1RRGA 1L5RA 1TA4A 4NPHA 1EUYA 3T12A 4UTNA 3M6VA 3CLTD 5F1OA 1B3BA 1IBSA 2HPZA 3BILA 4R2KA 2BJVA 3F8TA 3KWMA 1HDGO 3PDWA 4B9EA 4BLRA 4BMSA 1NAHA 1BCRB 4URYR 5FTNA 4BMCA 4EY7A 4YMTA 4AS1A 1G4AE 3RB8A 4BLPA 5BSEA 1NQVA 2R66A 1SZPA 3EF1A 3IKMB 1E4VA 3I73A 4IVPA 1OFIA 1W59A 2FW0A 2RARA 3PHJA 2HU5A 4YRTA 4FMPA 4KI0A 4EJ6A 3PQ5A 1JFRA 4BTVA 1E9VA 4FNAA 4WZBE 5KDOA 4Y1RA 3HADA 1NUAA 1LBEA 2HGZA 3MFYA 1W52X 2OZKA 2VT6A 1E3WB 1T5IA 1LZKA 2PMFA 2JDIA 4OFBA 1VECA 2BP7A 4BNMA 5AUPB 4ND8A 1SHLA 2Y0DA 1ZH2A 1N8KA 4FOLA 2RGWA 2UVPB 2IS4A 1ONNA 3L06A 1EFVB 4QUEA 3CWZA 3O82A 4TZ6A 5C80A 2J31A 4P5PA 1OLUB 2IELA 3WJAA 4PXAA 3E2PA 3IYLW 2GFIA 4YMHA 5AXAA 1TD9A 3CH7A 2I4OA 3ZI4A 3H1EA 4X1OA 4RTOA 2CNWD 3IOBA 3Q5GA 4S05A 4TTIA 4V0KA 4MV4A 4E94A 1VKJA 4H35A 1RQNA 1C2TA 1U2RA 3QVTA 2G4LA 2WA2A 4FEYA 4Y0NA 1LDBA 3B6ZA 1V9LA 4FCTA 5EJGA 4BLSA 5C8YF 3KVRA 1SKYE 4NMWA 2FPPB 4CKZA 2HSJA 5B6IA 4E21A 1XIVA 1XZMA 4B3JA 1P2DA 3P2MA 3K9GA 3ZW8A 2BAGA 4LHWA 4KYTA 4RJKA 2AF3C 3I9MA 3O95A 4BE9A 3G5TA 1L7NA 3QF4B 2MOKA 4UTRA 1Z68A 5FUQA 1X7YB 2IYTA 4Z6KA 3BBPA 1W34A 1EG2A 3HVKA 3WMWA 3WNCA 3FWZA 3CGWA 2HO5A 1P4RA 1QRDA 2J5KA 4TTTS 1X1AA 3LSYA 1GAEO 2YRFA 3NTOA 1A98A 5DNEA 2C7RA 1SVUA 2IHYA 2NNLD 1YS9A 2R1VB 1XTRA 2VJBA 2VSNA 3GGPA 4HJXA 4U7FA 4GZLA 4WTOA 4WRRA 4AULA 4MX8A 1MRNA 3QXHA 4C2UA 1A2BA 2FFBA 5TMEA 4C7XA 4O25A 3JARB 5G02A 2DYKA 4K6KA 4JFAA 2QTWB 3TOCA 2BZGA 2Q3CA 4Q4DA 4BJ5A 1XELA 4B5KA 1XTIA 1Z6PA 1XALA 1E1QD 1ZESA 3OESA 4F4FA 2CXHA 2YR0A 3EZ6A 1WOMA 2OV1A 3LHKA 5B3JA 5ADWA 2MYTA 3Q12A 3COYA 1B8UA 3O8QA 4RKQA 1KAEA 4RHYA 4G2NA 5FL3A 3UAZA 3UWOA 4AWXA 3E23A 3LDFA 4US0R 2ZRCA 2H1OA 2O8CA 5AI4A 3TNDA 1XRQA 4FR0A 4OV6B 4KXWA 1TZ2A 1Z07A 2C3PA 3RF7A 1GDDA 2Q6KA 1VRWA 1X7ZB 4PWYA 4PAMA 4EHKA 3TCKA 2O7NA 4H1HA 3WB9A 2FSSA 4BNGA 2VJYA 1JYSA 1BE0A 2Q07A 3QUSA 4O59O 5H80A 3PPVA 3T34A 1OY1A 2AOUB 1QDLB 4JITA 1HZZC 2CLIB 2D06A 2V03A 2WE8A 4P6VF 3FCYA 3CISA 1L5LA 3WYCA 1QV7A 4F8EA 4MQEB 3HYTA 1R9NA 1L7VC 4XIGS 4DQUA 3B48A 1WPXA 1YB1A 4NMXB 4B6EA 2GERA 3KYDB 3QW4B 5E3HA 3Q87B 2WLTA 4L4UA 1OZFA 3WLSA 1N9GB 1C5KA 4DMHA 3RVQA 4F6CA 3HJRA 2AYYA 2ZTMA 2B6NA 1T2AA 4OK6A 1T6XA 4JI1B 4AJEA 3AVYA 2FG6C 3AVVA 3QNMA 1YRAA 4DCOA 1E20A 1L7OA 3PR2B 2CVHA 3EOZA 2BTQA 3TXXA 4IDHA 4RXMA 2IPOA 4LPSA 1LGYA 2VP2A 1PZHA 5IHXA 1ZAYA 1EAMA 2I7DA 3R6GA 1G9TA 1SM4A 3GPCA 3S2SA 2GCGA 1GCUA 3EVDA 4IGEA 1G5RA 2OPBA 3ZXYA 1MAUA 3GA5A 1GSIA 1TPYA 4ZXFA 3SNKA 1G3UA 2IDZA 3KFXA 4CLEA 4E32A 3A3OA 3RROA 5JS6A 4G1FA 1YCDA 1BE8A 2DZDA 3IOMA 1G5HA 3DAFA 1EFDN 4DMFA 3FA2A 1B16A 2VH5R 3OFKA 4C3OB 3FNHA 4DA8A 2ZUUA 3FIUA 5EQTA 1II8B 1E2PA 4TTSA 2B2CA 4G0PA 2AJDA 5T3YA 4D74A 3OWXA 4DLBA 2B4TO 4HWPA 4H18A 4DV1B 3AVXA 3MWLA 1NM5A 1NBOA 1PG5A 2NXWA 4A8JC 1WCIB 1KQNA 5ALKA 2FFAA 5IT5A 3U61B 2IYXA 1JU4A 5A3RA 2DPXA 2WT9A 1QCDA 2E1RA 2GHQA 2QLFA 1H93A 1WABA 2WJHA 3GNQA 4X63A 1ORWA 2A7XA 1I3MA 4FYMA 4ZAYA 1PU2A 4MDFA 5LWQA 1NC1A 1L3IA 5T64A 1Y5LA 2IHTA 2PYZA 1IUPA 4KB5A 2ATXA 1V11A 5CH8A 4YRFA 4BLWA 1EXMA 5LMZA 1RM3A 2EP5A 2YWJA 4HUQB 2W83A 3FPCA 1ZC4A 1Y8RB 5WRFA 4DV7B 2NZ2A 1UC9A 2XB8A 1Y63A 1JKJA 3DWFA 3SYNA 2YJGA 3ZUGA 2A9PA 1OFHA 1U2QA 2GEUA 3MGAA 3QVLA 3K8QA 4RCVA 4RFVA 4RZHA 3W5HA 4AMGA 2DHRA 3GEPA 1WY5A 1YUBA 3KZXA 1GPUA 2A5FA 2IIPA 2JFUA 3OIVA 2N42A 2VPWA 3W0LB 1E1RD 3IJEB 3K8ZA 2CYAA 1YF3A 3OMXA 4JC4A 2LNDA 4S1NA 2QS9A 1EE1A 2JIZA 2VDMB 4IOMA 1OWLA 3DHNA 3KS9A 4JFRA 4Q4LA 3SHQA 2FCAA 3OI7A 2NQ2C 1MX1A 1B1AA 3EN0A 3ZGXA 3EWNA 2FFQA 4MTLA 1EGVB 3CVVA 2H8KA 3BJMA 2WWHA 5CNKA 1Z2PX 2OFWA 3F6PA 1RPZA 1GTL1 2F17A 3H17A 3QWAA 3RUPA 3V4SA 1UEIA 3JYLA 2YZMA 5I9NA 3IUQA 2A1TS 1ZY2A 5JNTA 3MG9A 2YMMA 4KVAA 4EB8A 3OAAD 1LLQA 3M3HA 3PXEA 121PA 2QRGA 4G9EA 4Z2AA 1PVOA 2D0DA 1G20B 2V6GA 1IM8A 4EG5A 3D6NB 4EY4A 3ILSA 3QEJA 4C0JA 4F3TA 1UJMA 4P08A 3AXTA 1P33A 3QEKA 3RAGA 3RSCA 2ZIUB 1VYTA 2VWGA 2B8JA 3I9KA 4JSYA 3U3XA 4B43A 4F9TA 2EKDA 2RE8A 2O50A 3AVQA 3HMQA 1ZXBA 3R0QA 4NATA 3PHIA 2PS0A 1N0HA 3QA3E 1NDQA 3Q0EA 2R751 1L0BA 4WBNB 3BE8A 3W5IA 2ZEJA 5DTMA 3AK4A 3W9SA 4BYMA 4F2GA 1MENA 3DMPA 1SPXA 3BL5A 1WXXA 3H0CA 5EKTA 4ZDKA 1DOAA 2VT3A 2QJFA 3AEYA 1E6WA 3M9XA 5B30A 3CN9A 5F98A 3ETEA 2FW1A 2PZLA 4K5QA 2FFJA 3K0FB 4DXHA 4F7DA 3OQMA 3M34A 2I7XA 1JNYA 2H1VA 1DAHA 3IB6A 2PXHA 5ALTA 3R4CA 4TKUB 3NS7A 2WJAA 3VTZA 1SVOA 2AZMA 4CIYA 1MJGA 1UQUA 1EHYA 4W9NA 4K9RA 1KIMA 2UYCA 3D7LA 2H4FA 2V3WA 3I0NA 1U1DA 1QFXA 1ZSVA 4RVFA 5SZKB 1A5AB 4HWKA 1NRJB 4HWRA 5BMOA 1O54A 5CXSA 2B98A 4KPEC 5DX8A 2CHFA 3TOSA 2KBEA 3D8HA 5FD8A 3ZW7A 1ESMA 3DAPA 1QRRA 2V7GA 3E18A 3EIWA 1HLFA 3FDFA 3FNEA 3I6IA 1QH8B 4PAGA 1QNLA 3LUPA 4RCZA 1XB2A 4HGRA 1EZ4A 4KN8A 2P9GA 3RS7A 4AN0A 5ERGB 1Y80A 3HL0A 3HU2A 4ZC1A 3VR3A 5JPDA 5E7MA 2VK8A 3O1HB 5F77A 3OOSA 2IYZA 4Q02A 1IBRA 2O7QA 2XI4A 4MRVA 3MRSA 2BBOA 3GELA 2HNBA 1W5AA 3PDJA 4L5AA 5TF0A 4ZHQB 3T06B 1E3QA 4LYEA 1O6BA 1KS2A 4YT5A 5TMBA 2IU6A 4QFMA 4XUDA 1KZHA 4OHCA 2XWJI 4WECA 1YVPA 2VQEB 3A4VA 1M5UA 2QYSA 4TL9A 2ZVPX 2PGJA 4JENA 5I4CA 1Z6ZA 3AETA 4HAZA 4RO0A 2WWXA 3EQ2A 3LHFA 4GO1A 3CT6A 1N6PA 2WIAA 4CRWB 3FXAA 4M1ZA 4GYYA 5AYVA 4EGSA 4ALJA 1EWKA 4GPEA 1JR3E 3PFFA 4Q05A 3H1AA 2GZ1A 5BR7A 1RRMA 621PA 1M74A 5HKBA 3K6KA 4BZPA 3G0OA 3DE2X 1XZBA 1BJRE 1WKCA 3FIJA 1GVHA 4FYWA 4K1LA 4DHWA 1LVHA 4UFPA 3GLGE 2YXNA 1V6AA 1I3KA 1J23A 1G60A 2VHXA 4HGPA 1P0QA 3BGVA 2C9OA 2CW5A 3TW8A 2OMKA 3Q8XB 1CJUC 4KQWA 4OKSA 3MTQA 1QGUA 3W5VA 2DTDA 4MQFA 1G2PA 3RSZA 2IYFA 4P8RA 4HI0E 4DYVA 1BHO1 1WDWB 5IH3A 4NBLA 1VIYA 3BK1A 2VLBA 3FZNA 1N34B 4UHDA 4D80A 3ANLA 2FG5A 4DE5A 1CR4A 4I4NA 1JKFA 1L5YA 2PYIA 1I94B 1PR1A 2QTTA 3DBIA 1R4NA 3OE4A 1VLZA 1TMGE 4COOA 4GXQA 4OSOA 2XQGA 1IN4A 4BAGA 1ETUA 1CDEA 2PBLA 2OILA 4I4TA 1F20A 4BIMA 3PFHA 4F0JA 1XQXA 3KXDA 1FXWF 3K1AB 1PE0A 3A9SA 3SYTA 3WKCA 1NP3A 3DGEC 4LNAA 4DZTA 1Q1AA 4EA9A 3T1NA 1E0AA 4PS0A 4YASA 4EFLA 1W2GA 2WD9A 2YFQA 4YJGA 3G59A 1DARA 1AUVA 1U0RA 1WP4A 4X8LA 4HAIA 4IJQA 3P9ZA 3ND9A 2X2PA 1Q0RA 2OG2A 3LKBA 3NBXX 3FLMA 4TQAA 4YUZA 5CDTA 1KYZA 2PGXA 4AZVA 4B4DA 4BNUA 3CUKA 3JQ7A 4F5EA 2ICAA 4WZ6A 4NZYA 4I55F 3WWZA 4CU5A 3LQQA 1XDUA 3DOEA 4G4GA 3OZBA 4Y1FA 1JTEA 2WILA 2XBUA 3LOQA 1P7WA 3RW9A 4A03A 5A4KA 4KMRA 1LBTA 4TUYF 1M2KA 4UNPA 4UTXA 1DP4A 3OMLA 4B83A 1ZJWA 4TYYA 1S01A 4COKA 1NVXQ 3CX6A 4CN9A 5DX1A 2C0CA 3ORYA 4I8XA 5IK2A 1GGEA 3PPYA 4D45A 2Y93A 1YB5A 1EUCA 1TW2A 3LOPA 3U4IA 4O3MA 4NK5A 4IJMA 1DC6A 3IBFA 1MB4A 2J6HA 1GYQA 2I7VA 4R31A 1I3OA 4BFXA 2QD4A 3IT1A 5CT6A 5D5QA 5JUWA 1BH2A 4JSTA 4HVCA 4UMDA 4ZVSA 2W2XA 3HO8A 4UBIA 1SU4A 4LQCA 4ZVVA 3QPDA 5ELXA 3DEHA 1D2EA 1N2CE 2V54A 1WSAA 4D0SA 4OI1A 4MJXA 4G2TA 5CXUA 2OZPA 4OHVA 3LK7A 4GH5A 4QLAA 4B6FA 1J00A 1CUJA 3FWKA 2EP8A 5H4HA 2Y1FA 4Q3NA 3VH3A 3CKYA 3LX4A 5BQOA 2RHMA 3V3TA 3IT2A 3TVTA 3BRWD 1O95A 1FJHA 4BNXA 2GVZC 3BSWA 1RAHA 3NALA 3IJRA 4KK4A 4OP1A 5JY1A 3MW8A 3EF3A 4RK6A 1NC3A 1I7PA 3UB2A 3DP9A 5K0GA 2ZIEA 3CUSA 1Z17A 1GCIA 1FYDA 1R66A 1ZCJA 2OD7A 3KR2A 4PTZA 3SICE 3PJGA 2EJTA 1GAQA 2I8AA 1DVRA 1QAQA 3E58A 2XPCA 2R6CA 1VIVA 3BMXA 3FGNA 4JEHA 4QRDA 1Z26A 1PNTA 4QODA 3I34X 4R0NA 4ZODA 4QBTA 3PNSA 2ZJBA 1C1DA 2GWRA 2V7TA 5I51A 3NHLA 2PFGA 2AJCA 2BFFA 3D02A 5HNKA 1OI3A 4YN3A 4ZCIA 3LGXA 4RHEA 3CCBA 3PUIA 3CZ9A 1ZX1A 1AF7A 1FVFA 3H5WA 3PC8C 2X9VA 4PINA 5AH0A 4EBBA 3KQWA 4WOCA 3F6EX 4RELA 4J8PA 2ZBDA 4RCYA 4YH1A 2QGFA 3QPUA 4A8JB 4GSKA 4PLYA 5DGXA 5CB8A 2GUWA 2A2ZA 2J45A 2GBLC 2ZGVA 5DYNA 4ZVNA 1KEUA 2IQIA 3SYLA 5ERXA 1BMTA 2CXPA 3PC6A 1EZZA 1GU0A 3NDJA 3OJXA 1L7PA 4HUJA 3WHKA 4EJSC 1R6TA 2V7PA 4K05A 4XUCA 3AO0B 2JGNA 5CTJA 1W4RA 2Y71A 3K9FC 1JMYA 4HTAA 4J49A 4UDXX 4INAA 4WOPA 3D6VA 3KSMA 4PSUA 5KYYA 3FJ1A 3OURA 3ZKWA 1QPBA 4Y18A 4BZZA 1JEYB 4FCCA 4Q48A 4B6OA 2G3YA 3MTBA 4NX2A 1D1TA 2ADMA 5EESA 1FU4A 4IWYA 4X0EA 1PT5A 4BLVA 3FYDA 1FVHA 4X44A 1ISHA 1R0ZA 4Z9BA 1N3IA 3OLQA 3PC3A 5IVKA 4X20A 4ZAWA 1SZJG 4H1WA 3OIYA 4XTCS 1EVEA 3GUZA 2DM6A 1TVCA 1WMEA 2Y67A 4YS6A 5CMLA 2PMCA 2BFEA 1Y89A 1XTVA 1HY3A 4NCNA 1HA3A 1FLAA 1Q6YA 2OVBA 1C2YA 1ARZA 2VWPA 4I66A 2FPGB 1ICIA 2FB9A 4EEZA 1G21B 2X2OA 1F6DA 4LY6A 2CF6A 2O6HA 1YFKA 2UZ4A 1WUIS 4EI7A 1U7ZA 2Q5FA 4GX5A 4DDHA 3IQEA 2WZCA 2YINC 1BX3A 3PLNA 4URWR 2ECOA 1IY0A 3A8TA 5JS8A 3PXCX 2C5BA 4TYPA 3G0IA 5EMKA 3UTCA 4LJAA 1NSFA 5KWEA 3L1JA 3UJHA 4DMCA 4YCSA 5EJ8A 1CNEA 2XT0A 1P4SA 4NDAA 5FH9A 3TFQA 4HLCA 4CIBA 4FTWA 4L3OA 4OYYA 4TOIA 3ZY6A 3WS7A 3QYAA 4ZQFA 1LC0A 4OUDA 1O94A 2N3ZA 1A0OA 2ST1A 3K9BA 2Y6UA 1J2EA 1NFQA 5M3BA 3UMBA 4DYHA 4F6RB 4TTPA 1S9DA 4P7BA 4EW1A 1WPQA 2XVAA 3QE3A 4WBXC 5FBKA 1RWPA 3BULA 4NRDA 4YP9A 3WNQA 4MNTA 3IDSA 3OPYA 4CLRA 1U8UA 3COZA 3D6HA 3FPSA 1E9BA 3L7IA 1FIUA 2WTAA 3BRCA 4H3SA 2PRIA 5J40A 1E1RA 3C8UA 2JD1A 4QUGA 3JAKA 3QE9Y 2IF2A 1DBSA 5E4TA 3LRPA 4CG3A 3H2GA 1T5LA 4HQNA 3G2MA 4TTJA 4FSDA 1WBJB 3AR2A 3MCTA 4DNQA 4GRAA 4KQ6A 3AG5A 4Q4JA 3B1VA 4I9HA 5K0ZA 4WOKA 1MU0A 2L42A 3UXMA 2AVNA 1YZYA 3ESRA 5M04A 3FYUC 2VPTA 3EX7C 1C14A 1DT5A 1GR1A 2R6FA 3CNOA 1Z6YA 4E31A 4CM9A 1UJ6A 4YDQA 5SY9A 1FFGA 2CHQA 1C4OA 2IW3A 2FPOA 4GPZA 5M7EA 2X1HA 2O2EA 4CM5A 1YOBA 3LSTA 4UM9D 1N5IA 2MSEB 2TECE 2QTAA 1AO0A 1M6YA 3JAWB 3T9AA 4AK9A 3WLQA 5A04A 2DEUA 4IMIB 3L0PA 4M8IA 2O52A 1C9DB 4O3FA 3WRYC 5KTSA 3LX5A 1QYWA 1VGVA 2RGYA 2BFMA 2YV1A 4GKVA 4GBED 1IM5A 3FBTA 3FKJA 1RD4A 1SIUA 3FNRA 1C4WA 1V25A 1GUAA 1J0AA 4JAVC 2OC4A 1V37A 3L4JA 3ZQ6A 4U02A 4EJMA 1JZTA 2Y77A 1AJEA 4J0KA 3BWBA 2BGKA 1JYEA 1OXBB 4B7XA 4LJ7A 3ABQB 4DJAA 2JG3A 3Q1KA 3QUCA 3SC3A 3QITA 4AMZA 1DIOB 1T0JB 1RHMA 3CUUA 4L51A 5LLTA 5DASA 1CZRA 4ZI7F 4MI3A 4D6PA 3AYXB 4XOUA 5DNCA 3RUEA 3E05A 1P1RA 5AKEA 4LUCA 3LL4A 5H4GA 3VYVA 1E9EA 4OHFA 3CM0A 1HEYA 3UW3A 3HLTA 4GOLD 1K5PA 3LCJA 4KOEC 1EM8B 3AIIA 1TVKB 1GPYA 1MB0A 1VQ1A 2UVDA 4M53A 3HY4A 2VJPA 1YS6A 3DEFA 3LVRE 3I6MA 4AJ4A 5JCJD 1K0UA 2N9UA 2WOOA 1NJ8A 3CZPA 3FZQA 4I4LA 2NO9A 4UREA 1KMCA 1T3LA 5ALNA 1GRNA 5AXDA 3PFKA 2J9GA 1D1PA 1L4HA 4JJIA 4Z9YA 2XTAA 4EKEA 4C7OB 3LE8