4PGMA

Saccharomyces cerevisiae phosphoglycerate mutase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
235
structure length
235
Chain Sequence
PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOGLYCERATE MUTASE 1
publication title The 2.3 A X-ray crystal structure of S. cerevisiae phosphoglycerate mutase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 80
structure length 235
sequence length 235
chains with identical sequence B, C, D
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 1997-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4pgmA00
3D6AA 1QWOA 2H0QA 2HHJA 1SK9A 3DCYA 3ZHCA 4GPIB 1YJXA 1CVIA 1SKBA 1FZTA 2BIFA 1H2EA 2HIAA 3K4PA 2H4ZA 3E9DA 3QPUA 4MA4A 5AJZA 3QPVA 2PA0A 1DKNA 4PZ9A 1C81A 1DKQA 3FJYA 5AJVB 4D4KA 3DB1A 5AK0A 4JOBA 2P2ZA 1C7ZA 3D4IA 4JODA 1T8PA 2P79A 1C80A 1DKLA 3IT1A 3LNTA 1BQ3A 1IHPA 3K4QA 3NTLA 4IJ5A 2AXNA 2OWEA 2P9FA 2EKZA 1UJBA 2DWPA 3F3KA 3LG2A 3PGMA 1RIIA 4IJ6A 2RFLA 1K6MA 4TSRA 1DKOA 1UJCA 3MXOA 3IT2A 1QFXA 4QIHA 5HTKA 2H52A 4E3WA 4ARSA 3D8HA 2I1VB 1YFKA 4D4JA 4FDUA 1V37A 3KKKA 1E59A 4EMBA 1EBBA 5PGMA 4FDTA 3FDZB 3HJGA 1TIPA 2A6PA 4EO9A 3BIFA 2ENUA 2QNIA 3E9CA 5AJXA 3NFYA 3E9EA 1RPAA 2H4XA 4PZAA 2HPAA 4PGMA 3F2IA 2ENWA 2WNIA 1ND6A 1SK8A 1E58A 3EOZA 2IKQA 1SKAA 2P77A 1NT4A 2A9JA 4ARUA 3LL4A 2P6MA 3R7AA 5AJWA 3C7TA 2YN2A 3EZNA 5CDHA 5CU7A 1H2FA 1FBTA 2P9YA 4D4MA 4AROA 3IT0A 3MBKA 4JOCA 5AJYA 2P6OA 3GW8A 1DKPA 2EKBA 2OWDA 1RPTA 2P2YA 4D4LA 2WU0A 2P75A 1BIFA 3FDZA 1ND5A 4HBZA 1V7QA 2GFIA 2DWOA 1DKMA 4ODIA 2EOAA 1QHFA 1XQ9A 3O0TA 2WNHA 4GPZA 2P78A 3QPWA 3OI7A 2P30A 2F90A 1BQ4A 4ARVA 3IT3A 3GP5A 2P9ZA 5CX4A 5HR5A 2YN0A 3GP3A
chains in the Genus database with same CATH superfamily
3EY4A 2FR8C 4HFRA 3CHYA 3TO5A 1Q0HA 3S68A 1XNRB 4F3TA 5AD1A 1POWA 3WQBA 3WY9A 3VU8A 4YX9A 2BAGA 3U5TA 3F0TA 3DNFA 1J39A 4JT2A 1MJFA 1D3AA 3SR0A 1FUYB 1MV5A 4P31A 4M0KA 1JDTA 2Q5OA 1ODCA 4QX6A 2IWHA 1RWXA 2O14A 1G19A 4JJFA 1OI7A 1CUBA 3OHPA 1JBKA 1NAHA 1Z35A 5DT2A 1W4RA 2L0XA 1H4VB 1RE0A 2IYSA 3IPXA 3VPAA 2VJMA 4CIVA 4QECA 4V2UA 1F4LA 2BJWA 4UDNA 2AIRA 4D81A 1U7TA 5KQRA 2WG1A 1DMSA 1XAGA 2YMPA 2AZDA 1N5KA 3NP9A 3KOUA 1YZNA 4IEEA 3DBLB 4CBVA 1XKXA 3OEEA 4IH1A 1UAAA 5GVSA 4JP5A 3NMUF 1QU3A 3ZK8A 3OY2A 1A2OA 4OQEA 3GRUA 3FETA 1MTOA 3C14C 3IIEA 1YIOA 2CKDA 2UXDB 3HN7A 4MJ7A 1TMYA 1HC7A 4UTOA 2W8BB 4ARZB 1OT5A 3L18A 3DR5A 3IALA 3HBNA 3LO8A 1WY5A 1RIIA 1KP2A 4MI3A 1NVBA 1HKHA 1WZIA 3ESXA 4QTZA 3VKVA 4R0MA 4X44A 2FVXA 2OORC 2PGLA 1URPA 4D57A 1GTL1 2FEWB 1J22A 4NVRA 3EA5A 4DYHA 3MGKA 1OXKB 1SKQA 4N54A 3GGJA 4TUYA 2B94A 1SVIA 2XMRA 4YRQA 4ERXA 1PSWA 3JATB 5F78A 3H6KA 3PEUA 1R8SA 3RYCB 4ZN6A 1QK4A 4PEVA 1TPYA 2JGJA 4AZ3A 2V3CC 2YJZA 4BVGA 1B0PA 3MCTA 2ZWVA 4HNTA 4XIFA 2LUOA 4EA8A 1ZSVA 2RK3A 2WKSA 3MIZA 3LYHA 4ZU6X 3V46A 4P36A 1PSDA 2FKAA 3ADOA 3SY8A 2HY7A 1DBWA 1U02A 3FTNA 4HLQB 4X1OA 5A5FA 1KIFA 3F3MA 3RIYA 1R18A 3MJFA 4YUZA 1EFPA 3TDMA 1GEGA 2PXXA 3MRXA 4B40A 3NKFA 4DIKA 7ADHA 2O50A 1ZJ4A 5FWAA 2C4HA 4CTKA 1EKXA 4BMXA 3L4KA 1UC4B 4ZQBA 1YR6A 5A4KA 1CD5A 3ED5A 3MWFA 4I1OA 2Z98A 3GEGA 4YHHB 1ZGAA 2P9TA 3WLHA 4PIVA 2FSVA 1NN3A 3HM9A 1DQRA 2V6BA 3MWJA 3LLSA 4Z99A 1RI1A 1YZKA 1MRZA 2ZRBA 4KK3A 1R4MA 4U6NA 4L4XA 5CDUA 4ND8A 4KI0A 2BBOA 4O4HB 2Z56A 1L8AA 2Q45A 4LAFA 2A4MA 3MAJA 1N6OA 1GTMA 3PC8A 1F6BA 1KETA 2QUIA 3C6ZA 5EQFA 1L2TA 1RAFA 3RHFA 3WLSA 5HK9A 4WN3A 4IF4A 5AVUA 2Y76A 4YJGB 3W3ZB 4F4DA 3Q72A 5JNSA 2JPDA 1BDBA 3MCWA 4UHBA 1VJ0A 2WAYA 2XF8A 1J09A 4K6MA 4DRXB 3GGOA 4N5DA 3DHEA 3GLTA 4FE4A 3KOZA 1H23A 1XSEA 1V16B 3KFLA 1SRQA 3O38A 4RQTA 4QSHA 1QWOA 5AM1A 4REQB 4EQ6A 1ULBA 4RTJA 4ZICA 4LY3A 5ESRA 4A9AA 1KH2A 1V8PA 2RGWA 3JVVA 2ZJOA 4NDZA 2ZOSA 3P0IA 4X7RA 4YJ3F 5CR9A 3TLBA 3QZUA 5ERYA 4POOA 5BNTA 2O8FB 3PGVA 4L5CA 5K0BA 1I7QB 4OHZA 4HGRA 2FMXA 4WZAA 2ZTMA 5EIHA 3LPAA 4D3ZA 4OXKA 1KAHA 1YI0A 3PUXA 4HDRA 1YDWA 2ZRMA 3PKJA 4N0PA 4R05A 3T06B 4DPKA 4CXMA 2EFEB 3KYIB 5T6MA 3T1QA 5D8DA 1T9GS 4JLBA 1U7OA 1PGPA 5EMMA 5IAEA 3R8CA 4E7PA 4LJ4A 1XQXA 2AYZA 3QE3A 3PZRA 2JHPA 1L8LA 4CM9A 2FN9A 4WK2B 4ZYWA 1DXYA 1C0LA 3M6FA 2IITA 1ESMA 2C92A 3BDAA 2ZB4A 4JBWA 1HDGO 3GH1A 3V8PA 3VOTA 4ZHSA 4P3YA 2CGEA 1U4NA 1YS9A 4TXLA 3U44A 3FY4A 5HQTA 2IS4A 1UBUS 1HURA 4H3VA 1XRJA 1C2TA 3N28A 3BGSA 3EIQA 3CUTA 4ZT6A 1O57A 4B2IA 1IXZA 4JV5B 2ZVPX 1YCFA 3F71A 1PI3A 2CVZA 1WE2A 3O8DA 4FN5A 1CJUC 4JJEA 2X19A 3HG7A 5FD8A 3NUZA 5JXHA 1L4EA 2OKCA 4F2HA 2GCIA 1WTCA 3T9AA 3D6JA 4RPLA 3HRHA 3U4DA 4BMCA 5CPFA 2QL9A 1NBME 5CFQA 3PWSA 3EXHA 1UKCA 3HCNA 5T3YA 3VM6A 2JFGA 4P5DA 1VCHA 2WT4A 2Y1FA 2Z4TA 2VAWA 3FCUB 4M2LA 3LH5A 1O9HA 3KPYA 3B60A 4QARA 4L4SA 4XJSA 5A3RA 2QVZX 4QAJA 3DOUA 3GY0A 5EMLA 1NBEA 3M34A 2CWDA 4IQ4A 1CY4A 1YVRA 4JWTA 3PGKA 5EEHA 2XHEA 3KAPA 4R7TA 2YZKA 4P4TA 1Z6XA 3CH7A 4KQ6A 1XTIA 3RANA 4AWAA 4QRIA 2CWWA 4WESB 4HGOA 3UBTA 1PD0A 3PUJA 5ECWA 4I9NA 3R6GA 1WEKA 2WPDA 2AF4C 3GAZA 4ALMA 4EPRA 1FBTA 2A14A 2DQYA 3GCGA 1OQAA 3GEEA 5SY9A 3T7AA 5JECA 3HWX1 4QTYA 1G3UA 1JQAA 4WECA 2NTYC 1IEXA 4Q21A 3PYLA 3C45A 1DWQA 1C30A 2BOVA 4EYGA 4N0QA 1UT8A 3U7QA 3H7AA 3OF3A 5BMVB 1MQ9A 2QL7A 1I4EB 3AR3A 2COUA 2YJTD 3HR4A 3NJ8A 4J9UE 3VNQA 3UW3A 3QJ5A 1N75A 3G2KA 1AQUA 3BX1A 3LC0A 5JSKA 1KC1A 3ZY3A 1MRNA 4BLVA 3TJZA 4UQOA 2IP1A 1LB1B 1YNSA 2CT8A 5SZHB 4NE2A 2RE8A 2ILTA 3V4RA 1N1GA 1OXVA 3ADKA 3IBTA 5T4EA 2ZANA 5FDFA 1P6UA 3A9CA 3CF4A 3QKSA 3SC4A 1JDBB 1M8KA 3DV0B 1X8XA 5SY6A 5BVGB 5TT1A 1N3YA 1FS4A 2DCUA 2VK2A 2XRFA 3EUWA 3ZLUA 1M1YE 5KNCA 1T6XA 3CY6A 3NT2A 1S6YA 4PLCA 5EJ7A 5KPJA 1N7JA 4XJTA 4R71A 3EX7C 3A3KA 4DSTA 2AH5A 3L92A 1HQDA 1MC8A 1ZM3A 3TNJA 4AIRA 3JYLA 4WZ6A 1ARZA 2K4MA 4OSEA 4W9MC 1ECLA 1NUQA 3CTMA 3ZC3A 2ZSKA 2ID8A 2YOHA 2BFBA 4UM9D 1DKNA 3M3DA 1T5HX 2GPTA 3R0ZA 4QDZA 2IYOA 5IK2D 3BK2A 2I8LA 1FU8A 4OJKA 3JV7A 4YI3A 3ZQ4A 3P0FA 1AB6A 1A97A 1RWMA 1Z39A 3EQ2A 4FCVA 4AMBA 2H1CA 3PXDA 5T57A 4XVCA 1PBTA 1KAEA 2WABA 4RV4A 1NT2A 3R3XA 3F6PA 4W6ZA 3TOVA 4ROSA 2HREA 2P1DA 4Q00A 2FCAA 3GNSA 2FX5A 1ZVKA 2FGJA 3WLEA 2X0EA 4JI3B 1LK7A 1U0JA 1Q44A 4CM8A 1Z08A 3CZ4A 3GPLA 5I6DA 2WWVD 1W6RA 4EB3A 3MTGA 3PHBE 3HKBB 3REFA 4BYMA 4EJSC 1I2AA 4FMCB 3OZVA 4L0QA 2WE8A 4QJBA 1SZCA 1LLUA 2HJWA 1O6ZA 3N70A 3TUZC 4BOYA 2Q3MA 1F2UA 1P74A 2XXBA 1W4BA 1FJ2A 1JW9B 5FPPA 4R8MA 4B3HA 5BSFA 1MJ5A 3SVZA 3RB8A 5AUQA 1JYFA 2H8KA 5DLQC 5SYAA 4QU0A 4DWJA 5J4YA 4I36A 2I65A 1ZCZA 2FGKA 2I1VB 4OP1A 3ZCXA 3EDYA 2GASA 3GLKA 1FVFA 4TRMA 5HMLA 5BWOA 4X45A 3AUJB 1O97C 1VB3A 1H9CA 3RQSA 2VSYA 1KDYA 3FOWA 4WCFA 3E05A 3T3HA 421PA 2YFKA 4A27A 3OA0A 1NBAA 2CLOB 5K05A 3RFVA 1LQTA 1W49A 2ZIXB 4OHPA 3GLHE 1E1YA 1QZUA 5KTMA 3ECSA 1IRXA 1OU4A 4KRYA 3I6IA 3O1HB 4DCSA 1C3OA 2Z2YA 3DP7A 4Q18A 1L5NA 4DCUA 2FQWA 2REOA 2WJ6A 1RCTE 4GWGA 1EA5A 2Q4OA 4LJ6A 1K9SA 3K6SB 3C7KA 2DKOA 1Y1KE 3O21A 1GTRA 3F7OA 1JQ5A 3FUWA 3Q10A 3WKAA 3LP5A 4MTLA 1NUPA 1W2HA 1NN5A 2YZGA 1KDVA 2B21A 3GAAA 3JQEA 4HC4A 5E0OA 3LXUX 3NPMA 3WL8A 2VQEB 5JJKA 1JTVA 3BXXA 4OYRA 2WWFA 3P4UA 1JAZA 2H06A 4HWTA 1MB3A 1NMQA 2H3HA 4ZJUA 1B93A 3ZYZA 4MV4A 3A2KA 1VJDA 1XMSA 3FUUA 4B7XA 1CDEA 4M1MA 4P0PB 3HXLA 4MMYB 5ESWA 1SZDA 2GFIA 3DLTA 5DEIA 3AIIA 4KFUA 4KR6A 1P44A 2Q1TA 5KU7A 1FMLA 2BMDA 4LC0A 1ISFA 3DMRA 5J5CA 5IBCA 5KB3A 1WG8A 3U3DA 2P4QA 4DG5A 1M2JA 1RU3A 2A30A 2GZ1A 2PLRA 2RHLA 3L8CA 1Q6ZA 4J16A 4JR0A 4QQFA 1E9EA 4TN1A 1C8LA 5A71A 5LWHA 2W2XA 1H8HA 3S27A 4CLDA 1G42A 4BO0A 2E4UA 1TMGE 5CMLA 5HUHA 4RL4A 4EEZA 2QRUA 1UC9A 3FPBA 3UXHA 3UUWA 3EMBA 1NN0A 3WRXC 3QPDA 1CJSA 3QYPA 4KAAA 2WTUA 4K6CA 3IP3A 3ND7A 2FXVA 2HJSA 1N8KA 5LYJA 3MMSA 4Q02A 4XJXA 2QVGA 3QPUA 3OAAA 5C8VA 3X43A 2O3RA 3L7OA 4FFNA 5K01A 3M8KA 2XGJA 3GDGA 4QYSA 3ZHUA 1OXXK 1D1TA 1G1AA 4F8JA 2WYOA 4ZOAA 3VC7A 3ZHSA 1U28A 1YR1A 2QPTA 1SU6A 2XKJE 1EZ4A 4BQRA 1K8XB 4NBLA 1XRPA 1YRWA 3K9WA 2OCGA 2PMDA 2ASEA 1M2OA 3NONA 4E07A 5K3EA 1THTA 1P3Y1 4UHJA 2HJ9A 3BEOA 5LQAA 3NYWA 4HNVA 2QB5A 1CUYA 1KQ3A 2VP4A 1QNFA 1VMEA 3ESYA 3RQIA 3PE4A 4U2CA 3ZHRA 3MT9A 2JHFA 1JFLA 1RC8A 2FW7A 4HAWA 1TC2A 3BREA 1G6HA 3T0IA 4F2PA 4ZOQI 1FA9A 1B3BA 1FXUA 4GBGA 4I5FA 1DAIA 4M7RA 4TMXA 3SR3A 1OASA 2XMZA 3RK0A 2Y3IA 1Y1QA 3D6MA 1Y3CE 2CFOA 4OH1A 4R01A 4R6WA 2YOGA 1H85A 1NE2A 4M0DA 3RCBA 3QE4A 1HTWA 5JROA 2FJ0A 3HRKA 4C76A 4CLRB 3JAKB 2GRAA 1SBZA 1B41A 5HF9A 1HA3A 3GGPA 4FFDA 1ZJWA 1NKVA 2C4KA 3USZA 2YJ5A 1WSAA 5JZ9A 3BK7A 4PO9A 3QW2A 2NYVA 4RETA 1SVWA 3KQQA 4QXAA 2QTFA 4YQEA 3TJMA 3DL7A 3IEPA 1U5BA 2BM1A 2Q4DA 3O8BA 1CRPA 1L0BA 1CYDA 4RANA 4ZZ3A 1US8A 3W8RA 3D4PA 1UDBA 1ZINA 3Q2OA 4DY4A 3PXAA 2A9KA 5IN5A 3U4QA 1HV8A 1PJCA 4Y9DA 4COKA 4ND8B 4BCBA 1HWYA 1P0CA 3BF7A 5AI4A 1I2MA 4JQZA 3ZBUA 4PX3A 2RHHA 3ISTA 4PLWA 4EKNB 3L4SO 4YNBA 1SUCA 3RC1A 2ZWMA 3MOGA 4NR0A 3GJ0A 3T0GA 1C7RA 3W8EA 2I3ZA 2X5OA 1GTVA 1VRCA 3I4CA 3Q8XB 3QE9Y 3K2BA 2YVUA 1RXVA 1X94A 5FV4A 3ETGA 4RK1A 1PDVA 1WBJB 1UBKS 1DQYA 4Q24A 4UUMA 3SG0A 3C5WP 2MSWA 4LHYA 2GLUA 4YONB 4C29A 1U2SA 4MGEA 5JTTA 4P4SB 3ZOZA 3D8NA 3VJKA 1QKKA 5JC8A 2PXCA 4U7JA 1G8JA 1JR2A 5KMGB 1SRRA 1VLQA 3O2SB 4LFCB 4RK5A 2G9VA 3U4GA 3OSZA 4BJ5A 2IJGX 3DPSA 1A4XA 1SFRA 3L6OO 4E2WA 1EVQA 3A0RB 1VHDA 3E3NA 4WDRA 2W4MA 4XM1A 2VH1A 3E7FA 3EIOA 4P33A 5K4AA 4MWBA 3EXEB 2PJRA 1U5AA 3OTHA 4Z4CA 5AMXA 1XMXA 5FYDA 1T6YA 1WW2A 1NW7A 2P9EA 2Z3VA 3IQEA 1QHIA 4FOLA 2DUNA 3OIWA 2CC2A 2RIPA 1IXKA 2QE7A 4I8XA 1JQJC 1K89A 1MEOA 2Q5EA 3FNIA 3GN2A 4MQLA 1JMKC 4MR8A 3SS7X 1N8NA 1M2WA 3VYRB 2B1QA 1YGYA 3U6KA 1DC5A 5JS2A 1FNDA 3ONNA 5D1NA 4D99A 3L8GA 4DR1B 3FCYA 2WM9B 2CY0A 4NCHA 1ST3A 1ZUNA 1UBSB 2CL5A 3GJSA 3HKBA 3ISVA 1IZYA 4XUCA 5DFAA 2JK0A 2JG3A 5A0TA 2ZWOA 1MXFA 4AYWA 5LOVF 3D0QA 1F6DA 2B1RA 1FOEB 4DV4B 4GHWA 4MUEA 4DLYA 2I6TA 4KYTA 4NAUA 4E03A 3QKRA 1OD6A 2BKXA 5BSMA 5C2JB 1A5BB 1EFCA 2P3LA 2D0IA 3QOXA 4OK3A 1LVUA 3K4QA 3SNKA 2R1TA 4HH0A 2DTEA 1A7JA 3O8CA 2DC1A 5CVTA 1T0JB 4KV9A 1YC2A 4OQPA 4NNJA 1ECBA 4K6OA 1UF9A 1ZJ5A 1ZK3A 5DTEA 3GT3A 3AWIA 4I5EA 1F9EA 5IMSA 1VBKA 4HH4A 4A8PA 4GX2A 2O8EA 5SV2A 4E5NA 5ISMA 3UWSA 2JGAA 3ONVA 4EEKA 2XXAB 5AUOB 2WW8A 1QFSA 4OJQA 3OJWA 5E8JA 1DMRA 5KS2A 2H59A 3COYA 1BGWA 3QEJA 1BX0A 1H69A 5HP4A 2EW2A 1SOWA 2Y05A 1KMCA 3YASA 4TUYF 3RS4A 5K0SA 5KVCA 1UBOS 3C6BA 3VDNB 2J4DA 2ZWPA 4BQIA 1R74A 3I3OA 3WADA 5KYXA 4U2DA 3Q5EA 3EBPA 3KSUA 4TLLB 3HJFA 3WA7A 5FL3A 4AJEA 3TLGA 2ISQA 3EXFB 3H9BA 4ZOLB 1AV7A 1G66A 3PHJA 3H0EA 5J2UF 2FSIA 5IAJA 3FPHA 3E9EA 2YWCA 1U5CA 1PL8A 3CE9A 3Q3CA 4BL5A 3H5LA 4R0NA 4P7JA 3PUZA 2BFDB 4GO1A 1M2EA 2ZT6A 5CA1F 4HXGA 5LNK6 2OHVA 1CR0A 1PL7A 1CYEA 1QZ3A 4Y2RA 3GF4A 2LCIA 2WAMA 3CX3A 4IDGA 5ITSA 3AV0B 3DHWC 1IM8A 2IHTA 4F9TA 1ODJA 4BO1A 5LB4A 3EPHA 4MQFB 3RTAA 1T2DA 1RTTA 3UWOA 5K0CA 5JQGF 2ZRDA 3E81A 3M1LA 2QTGA 1JEEA 4PCLA 3OCZA 3L8HA 3L6UA 3NBAA 2B4AA 4GXNA 3NHPA 4Q1DA 4QLAA 3K9QO 5AKXA 3W1VA 1NW3A 1OJLA 4U6SA 5LM3A 3OPYA 1KMIY 2EDCA 3SIPA 1STOA 1UM9A 1XD2B 3A3NA 3I2YX 4KHZA 4N3AA 2ZUFA 1I32A 1NE7A 4YRGA 4GBMA 1P8JA 3SR4A 1WQ1R 3VC2A 2OORA 2IUYA 2WIDA 1DOZA 3OIGA 5KTYA 3LUDA 1DARA 4AXXA 1N33B 1WHSB 4NFHA 3KD3A 4BTVA 3D8RA 3CRMA 2ISSD 1DO0A 2D1SA 2PX4A 4H1VA 5GP1A 5LJIA 4IGFA 1Z45A 5IMBA 2I4LA 3TIXB 2I5PO 3ETCA 1DG1G 3I6MA 2YIVX 4OXRA 2J4CA 3BFXA 3CZCA 4XWGA 2X5JO 1CVIA 2EBUA 3JTMA 2YIJA 3A6KA 2QD1A 3IDSA 4YGYA 1A69A 4RQBA 3OIDA 2C9OA 2YWRA 3DMTA 5HRUA 4WH0A 5A3JA 4D98A 3NNSA 6AT1A 3HY6A 3Q40A 3QXXA 4WNIA 1EGVB 5HE9A 3K0CA 4X54A 1VHWA 1GZ4A 3I2HA 3HA7A 5K6RA 4A3SA 4BDTA 1Q1GA 4KRFA 1JYEA 3GXBA 3IBCA 3IYLW 2RHWA 4Y9SA 3VVBA 2C8VA 5CB4B 2I87A 2QE7D 5B4UA 3ZDAA 3I9V1 1NNI1 3RVKA 4PLTA 4G0NA 4QUHA 1SKMA 3H8SA 3IDFA 1JRLA 1JHYA 2QA5A 3EDRA 3LHDA 2OWEA 1NVTA 2VT7A 1TT5B 2YX1A 3GFFA 4JUCA 3V5NA 3BL8A 4G37A 4KQ2A 1L1RA 3ZWXA 4RD2A 1JQ3A 3OE5A 5T7BA 1SXJE 1PJ3A 2C5LA 4US2R 4OGLA 4WGFA 3DE1X 7AT1A 2C96A 2HAEA 1KJ8A 2NZ2A 1JIUA 2Y77A 1PEKE 1M1NA 2AF3C 3TL6A 4H7KA 3NIWA 2I3AA 2PJZA 1PZXA 2X1MA 1FSZA 2EX1A 3GAMA 4ARSA 4KK4A 4B4OA 3ZNPA 1UBHS 1OE0A 2R87A 2WK1A 1JF8A 3NANA 4X65B 3N76A 1W36B 4Q9NA 2DEUA 3FW1A 3TW8A 4XD7D 5KSWB 3P4XA 1FU4A 4E2ZA 3ZN2A 1NKTA 4EMBA 1SB9A 5LU9A 1XYVA 1OBOA 2ZATA 2XZDA 4JL8A 2NU9B 3ZI7A 1QP7A 4KBGA 1MMFB 4GYYA 3QMPA 2VTBA 3CT4A 4I4LA 4PSDA 4UBIA 5I8WA 3HJHA 1QHEA 3RTEA 2B78A 2D5BA 4GR4A 1IATA 5JOQA 1L4FA 1EK1A 1TM4E 1VRWA 3KJGA 1VKOA 3OH8A 3I5MA 4JUFA 4OXXA 4Q12A 4Q6BA 1GM5A 3WWDA 1GFSA 2EERA 1SKAA 2AG5A 5FPHA 2RCNA 1MB0A 3UV7A 3PA8A 1BSVA 2FHPA 3LUKA 5AHRA 1KPGA 3COVA 3OU2A 1JZTA 3P20A 2J87A 4MKFA 1TYEB 5J43A 3AC0A 5AK3A 1P1BA 3BQMB 3ER9A 3G9UA 2ZIEA 1ODIA 4CR7A 3ADDA 1W36C 1ZGGA 3TTWA 2XT9A 3THYB 1N77A 1ZOOA 3D2BA 2BHRA 3B7WA 4BQSA 1U0OC 2SECE 3GLGA 1GZSA 1CTQA 5ADHA 4DFDA 4UQLA 1A9PA 5HRAA 4XUGB 4EW3A 1N0WA 3L01A 5ALSA 2WSMA 4PQRA 5LYJB 1DKMA 1MQAA 4XDZA 4MDYA 2RH4A 1M5RA 5AI8A 1K0FA 1TM1E 2QRNA 4PC1A 2W00A 4UEOA 4UHFA 1V48A 4DL9A 1ZGJA 2WIBA 1Z6ZA 2OQ2A 3LC7O 4JLKA 4KFTA 1YCGA 5ALKA 1XTTA 2HNAA 1BMTA 3HB1A 4M0EA 1Y3HA 4DA7A 3BD9A 2AE2A 4DA0A 4ZYUA 3AFNA 3E18A 3NOXA 2C99A 4FR0A 9GPBA 3LA8A 1CZRA 3OTWA 2WEKA 1VHJA 3NYQA 4ZMSA 2UZ4A 1A4IA 2O8VA 2QQFA 1LGYA 1E3EA 1E2EA 4NATA 4BQQA 4BVHA 4DANA 2WU8A 1FTWA 1U1FA 4BN5A 3B9QA 1YONA 2VJLA 3LQ1A 5REQA 4ATNA 4E5KA 5A06A 2HSWA 4EFLA 1DAFA 3FNBA 3C8ZA 1OC4A 1H66A 4L8YA 1HLGA 1RJ9B 4I46A 5EESA 1E0KA 3D6HA 3OHMA 5EL0A 5FBWB 3UENA 1YVPA 3VYUB 1H05A 2ZR0A 2FAXA 4DM7A 1U3WA 1EX6A 1Y63A 2KBFA 1B2LA 3HNPA 1H6BA 3PD1A 3CLKA 4Y9TA 2QGZA 4C7MA 2OY0A 2Z9BA 2KSQA 3NBKA 4C4TA 1BD4A 4CLRA 4AZ0B 1GNTA 2OV8A 1DJLA 1SQFA 1CUHA 3ZVNA 1FFSA 4TL7A 5ETJA 4BMDA 5KOHA 3FZQA 3S7TA 3VDMA 4ML3A 5IRCD 1E2NA 2QVLA 2X6TA 1AH2A 2UUBB 2ZPTX 3ZW8A 4J6FA 2Z8ZA 1AHNA 1UANA 4RH1A 4YLYA 3PGA1 1XCPA 2QAIA 5JJCA 2JGRA 1RNLA 1O9GA 1FTGA 1QAMA 2DWPA 2H2DA 4FDAA 4NG5A 4U8GA 3ZIAA 2H7VA 1INLA 4MW0A 3Q0IA 1WETA 2QN2A 3D3NA 1K6MA 4TKVA 3MXOA 4M21A 3ICEA 2H0AA 1S4MA 4YRMA 1VIAA 4DMUB 2QAGB 1LX7A 1QU2A 4XI9A 5JV5A 3JRXA 4RNCA 1DT3A 4BV8A 4IGIA 2G25A 4JYCA 2WYUA 5IUJC 4P4UA 3IMCA 4ZCQA 3SF8B 3T54A 2EYUA 1A7KA 1DVRA 2QENA 1RM4A 1OH8A 2XNDA 5CFOA 1EESA 4MS3B 3AZQA 2FKNA 5JO9A 2OO5C 5FTKA 4CMKA 5A04A 2QOEA 4HDSA 3REGA 3L4BA 3D6UA 2W2LD 4GYJA 4RQUA 3PXCX 3O4HA 3GJQA 4G5HA 3KVYA 4DSZA 4P4SA 3R6LA 2ZEJA 2OG2A 1FRFS 2BMWA 2BR4A 4JP1A 4UVDA 5B1HA 2DR0A 2PKYX 1WX1A 3L7JA 3L4EA 1ZFNA 4PYNA 4RY9A 1RC0A 3SM9A 3X1JA 4ARUA 3PC2A 1MIOA 3LY9A 4DLNA 2UVDA 4KO8A 5A6SA 3OE4A 3MTDA 3HXMA 3R0JA 1I0ZA 4CE6A 1DJOA 3HKDB 2AV6A 2FMUA 3KXKA 1A2QA 2R25B 3MFQA 3MGCA 4BMPB 1U0GA 2WVHA 3NS7A 3ABQB 3AF5A 1JVNA 3MWGA 2MWMA 4D82A 4EG6A 2XRYA 1AKRA 4Q4AB 4JOQA 2Q6KA 1XXHA 4WV3A 2ZSUA 1C9YA 2XWBF 4J43A 3P7MA 1W76A 4M60A 2NZXA 4TL6A 4BAGA 1S9DA 7GPBA 1FFCA 4OVKA 2QLTA 3MUEA 2VJNA 2I91A 3SBOA 3S40A 4OP2A 1SMKA 4H1UA 3QP9A 1BQ4A 1G9TA 5EOVA 4F21A 1PJ4A 1XPJA 2H2FA 3LLVA 1A9XA 3I92A 2WZQA 5DI3B 4QUIA 3RUHA 1VB5A 5DX1A 2OZLA 3BWCA 1N9ZA 4F3NA 1JDSA 2W2QA 1PR2A 1U7DA 5ILOA 3H4TA 4QPNA 2IOFK 5JJIA 1RQ2A 3BXFA 2JFXA 2FWAA 3EDMA 2DFLA 1YK0A 4DNFA 1TTPB 3Q41A 5D3MA 2GD1O 4OM7A 3VNBA 4RQAA 1XTSA 5ERGB 1XZJA 4EKDA 3WGQA 1QIEA 2OVFA 1PJ2A 1TT5A 2P9CA 4AIIA 4YRIA 3M6AA 2OESA 5LC1A 1I3CA 4WVLA 4YWJA 5JSUA 1TU4A 2J0VA 3LS2A 3DB1A 2DX7A 2IXBA 3HP7A 2E85A 3GH3A 1Z5OA 2VOJA 1Z0IA 2ABWA 1P73A 3FXAA 3BMQA 1M6EX 1XZAA 4QYMA 3WMRA 2JFQA 3HM2A 4Y0NA 5M3BA 5CCEA 1CRQA 5AI9A 2A78A 4TS4A 4AICA 3ZLJA 5L40A 3B78A 2ZJ5A 3UK1A 1ADJA 4LISA 1PJSA 4D92A 5KYXB 2XRZA 3I2GA 2P62A 3CVUA 4HXEB 1AUPA 5JBQA 1IXSB 2WM2A 1QYWA 2VN8A 1CUXA 3MT7A 4UD6A 2DSTA 4YAIA 1IXYA 1LEHA 2XX3A 4L6CA 3EULA 3GHHA 3K16A 5IYZB 3HO6A 3INGA 3I2KA 1H0SA 1WXIA 5H70A 1IFXA 3JQBA 4CIDA 3CGWA 1JE0A 1NV8A 5IN4A 1QFXA 1CULC 2B35A 2XVMA 1O7JA 1ZI9A 2GPNA 2QMHA 5A9SB 5AVQA 5L95A 1U3GA 3G6KA 5EXDA 2E5LB 1UOPA 3HJNA 1P9WA 3EF3A 4FKMA 1YE8A 1ZK1A 4MUIA 3IMKA 3V7UA 4EG7A 4PF1A 2XQFA 1U0RA 4QZVA 1QYXA 3BAZA 2PQ6A 4D8VA 2BN4A 2Z2JA 5D5PA 4GWKA 1M33A 2PKWA 2JK1A 1XP8A 2B20A 3H9CA 5AM0A 1FXWA 3TTVA 1LPMA 2P0YA 4ND1A 4CKEB 2V58A 4NBWA 5JTUA 1V3VA 2HK9A 3LP6A 1EUCB 3NUQA 4I1SA 4MI9A 1FFBA 4ZP1A 3E58A 5KTSA 1NC1A 4EKIA 5IU6A 3FVTA 1XVTA 1J90A 1FSSA 1DQNA 2X42A 3GCXA 4MRVA 4UZEA 1C8KA 5EIXA 4RELA 1I36A 3MN1A 1YD7A 4QGFA 1VP3A 3CZ5A 2CL6X 2Z2ZA 1QHXA 2CLDX 1ZK2A 2HMTA 1W96A 3D8UA 2ZI5A 3MWEB 3P9ZA 3R3UA 1SY7A 3T9DA 3M2PA 1R3DA 2GD6A 3DVQX 1G41A 1MX5A 2IIBA 2PT6A 3LD9A 4LV6A 4YP1A 1GSOA 4Z3DA 5T41A 1ZM7A 3SYRA 2IIPA 3LRPA 4Z1MD 2NTJA 3CZRA 3PG5A 4HNRA 5GADl 4G07A 1CDOA 1RHRA 1U3VA 3R3ZA 3WWYA 2IYZA 5IAOA 2F3SA 2BTQA 4B31A 4E5VA 2F8SA 1TTTA 3H9JA 3U16A 3HH8A 1UT5A 2LE0A 3MINA 4PRKA 1PJRA 5FNZA 2X13A 3ZDQA 1FPMA 3ETLA 5G0VA 2ZIGA 5EP4A 4A8JA 3AR7A 4FYVA 3NBQA 2XOXA 2PUVA 3EQZA 4YMSA 4ZV4A 2V7TA 2QVCA 1D4AA 3EZYA 2E7ZA 4G5YA 3RYHA 4H59A 2Q6OA 2VC2B 3WFZA 2WSLA 1X87A 4TTSA 1XT6A 3H3JA 3H5AA 2WD8A 3PQ4A 4WXEA 1OC2A 1QIFA 2UUAB 2ASVA 1CP2A 2QV0A 4MS4A 4MRNA 3GRKA 4OXYA 3M2TA 4UUQA 1MO6A 1V2HE 4BUZA 5CHYA 1JFTA 4DNQA 4LNHA 4JBLA 2JIOA 5FA6A 4XR9A 4H7IA 4B9EA 3EZ6A 3W5HA 3FHCB 3VO8A 5CVJA 4LJYA 4IYJA 3N5KA 4AO8A 5KOHB 3FFAA 3SHFA 3QVMA 4G4SP 3OOSA 4IFBA 5L51A 3L84A 4GG1A 4IDFA 4JVOA 3QA9A 4INZA 1DRWA 4KIGA 2BEWA 2BP7A 1VLMA 1WHTA 3KBBA 2GAFA 1R0SA 2VPIA 1LLCA 2YOFA 3IJEB 3PUYA 1XCBA 2P3OA 1L4GA 4IXWA 2V7UA 5CG2A 1OFGA 3IQFA 3ETEA 4BE7B 2JB9A 1KIAA 2OHGA 4HHEA 1IZ7A 9MHTA 5KKAA 5CBPA 1Q19A 1MP0A 5KNDH 3U80A 2GF2A 3ELDA 2R6HA 2YQZA 2QK4A 3H1GA 1R50A 5HIIA 1JE1A 1OAAA 1G5FA 2YHUA 3R3SA 2EIXA 4RU1A 3E3LA 1F3OA 2OD2A 2PS9A 5KDLA 1FP7A 2NSDA 8ADHA 3DT9A 4IVQA 1E7YA 4W8OA 5FI0B 5B3LA 4MGYR 2FFQA 2JCBA 2NAFA 2FDCA 2B37A 2PCJA 2XWQA 6ABPA 4H15A 2D00A 2XCUA 4HGNA 3UTDA 4YR7A 2AW3A 4JLMA 2VDWA 4G0OA 5DP2A 2I1WA 3EGDA 4HGPA 2HMYB 2XCLA 3IBGA 4G4GA 4K6KA 3NTXA 3BIOA 2CFCA 3IELA 1Q14A 3PNPA 4ON9A 4QFDA 3WYFA 1AA6A 4YDRA 3EC2A 1H6CA 1SH7A 4GSYA 4LGYA 1EVYA 4LXTA 5LZ7A 4LJ9A 4XSGA 1U90A 4R2XA 3LBYA 3G2HA 3WLTA 2DFNA 2O1EA 4C0LA 4KHPB 2CKMA 5BRJA 1EQAA 2PMFA 3UJ6A 4UNPA 1PR0A 1SIWA 2JL1A 1RYDA 1W0JA 2W2PA 4BCDA 5IXJA 1EDOA 4A0QA 3PDWA 2IKQA 4LDQA 1IPHA 3T3MB 4LZNA 1NMSA 4C0BA 2I78A 1TJNA 1SCDA 2YV3A 1FFDA 4X3CA 3WGOA 1RR6A 5BQ5A 2P9YA 1KJYA 2IU3A 2J3IA 2JJYA 2POQX 4KYIB 4AJ9A 4AS2A 3D31A 3CTPA 3MJCA 5KDDA 1DEKA 4R81A 5FADA 5I9MA 2F3RA 5E7JA 5I9SA 4QHSA 4ABYA 3FBTA 1NYRA 2FPXA 4GXQA 3A6PC 5FUVA 1J2YA 3KT3A 1G20A 4AUEA 1M34E 1TF5A 4M22A 3PPWA 1O54A 5BN1A 2XTZA 4BTEA 2ZUEA 4F71A 1KZ7B 4YAGA 3DE4X 1XAIA 1BEUB 3A1TA 2OXFA 4PO1A 5KYWA 1DKUA 2FFHA 5I7SA 1ABFA 3SQWA 1UWKA 3IEUA 1SB8A 4I6GA 5DYGA 1MQSA 1X13A 2Q2QA 3COWA 1ODFA 3AP3A 3HCAA 4IDNA 1T0BA 4JR2A 2A0XA 2GF9A 4LNUA 4PONA 3ZE1B 4A15A 2ZCJA 2VKTA 4EGQA 3TR6A 4V0MA 4EI2A 5TQ2A 3VSBA 1NYQA 1P81A 2H29A 3PNBA 3TEJA 1RAEA 2FPIB 4MRPA 2QJTA 4BNUA 3ROPA 5K3SA 1B26A 4Z9AA 3WMGA 3EVZA 1SHUX 4FFVA 4XX0A 1IEVA 3KCNA 5KNDD 3VI4B 1X7GA 4MX8A 3D02A 4U2KA 3EIXA 3RU7A 4AUMA 4PLVA 2ZQZA 5H3LA 4U7FA 3ZDZB 5CIYA 2O0LA 3VKGA 3Q2KA 1X80B 4KODA 3P8ZA 4LXXA 1JLLB 3SLRA 4OP3A 4KI7A 1GGEA 1S01A 5JAQA 2BBWA 4XWKA 4TGLA 4TKVB 3ZBQA 1VE1A 2GN2A 1TO6A 4IGKA 4UFOA 3V4LA 2IWRA 3V8VA 1SN7A 4GI3A 1JH9A 1K06A 3H5VA 1QZXA 5IVPA 2VUHB 4DMLA 2Y4OA 1QIHA 4P4LA 4PS0A 3CRW1 3TLMA 3I1FA 4I1VA 4CRWB 4D96A 5EUCA 4FHFA 1WD7A 4JJKA 3ZEIA 1C4OA 2CMGA 2C29D 2I9KA 1Y48E 2PCLA 4BWFB 1M7GA 4BQOA 2G76A 1MZPA 2RHBA 3FLMA 2GEVA 2WSSA 1X7DA 4X3OA 5DHUA 2DPGA 1X8LA 2O8DA 2ODQA 1QE3A 1JG6A 2QXYA 2HXSA 2XQGA 3EZGA 3F5MA 1P45A 1UP4A 1M1YA 1WAMA 4NFYA 4Y6GB 2PK3A 5B3JC 3DEZA 1CUZA 4G8BA 1EA7A 3M6IA 4GQAA 1JL3A 4IDBA 2OXTA 3RSLA 3UIEA 3W6OA 2P2GA 1B0AA 3KD2A 5C3MA 3AHDA 4Q7JB 2F1IA 1OVMA 3K5HA 1GNSA 3KOYA 3JQFC 5LZ8A 2I99A 2BFAA 3ECCA 3FWNA 1IM2A 3DBIA 3GEMA 5JVDA 3HB7A 2G77B 1J99A 3IESA 4H0CA 4DIMA 2YMLA 4F1WA 3DMHA 4Y1RA 4J8PA 3ZE7A 3FTFA 3K8YA 4RVNA 3TLJA 2G0NA 4W5JA 1ZRNA 3BJIC 4DBVO 5ADUS 5JNRA 3R7BA 2IL1A 2XTMA 3AM4A 4LDAA 3FHLA 1TQDA 2E4ZA 2XB9A 4ZO9A 5T3UA 2GETA 1UWCA 3TS1A 3TGLA 1ZU5A 5F9FA 2E82A 2ZTSA 2QJOA 3WK4A 2WYIA 4G6ZA 4RHTA 4WZAE 3UJAA 3C7CB 2HDWA 3WL3A 2ZJ1A 5AI0A 4ISBA 3HDHA 5G1NA 1GV1A 1Q74A 1Y4AE 4GC5A 1DWUA 3L93A 3AHEA 3A2NA 4IEFB 1KY3A 3WNQA 5F7OA 1PFQA 4N3NA 5FAXA 4J2HA 4MVJF 3UGTA 1SELA 3L2OB 4LBVA 1K6IA 5FI3A 7YASA 4G1BA 2XB6A 4EY5A 4MW5A 2W8ZA 4I55A 2RAUA 2OPBA 5CJJA 3K6KA 3QJYA 4BEBA 2H85A 4X3PA 1AF7A 2WVJA 1C4WA 4WBNA 5JG7A 1FDIA 2WNHA 4FFSA 2AYYA 1OGJA 1RM0A 3OI7A 3UT5B 2XCSB 5JS1A 1P4GA 3HYNA 3ZGXA 1JFFB 4BPBA 2Z09A 4EY3A 3EGEA 5D3KA 1VSVA 4DUYB 1J06A 2IUUA 1SXHA 3DMGA 2OENG 3O82A 3REOA 4L0DA 1KFKB 5LQNA 4OATA 4NFLA 5SZJA 2CMHA 4Q3LA 3E9YA 4TZTA 3D7SA 3INNA 3NVMB 1U1IA 3SC2A 1ISSA 2HK7A 1SD1A 4HS9A 3UW1A 3VPFA 1S2MA 1I7LA 1WV0A 4GX5A 2KHZA 1UMDB 1V5GA 3DE0X 3SDSA 1JQKA 5KYNA 4C20A 2IOFA 4GOKA 1JA9A 1W85B 3GUCA 2XGOA 3TEFA 4Y0VA 3E84A 4LQLA 4MUFA 4ZAGA 3U17A 3UT6A 4XD2A 4F6LA 4NAVA 1IK6A 1JKJA 4XFKA 1GCGA 5LZ9A 5JQWA 5EHNA 2YWEA 5KHOC 4RM3A 3VGJA 2WG2A 1X1BA 4KXMA 1BU8A 1XDWA 4BVKA 4QTXA 2AFIB 2UVQA 4FCCA 1XTRA 3GIDA 4X7BA 5JDIC 1B3RA 3EGDB 4FHDA 4XB6B 1E1RA 1ZI8A 2X8AA 3QXGA 3L7AA 1YT5A 3KU1A 1RZRA 4F5YA 3GZNB 5E3JA 4E5DA 5EJ4A 4PYMA 4PC3A 1MZVA 3NG1A 4DYDA 2WWWA 2DWQA 1E1MA 3N0WA 4M0UA 4LRQA 1VYVA 2IS1A 2O4CA 1HMYA 1NP6A 4ZZ1A 5IFLA 1N3IA 5HM6A 2OTCA 4NZ9A 5CT5A 2EG9A 4IZIA 3QOYA 4UEQA 1YB1A 3FTPA 1RI3A 3MWEA 5FR1A 1XZHA 5TT0A 3WGMA 2YVAA 1NI5A 4Q48A 4RMIA 4I6EA 4RGVA 3TZBA 2C2YA 1JDJA 1ULAA 1D9XA 2HWWA 3L8MA 4MVJD 2OCAA 1Z5WA 5E2BA 5EWLA 5IF3A 1YL6A 4IY1A 4EDHA 4E1VA 1KI9A 1JAHA 2B34A 2EGGA 3G2JA 1JDPA 2Y6VA 2C07A 1L7MA 3AILA 3HBLA 2J59A 3P9SA 5J2UA 1Z3IX 5DGCA 4INAA 3OEYA 5EYPA 5H16A 5H80A 2HZ7A 2CLFB 4PRZA 3TXXA 1SK8A 3K53A 4HVCA 2CF5A 1SULA 2I2CA 4C1NA 4YMLA 3LCRA 4BXOB 1UBGA 4BS9A 3GI1A 3U6BA 4XKJA 4TMVA 1O89A 4ILKA 1LPNA 1HOTA 3DTNA 3TBFA 4ECEA 1X6VA 3CURA 1H2FA 1NXTA 1BE8A 2FCRA 2QX9A 3BB4A 4PCVA 4INJA 3MRTA 2F6RA 4QU9A 1YRHA 4U7GA 3P9QA 3L7KA 3MOSA 4BX8A 1DRJA 4FC6A 2X0DA 1KYZA 5FFFA 2IYRA 3BMCB 2B5WA 2P41A 3O3MB 3HB9A 3RLIA 3UMCA 1WNTA 3CF4G 3U37A 1Y82A 1DDIA 5E9QA 2ZU6A 4RPGA 1WZUA 2OCIA 1ZMBA 4K05A 2HC9A 1FQOA 4NC9A 2ZVDA 4TMZA 4DDUA 2N9UA 5HQ3A 1TD1A 4EABA 4UEWA 4O8ZA 5DGTA 1GNRA 1FSFA 1NM5C 3KB6A 4FZVA 1K4KA 4Z7OB 1PR5A 1XVUA 2O1XA 3H11A 3ILYA 2CZCA 4E0BA 1SCUA 3U9LA 1H2RS 1NZDA 5TSDA 1NVDA 4YJ3A 5IJ9B 3LYUA 4QYIA 1OLUA 3RVDA 3KQWA 1XF9A 2LR0A 3TSOA 1RXIA 1YS6A 1L4BA 3MLAA 4JJ4A 1SXJC 2ZUUA 3K4PA 4KJXA 4OHXA 5AVZA 1H42A 2UAGA 3FI0A 2VVTA 4Y1GA 4MYSA 5L6LB 1RXEA 3WWZA 1YBAA 3PIIA 2WAAA 4HWOA 2HDNB 4Q6WA 3VKFA 3HTXA 1ZONA 3B70A 2OV1A 3K0FB 3OJCA 1HNNA 2GEUA 2Z30A 4LV5B 3EA0A 3U7RA 1BD3A 4INOA 5CLJA 2P2ZA 3KKOA 3RJZA 2PM8A 2ZSAA 1H4TA 5BQXA 2CV2A 3T3GA 2VDWB 1QF9A 1L5WA 2BI7A 3FYHA 3R9XB 4YCLA 2BHSA 1QQTA 4ZOBA 2GBPA 3K30A 2XY4A 5DSXA 1XCMA 2G6TA 2FOXA 2PRSA 3B1ZA 1T3SA 1ZUIA 3OMXA 4KYVA 3TUJC 4DLKA 2QTCA 2I2WA 3TZCA 1ZQ9A 2ID9A 3WC4A 1G8MA 1QRSA 3ENQA 2CHQA 5T8KC 2QP4A 1PJLA 2IBSA 4XGIA 3MRSA 1F5SA 3IT2A 4BYGA 3QYJA 3KTFA 2PEZA 3R40A 4RNDB 2IY7A 2R85A 2CMFA 2W6ID 5HILA 3TI7A 3ZWQA 4UM9B 2PSDA 4KUHA 4CM1A 3EEBA 3GRPA 4O4LF 2IYEA 3PDCA 3AI7A 4TYYA 4PGHA 3P9KA 4QRDA 4F2GA 4F2WA 1ZUD1 3GUUA 3ZGVA 4AWXA 2XZPA 5BRAA 1CIPA 1KP9A 1AG9A 1Z88A 2HA6A 2WD9A 5L3ZA 5TMDA 3DLHA 3T9BA 1U94A 1XEXA 1TZKA 4D0LB 4BY9E 1N2CA 4QATA 2H9IA 1C7IA 2BGKA 4ME6A 4CLEA 2VPXA 3QA3E 2V8OA 5KTOA 5KOYA 2G28A 4MINA 2I66A 1G20B 1UBEA 2WU1A 4GVPA 4BFYA 4F5ZA 3L7DA 3HFGA 2P5UA 3S3TA 2C9MA 4KE9A 1XL0A 4PFQA 4M1QA 1ZQ1A 2PE5A 3WWPA 1OHHA 5IJ0A 2L2QA 5K8JB 2X9VA 1DJPA 2PY6A 1J20A 2H51A 5L8VA 4GXRA 1KOGA 5B58C 3CF6R 3X0DA 3LI2A 5EIFA 2SKDA 3ZHOA 4A10A 4CF7A 4NESA 2YCBA 3KUKA 5IJXA 2CN1A 1O6FA 1E5TA 2CLLB 3VU9A 4DTCA 4FDVA 4JOCA 2E1RA 1XXHE 3D2AA 1GYRA 1O96A 2YKGA 2VRNA 3MHPA 4RIIA 4JUIA 3V4FA 2MR5A 5GZ3A 5KJCA 4RDHA 1NQVA 3PR3A 3EZXA 3A6EA 4NP6A 2ISCA 2OB2A 2PANA 4TTRA 5TDHA 1QFMA 5JAPA 2ZSJA 3QBEA 1A98A 1DQSA 2CJYA 4Z0NA 1WL8A 2OFXA 5LVAA 1XDZA 1O6BA 4JJ7A 2ON6A 1CIVA 4AN1A 1C7QA 1G2PA 2H1HA 2PQMA 2ZYSA 4JEHA 1YTUA 3VYTB 3K0SA 1XZDA 1NVFA 2VPWA 3LOQA 4QBKA 2IHVA 2WFAA 2A9VA 1FDRA 5DB4A 1ZHHA 3H2SA 3SQMA 2FW8A 1GCAA 2GM3A 4NX2A 3OFKA 5GJCA 5T4BA 4RKFA 4QJIA 4KAXA 2QHXA 4ZQCB 2DR2A 1TA4A 1EM8B 3BORA 2Q6IA 3RJ9A 2PYIA 3BT7A 4E5PA 1YJCA 3B1YA 2YV1A 4HVLA 1JU4A 1ZMTA 4HWRA 1Q0RA 1GTSA 3HYTA 1QP8A 3OZSA 4WXPA 4JXXA 2OKGA 2A4KA 4MB6A 3JSAA 1T3ZA 2IHBA 1RM5A 3L06A 4B80A 2HRRA 5H8WA 5B36A 3I9FA 2GNPA 5FUBA 4JOBA 2SBTA 4YCAA 1GZHB 4XVUA 3CG4A 3H6HA 1BCSA 1VBNA 4TQUS 2AKEA 3FZNA 1SQSA 4D1YA 3AEUA 2FUNB 4MIOA 2ZIAA 2IZ5A 3IA2A 5TGDA 3RFFA 3A7EA 1YMUA 5AVKA 3CVJA 1U2TA 3NHYA 4CCWA 1GU7A 1LFAA 1NUUA 4J07A 5FWYB 3MD9A 2WWHA 4NYIQ 4D9GA 2XSZD 4TL8A 3FIJA 4QU8A 3RO7A 2WKWA 4QNMA 1Z5GA 1EFPB 2EP8A 1VFNA 3HU3A 1Q91A 2QRPA 2OB1A 4LPSA 1KNQA 3PDJA 2XV1A 4ZPJA 1ABBA 3KQHA 3IIKA 2D7DA 4LF5B 2KE5A 1VKHA 2A5YB 2PN1A 1MBZA 1N4DA 3BGIA 3CFYA 2J4FA 4HQOA 3F3SA 5D7NA 4R51A 3OIYA 3UJBA 5P8WA 1X0XA 2MINB 5LOVB 1F4PA 1XMJA 4CCAA 3OX1A 3F6BX 5K99A 3EJWA 4JLJA 2GKSA 2FH5B 3QJGA 3CSSA 5EKUA 1BE6A 3KKPA 4ZQFA 4ZT2A 1G17A 3UPUA 4CETA 2OZPA 3I2FA 4RTOA 3F2IA 1ADBA 4Q1VA 3HYRA 4KFRA 1JHXA 3RRXA 1XQWA 3SZLA 1RLUA 5EWJB 1KPIA 2WINI 2HH9A 4EFNA 1QRUA 3C5CA 4JNCA 3EH2A 3DLAA 3M9XA 1TFRA 2D8MA 3DS8A 3U49A 4EY8A 3L9XA 4B76A 2HEGA 1E69A 3ZLVA 4QEZA 4HX2A 4P2GA 3CZQA 4ZT4A 5J9FA 1XDUA 2QUJA 3L7IA 4R3WA 1NF3A 3BICA 2KS6A 1Q3HA 4IIHA 2G80A 4LNAA 2O3UA 1FX0A 1D6SA 3OZRA 4N6OA 3PITA 4EGAA 4JJIA 1UMDA 5JANA 3P9XA 4AC9A 4AF8A 4ZOLF 3BH7A 1YA6A 4QOSA 1J49A 5KBYA 4A6DA 1JHAA 3T5TA 3MJVA 1RHQA 4IW3B 3CO5A 4UARA 3RSFA 3TR0A 4JFRA 2NPOA 5IC6A 1PVOA 1ZH4A 1P72A 4AUKA 5TE9A 1B6SA 1HDOA 3JZDA 2HV8A 4DV6B 1Y4ZA 5THQA 3GJYA 3W8FA 5G41A 3PKIA 3WRYC 5JT1A 2PLNA 4PZZA 4LPKA 1PUXA 3TW4A 3WKEA 1P5ZB 3MOIA 4GRDA 4IS2A 5HKBA 3T35A 1SVKA 1AX9A 1E64A 2C7VA 2AFIA 4M6WB 4O4JF 1N4AA 5L4SA 3P2IA 1KSJA 2XUKA 3GOHA 1NNUA 2OAQ1 1UAYA 3FDJA 2PJDA 3LX4A 1QC5B 4N8SA 4HUQA 3VHLB 5KTNA 3A10A 5HMMA 1X0VA 4UM8B 3U0BA 1VL2A 4E46A 4EG1A 1Q22A 1CF9A 4ZT5A 1RWNA 1R10A 2JATA 3CBGA 5DM60 3OBIA 2RC6A 3L0DA 4XAQA 2PPVA 4I1YA 4DDKA 2PRYA 2OVBA 4ZEVA 3K9GA 2O8CB 5AK0A 5I7UA 4M38A 4M8LA 4QBFA 1ZXBA 3ND9A 4UAVA 1HPLA 1T8PA 3DVLA 5COQA 4ZCRA 2FPGA 4GQIA 2Q1WA 3IT1A 5EJEA 4WRRA 1NHWA 5A7HA 2FR0A 1CP3A 3CKYA 3FD8A 1X7XB 5EKXA 4UBNA 3KIPA 4OX9Y 1MA0A 4N4AA 5LB2A 3VAZA 3JR3A 1H2YA 1EBFA 3LK6A 1QV9A 2CW5A 3EGIA 4Q4DA 2O5CA 4MB0A 5AIAA 4DABA 1GTG1 3OOJA 4YAEA 2IPXA 5ALZA 5BQOA 2EJBA 4ZC1A 2QTVB 2BCGY 2IE8A 4F3CA 3DL4A 5GJVC 3MZ0A 1OYWA 2Z95A 4QIHA 3WMFA 5L4NA 1HM5A 2AN3A 1C7FA 3JASA 1UDRA 3M1AA 3LU1A 1YBFA 4LOLA 3TL3A 2JHGA 2AS0A 2P2LA 3CRVA 3I9MA 4HXYA 1JI3A 4X1YA 3BHJA 5CXUA 4GOOD 4MQBA 5K8LA 3BILA 2ZFUA 1SG0A 5ADVA 5HKOA 1XJ5A 2AG0A 3DO6A 4JP8A 5K4GA 4D80A 2ZITA 4BNZA 4IBOA 3FYUC 1XD8A 4FJ0A 2Q9BA 4QVIA 1ODSA 5JSZB 4DVGA 5MGBA 2REBA 2WD7A 2PD4A 2W6JA 3H0CA 5MGNA 4J49A 3BQNB 4OQXA 1U0SY 2UUPA 5CNMA 3WGYA 2OE2A 4DCJA 3NFYA 4EEXA 3Q12A 1ZN9A 1NKSA 3NP7A 1LTHR 3QEMB 4EL5A 2C3MA 1B1CA 4YUWA 1R6TA 1H2AS 3VU9B 4BCCA 4U00A 2ZSHA 1G18A 4QDKA 5GGYA 5AK5A 2O52A 1JEDA 1N5LA 2ZRPA 4J0FA 1YBHA 1ZA1A 2UZIR 1HYEA 1O95D 3N39C 3NOOA 2D5LA 2QTHA 4OQQA 4EUFA 1UZNA 2QX4A 2Y9PB 1GAEO 1O08A 5H9VA 5ICFA 3C7TA 1P2BA 2YYZA 3RUFA 4NSNA 4DUGA 5HGXA 1X92A 5DX0A 1KDTA 3Q8MA 1QMPA 3E2MA 3QNMA 4DLUA 3AUXA 3UJ9A 7MHTA 2QE6A 4LMRA 4DLRA 1X9IA 2PUJA 4HNAA 3ZK7A 1PBNA 3ER8A 3D6TB 3JYOA 5AQEA 1SXGA 2QY9A 2YZ2A 3R6WA 4J75A 1E3TA 3RIGA 3Q6NA 1IM5A 1EPUA 4RAOA 2X1LA 1VLJA 4MYDA 3CLUD 4JJGA 5FYQA 2GUWA 5GQSA 4R2WA 4WHMA 1TA0A 2GSWA 3CG0A 2JFPA 3HU2A 4YBZA 3L77A 4G24A 2B2CA 1C1XA 4Q3OA 5DHAA 3QENA 3C3PA 4WAUA 1BWSA 5BPHA 3G0DA 4AM8A 1ATIA 1OLXA 2J3EA 2Q3FA 3UB3A 3PXUA 2G04A 2PUDA 3ZJYA 4WCVA 4HO1X 2AK3A 3KPWA 1CUGA 1IRIA 3MFYA 3G7UA 4U7WA 5BNIA 3OTQA 1JLHA 2IIQA 1B4DA 4KGVA 4L57A 4RFLA 1GZ3A 3NHRA 1YQDA 4G5XA 4NU0A 3RD5A 4IQGA 3T4XA 3E82A 1LJLA 1H0RA 1T1IA 3QEKA 2B8TA 4TZ0A 4Y6PA 3M6UA 2IHKA 4F1KA 1ZJJA 3EGCA 2Y92A 2NZUG 3TZEA 1M0SA 2BEVA 4UE3S 2YJNA 1UBLS 4GPTA 1T26A 2P9GA 3MS4A 4Z0PA 2F3TA 3Q9UA 2M6LA 4KXLA 2C04A 2BMAA 3JWJA 5JWRA 2O7SA 3AIMA 1USWA 4GI7A 1IAQA 2VTDA 2PNJA 1W8IA 4LZAA 4F91B 2OFWA 1Q1AA 2JAXA 4PICA 1MW8X 1I7SB 4KXNA 2HU5A 2X0JA 5DNAA 1JAIA 1Z6YA 4H35A 1WPXA 3GC6A 1FXSA 1QWSA 3D4OA 3ESZA 2D62A 4MWSA 6YASA 3ABIA 3EWSA 3L49A 3TPFA 1J42A 2MSDB 3HJCA 4GC9A 4RVCA 2TYSB 1E6UA 4JXKA 4EX6A 3I83A 4IWXA 4CUJA 4B5KA 1ESEA 4ENUA 2G8LA 5BSHA 2GEDA 4X20B 5LU8A 2GHQA 2LGJA 4D26A 4UVGA 4FW8A 4RLQA 3DCJA 1BGXT 3EXIB 5HUJA 2W2LA 2WQZA 3LUHA 5F51A 3GUYA 3UAYA 2OPHA 2CVFA 1ZH0A 2QVXX 3NZEA 5FOXA 4BNGA 3TTXA 3G2IA 3A8TA 3IJ5A 3ROGA 3W3AD 2VP9A 3L5OA 4I4TB 3SP1A 1NDQA 2IYQA 1FUIA 5B64A 2V1UA 1IEWA 5BSGA 5JZSA 3IKLA 4KWEA 3SFVA 5EAIA 1H5UA 1P18A 2R1UA 1Y42X 4PM4A 2AA3A 1W8DA 3SYTA 5E6SA 1TUIA 3DBRA 3O74A 3B3QA 3V1KA 2P1RA 5C5DA 4B3RB 1UOQA 4UKDA 4Y2HA 4BASA 1BX1A 4PR3A 4QG7A 5K0ZA 5DNCA 4U3JB 1D2AA 4Z8XA 2JAWA 3DT6A 2CNNA 1E2KA 2IOYA 5JALA 4RZIA 1T5DX 1GDHA 3E1SA 1QZZA 3EZFA 2HR1A 2YY5A 4RFSA 1EVJA 2AN9A 2H4HA 4DC0A 4EFKA 1KVQA 4ENRA 1ZLYA 3DHYA 1W9HA 2R0QC 2FJPA 1FYEA 4M88A 3DCIA 3OIFA 3K94A 4XTCS 2QRVB 4U8HA 3AEKB 4FMBB 3EASA 2CVHA 4GPD1 5JBNA 4NOKA 3OP1A 2HGZA 4JDUA 4B3FX 1THMA 3T3OA 2GA8A 1IG3A 5AKIA 3ZEAA 1N5OX 1ZSNA 1IPEA 2EP7A 1NNSA 4IX9A 4BV3A 2IBTA 1VPLA 3CSDA 3G59A 4N65A 4DQKA 4B32A 3EIEA 2A9OA 3ELYA 3N0XA 1QC5A 2QG6A 3R7WA 1UQUA 3DEJA 2P9BA 3VR0A 5A4JA 2ZAOA 5F73A 5BN3A 4P53A 1XKLA 4RJLA 1J8YF 3N9IA 4ZTZB 4NJOA 2BGUA 1DL5A 3F78A 1R4NB 4TT3D 1IK4A 4XOIA 3VZRA 2XKKA 4EA6A 4ZO7A 1SK9A 1OAKA 2TECE 3G68A 4NZOA 2OHJA 2J5QA 4AO7A 1KS2A 5HUQA 3ZZUA 2IRWA 3ET4A 2WIGA 4TMTA 3R74A 4DNXA 4IV8A 5KOJB 1CQWA 5D00A 3TLEA 4YMHA 3C8HA 4JCCA 4M0PA 4WY8A 5B6PA 2B9EA 3AK4A 2L42A 3CC8A 4FCWA 3E2IA 3BXPA 1DGQA 5DBOA 3UYLA 2OZEA 4XQ0A 3PC8C 1FFXB 2OYRA 1RWVA 1NQTA 2BZ1A 4DWWA 1USIA 4ZDJA 2QTVA 1CR4A 3AT1A 3B38A 1XDBA 3CB4A 3PDIA 4EHAA 2I6FA 3FVVA 2NUAB 3D5QA 1KDZA 3L04A 1CVRA 4CDMA 4LX0A 2JGEA 3JQ9A 1HLPA 1YWGO 2C94A 2PUTA 4GMGA 4XZ3A 4YCMA 2QUBA 4GGMX 4J3FA 4ZCMA 1ZGZA 1SUDA 2AOTB 3TIGA 2YUIA 1XVAA 3CEHA 5BWNA 3U4QB 2OGUA 1FDWA 1FDVA 2IYNA 2DT5A 3JD1A 4L0CA 1VOTA 4NMXB 3SS8A 1XMPA 1DELA 2NT4A 5DX8A 3RS5A 5JEDA 1KDOA 3H2KA 5TY0A 2O7QA 4CM4A 1H0HA 3L46A 3FDXA 1UEJA 2A3RA 3A58B 4FIDA 3C3DA 1ZL2A 5AW4A 2KI5A 1I13A 1YVEI 5FCDA 1XDDA 3N2KB 3GJ6A 1B6TA 1JNYA 2QIOA 2E5FA 2V7VA 2QTMA 4FS3A 2R751 4GBJA 2HIMA 2W58A 2CUKA 3KSAC 1GSAA 2BHTA 2C2WA 2GZ3A 4HNUA 4X00A 3FTEA 2Q6TA 2BM0A 1BE0A 2ZI6A 4LZOA 4KWIA 2PMWB 1SR8A 3RR2A 2V7XA 4XD7A 2GKOA 2BISA 2I6XA 4GBED 4L4YA 3GFRA 3IUQA 5CVCA 3ZGYA 1T3LA 3AZOA 2ODNA 2JJMA 3OY7A 4YP7A 1Y7TA 3ETNA 3I9OA 2G0AA 3F3YA 3WGZA 1U2QA 2JLYA 4FB5A 2NTEA 1V95A 4W4TA 3ZWBA 3EOZA 3IRUA 4FWIB 1C9DB 1EX9A 1VKNA 1B2RA 3GUZA 1CF2O 1M76A 2EKDA 3EXEA 3NATA 1UXKA 3B13B 3MRVA 4LJKA 4DLVA 5ITVA 2QBYA 4LJ5A 3I8XA 2ZT7A 2G5CA 5FUQA 1KBZA 4ED9A 1FMCA 1GR0A 2FW1A 2XT6A 3KAKA 2VIIA 3PENA 4HRYA 4DHEA 1G59A 1GT91 3EPKA 4WUVA 1I3OA 3HCEA 2ZAIA 1D7OA 4DMRA 1TVCA 2PGNA 3JYQA 3FKJA 2W6CX 4G5FA 5FO1A 2FRDC 4PX5A 5B7GA 1JPVA 2DBRA 2ACKA 3PQ8A 3S6JA 1Z13A 4OHWA 2WWYA 4C3ZA 2VJMB 4GKVA 1QP0A 1AHHA 1A7AA 1QS0A 2RK6A 3SHQA 4CF6A 5C9ZA 5IXSA 2Q2OA 2YFQA 1LSUA 4XIJA 3RSSA 5DW3A 2GERA 3L07A 1L8QA 2PLFA 3O3OB 3O84A 3WNDA 3WHKA 4E51A 5EIWA 4ZMBA 2ORWA 2FDXA 4GRAA 4YCNA 2GBFA 3DTVA 4LHWA 1EK2A 2WT8A 4HRAA 2JKVA 2XZLA 4TOIA 4CUZA 3AOGA 1AF4A 5DHPA 1BYIA 5CBKA 3ADCA 1ZUHA 5HVNA 4ZREA 3UFXA 3DP9A 4ID3A 2RJOA 1ZGBA 4CEIB 3FMVA 1X7ZA 1K5PA 1CIJA 1S96A 2OV6A 2R79A 3O2JA 4RXUA 5D86A 2HEIA 3JAMA 1DI0A 1HE3A 3JD2A 9LDTA 4HKTA 3AONB 1OOEA 5IULC 4G85A 4EDFA 1MVNA 3N8GA 3AESA 2JBHA 3DAFA 4DGSA 2PFGA 1WZNA 1EI9A 1XB2A 1TVKA 3ZHXA 2WHXA 5ICMA 3QTBA 3I37X 5F77A 1QJ4A 1QSGA 3PKZA 4YLEA 4KLZA 4Y9UA 5JYEA 1QK3A 1GD1O 3IEMA 1KO1A 1LK5A 2XMBA 4IDEA 1M3SA 3ILHA 3VU0A 3WHLA 4ZALA 3WNCA 4H1WA 4R68A 2IEAA 5E4TA 4RX1A 5DYTA 4KDCA 4W5NA 4OHCA 1D1SA 1CS0B 1GQOA 1WMFA 3AJ9A 4JLUA 5D51S 1XPUA 1RKXA 4QPPA 2GKGA 1QG6A 1AN9A 1C14A 2XH8A 5C81A 2IPOA 3I04M 4O2AA 1WZEA 1H9BA 2F4VB 3TNFA 3RRBA 4Z3KA 3IP9A 3MEQA 1H1LB 4HVAA 5KQMA 3HU1A 4K9RA 2HLDD 3EIFA 4AJOA 2EIHA 1L7VC 2PRIA 5F9HA 4M36A 3FPGA 5CYFA 4II7A 2BZGA 2DFDA 4ZEXA 1ZICA 4LYEA 2KJQA 2RFLA 2JF0A 4JYBA 1G8PA 2HPZA 2GVZC 3PQ6A 5D87A 3SHTA 3UMBA 1XP5A 1M2HA 1YZGA 1XFAA 3HYSA 4QGAA 3JQBC 2FEOA 1N6LA 2VP0A 1WIWA 3LOUA 3F7NA 4LXHA 1E0JA 1SVUA 2D4AA 1Y4SA 4MKXA 4HYEA 1WY7A 1D4ZA 2AWOA 4UEKA 2J9FB 5FQOA 2ODWA 4BGEA 3G9XA 3ZUPA 4MEBA 4KFCA 3OG9A 1PZMA 1IN4A 5IT0A 3DQZA 3SZ3A 2D54A 1MC1A 2O4UX 3R24A 3TE7A 4EO9A 3A9SA 4D8XA 2ENUA 1ZCFA 4BO3A 1A9SA 3EEFA 1UM9B 1GPH1 1XD2A 3PNKA 4OEHA 5J1SB 1ZD9A 1QYCA 2FUG1 3EZLA 3IVAA 3PT9A 4L7QA 4M53A 1GUAA 3ZBTA 1JBQA 5EEGA 5HIKA 1DXOA 2BKVA 4DRXA 4KV7A 3D4LA 3DO5A 2WILA 1YIDA 1PHPA 1XLUA 2R68A 1TYCA 1TJ5A 3WGNA 1J0EA 4P1ZA 1NQWA 2ZJZA 2HCJB 2RBGA 3OESA 4HCJA 4HXFB 4G09A 4MQUA 4JI5B 3OT5A 4I5IA 2ODEA 4I50A 4R9UC 4DCCA 3BFJA 4JNKA 1ZMXA 4IIJB 3ORHA 2X4LA 3PRJA 2P5YA 1THZA 4RIGA 2A0UA 1LJUA 2C5FA 3GCZA 3UXYA 4LCBA 1YE3A 2R1VA 4LGMA 3GJTA 5GIOE 4GAEA 5EZ5A 2IHNA 1KRHA 3ICQB 3MWDB 3U13A 5HM8A 2GJ8A 3M33A 5E1DA 3D6FA 2YZNA 4PWZA 5F12A 3SJ7A 2VYCA 2DWOA 4BB5A 5HKAA 3OZTA 2GILA 1DEHA 5T5QA 4IUCS 5IVDA 4AZ3B 5KI6A 3I0NA 2C42A 1VECA 5CNKA 1DC4A 3OM9A 4M87A 2EQAA 4L22A 3U44B 2BSQA 4JEMA 1M6VB 4RTRA 2X8LA 3H84A 4BWYA 3RU9A 1RRVA 1JKFA 3NBYC 4FGSA 1QHGA 2H4YA 3NORA 1NVGA 4OHBA 5HOEA 4WUTA 2OLJA 5DH9A 3OPQA 2MT9A 3AY6A 3T99A 1VPVA 5IABA 3O8LA 1P4JA 4N18A 1O03A 1W2WB 1WCYA 2HFJA 3WO0A 5KNBD 1RIFA 1LF5A 5HJ2A 3I12A 5THKA 5H4HA 5BP7A 1IU9A 2VUIB 3OU6A 4PO8A 3K31A 5K0LA 2GESA 2ZRAA 1Z2AA 2NV0A 1QGED 4HWKA 4X6XA 3VMMA 3WJ7A 4B84A 4HF7A 1DP4A 2IYLD 5DEOA 2EVWX 4R6XA 3SEFA 1HF3A 2VYVD 2HXYA 4H7EA 2ZB8A 3I32A 3UHPA 3VDXA 5ALPA 5HPYB 3RAGA 1NPYA 1GITA 1Z8NA 3BOSA 1O8BA 4UCWA 1LTKA 2G1UA 3PQ5A 3EA4A 4HK4A 4IKEA 4GFDA 1CUSA 1Z47A 4Q4HB 4Y67A 1X14A 3QW4B 5AKHA 3MMNA 3WIBA 4GECA 5CFPA 4C08A 1GRRA 4OKNA 1SUBA 3F5QA 3H99A 3LT5A 1PUIA 4UCQA 3ERCA 1MB9A 4IZ6A 3N75A 3HB4X 1YAJA 1ZVJA 1JJBA 1NVVQ 1ATZA 1HQYE 1TZCA 2NUPB 2XOKA 3ND8A 4JC4A 4ZA2A 5EPEA 4BJ1A 4EQ6B 5BURA 4OXIA 4BZZA 1JKMA 4BWGA 5BT9A 2DLCX 4OHMA 4L1KA 1C1HA 1XWIA 1DKOA 4Q4JB 1WQ4A 3MMPA 3O31A 4KUEA 1U3DA 7ABPA 3V2UA 1FP6A 4CEJB 3KOMA 2A1TR 2X4GA 3KPUA 2NSJA 2VYNA 3FKSD 3FF4A 1CJTC 5IWAB 1KBOA 2AQHA 1USUA 4PCUA 4CKYA 1TPZA 4K28A 3CW2A 1U8FO 4RKRA 4K0RA 4LZWA 4AKTA 3EVNA 4OFWA 2HJGA 4BWVA 4Q9DA 4D9MA 5LMUB 4X6LA 4HNHA 5FOUA 5DISB 2VATA 4CMIA 1AGNA 4I9FA 1Y4UA 3HLYA 3PICA 3RWOA 5JFGA 2GFHA 5AVTA 5THXA 1Y9ZA 4Q0MA 1QH9A 4CIBA 3MWKA 4MV8A 1EB8A 3OZBA 1UXJA 3M70A 2VBIA 3BMOA 2JFFA 5KAPA 3D0OA 3KR0A 1QS0B 2YC4C 3GVHA 3VSDA 4E4RA 2PH7A 1KEZA 1KARA 1OPRA 3E7PA 4XQ9A 5HA5A 1KRXA 2XVYA 4BNFA 3ECAA 1P5FA 3A4YA 1I4WA 3EXHC 2CNKA 3HDJA 1NBOA 4OSOA 3BKXA 3CXRA 2R00C 3FUXA 3MVEA 4DW8A 4ESVA 4KO1S 5G40A 3UA4A 2Y8EA 2H48A 2BMEA 2J6CA 4KP7A 1T5LA 3ABZA 3W78A 1Z9BA 3PQFA 3CX6A 3DVSX 2E4VA 1ZR4A 2HWXA 3CX4A 2AFRA 3IULA 3GBVA 1HI9A 3GLRA 3K6JA 4P2BA 1I3KA 3WRWA 4GE3A 4A16A 4Z7NB 1W0KA 1KQGA 2P7IA 3GWGA 2H5EA 1I6WA 2XDQB 3DLPX 3IQIX 4OHUA 1O58A 3EVGA 5TQ0A 3NJRA 4AMZA 2BLNA 3U62A 3SMVA 1D04A 1AZLA 1GPUA 2SKCA 1FMJA 1LSJA 3EVCA 4V3CA 2H3EA 3B82A 4PPYA 2V9CA 2XMCA 1F12A 1E7RA 4XGRA 3T7TA 5HR5A 3CU5A 4WESA 4BPRA 1RVDA 1Z6GA 2JCYA 3U4IA 3E7DA 2QUZA 4XQGA 3W8NA 3EGOA 1UEXC 4C6TA 5CEJA 5DNDA 2OHOA 4TYNA 1T2FA 1JXMA 3DZIA 1YR2A 4P4NA 3F73A 3NWBA 2G6BA 5I9NA 2QTAA 4FNGA 1UPUA 4M9QA 3I5XA 1CS0A 1NBMD 4R1PA 1JLSA 2WRZA 2D7CA 3OZCA 4UDOA 1SXIA 4DBLE 1FFAA 5CAEA 1GUZA 1V8DA 3NX4A 3ZWNA 4BNJA 1DXQA 5KDOA 1BDHA 2G1PA 5DBFA 4KPEC 2XVZA 3QU9A 4QOIA 1XYGA 1QQ7A 2JI8A 2B5OA 2EFDB 3CB2A 1OLSA 1QOQB 4L4UA 4R2JA 3FTQA 3SAJA 3ZV5A 2V0GA 3R77A 2XNJA 1VP9A 3DEFA 4ROTA 1Q2UA 1ZMRA 4RZQA 5BXYA 2MSKA 3BMXA 1WCXA 1S2DA 2DCMA 1DKLA 3AY0A 4YJ2F 5CVUA 3C8MA 4MS3A 1IAVA 1ZAKA 1BXGA 2ZIXA 4WPGA 3NLLA 4EHFA 1LW7A 1CNEA 1ISIA 1SKYE 3R7LA 3JQAD 3QKTA 2FN8A 2XUGA 3BFVA 4HQ6A 1QIIA 2AXNA 2FU5C 3D54D 3OZDA 1TEXA 4KR0A 5EXPA 3A6GA 5BVHB 5IASA 2DXIA 3UMMA 2REXB 4DQXA 5DULA 2R66A 3C5HA 3I5AA 3NALA 4M9CA 5KC8A 1X70A 3OICA 3O4RA 3PQ7A 1NAIA 4J76A 4ZQGA 3LY5A 4DDMA 2Q4BA 2AG1A 3JALA 4EQZA 4KVAA 4I50F 2QTWB 3NH6A 3N74A 4BEJA 4RMGA 3H4VA 3UA3A 1JG7A 3NDRA 4GOMD 3IXQA 3G8CA 4UUAA 2C1EA 1NYTA 1Q7RA 2X2OA 4PPNA 4H7DA 3IP6A 3RAEC 3UK6A 1NTRA 2EYQA 2JAUA 5TQJA 3OJOA 1OZ0A 2FN3A 1NURA 1G60A 5EY5B 5AO9A 4ZAZA 1MAHA 1L5HB 3KAQA 3NNNA 3SBEA 3V8MA 5JASA 1W59A 2LKCA 3BSSA 3N53A 1RAAA 1NJ8A 2ZS8A 1D2GA 4HMOA 4YA6A 3KVOA 4AMGA 2BDTA 2EKPA 1QKIA 2F3PA 4C14A 4DV5B 1KRWA 4K9NA 3C3WA 2BUAA 5CX1B 4G01B 5G02A 1FX1A 3LXMA 1IY0A 5I7EA 5A7GA 2ZM6B 5ARDA 5B4VA 1UXHA 4Y2TA 5JH7B 5H0IA 3TD9A 2H1IA 4DXAA 4KRXA 1FFEA 5A3QA 4RF2A 2FFJA 3EG9B 1Y7LA 1A9QA 1FSGA 1GNVA 2R47A 3M7IA 1X1AA 3N05A 3Q1LA 1FVHA 1ZSYA 4RM2A 4N48A 1CB0A 1SBHA 1UAGA 1VL1A 4KIWA 3S5UA 2OV4A 5JZMA 2E0IA 4Q1FA 2O0JA 2ATVA 1Z68A 4WOPA 3QE0A 1R37A 4QGHA 3SKYA 3Q9SA 3V2HA 1KMHB 3NV7A 4K5QA 1YZ3A 2PLAA 3PRHA 4NENB 1Q3TA 5A62A 1F8FA 1O5TA 2E21A 1CR2A 4IUDS 4YYEA 2PL3A 4HDNA 1A77A 1SWWA 2QPOA 3PCTA 2BFEA 2VDKB 1NW9B 1S8AA 4N0DA 1VE5A 3B6JA 3AXTA 2IP2A 3D81A 5ALTA 1G0OA 1PFKA 2C4NA 2N1BA 4YIKA 3H8VA 4MV0A 1BG6A 2XUZA 2WWXA 3PFKA 1YQQA 3KT0A 2WWGA 3AL2A 3QV1A 5ALHA 5ENDA 1DG9A 1EGAA 1P5RA 1RS0A 1AKUA 4L51A 3LDUA 5KIAA 1C3OB 4C0AC 5KO2A 4OHOA 2B4KA 1YJQA 3LFUA 4Q4LA 2JEOA 4DJ5X 3WV5A 5LN1A 4KXQA 4JQOA 1F5NA 1YBVA 4YJFA 1T29A 1RXSA 2V0NA 4YJ2A 2W2KB 1OA0A 2Y1XA 4HLUA 5K2OA 1DO2A 2R84A 4BDSA 2VG8A 4I9GA 2YJ6A 1TW3A 3QITA 4O2AB 4FZRA 3QGMA 1CQXA 5FPTA 5FULA 4E70A 4X62B 3MLEA 1FUUA 3PK0A 4P82A 4B4WA 4KR9A 2CHFA 1GNLA 3GO4A 3OCCA 2WFZA 5ALDA 3QPVA 4QTTB 4L15A 4FBGA 5CVVA 1EIZA 4DJEC 3H75A 4DXDA 5A9SA 2H2HA 3I9V6 1T4DA 3FPFA 3GFTA 3GOQA 1ZH2A 5AT1A 1OILA 2OGZA 3UKJA 5CFNA 5H1YA 1DAPA 4BLOA 3GFPA 4CL8A 1K0UA 5BNFA 1N2XA 4ZHQB 4IG9A 4O02B 4C7XA 1VLLA 4F7DA 1OYYA 1W4ZA 1WWKA 4LSZA 3IKVA 4NZZA 3L0YA 4I3FA 4QA9A 2X9LA 3K1ZA 1HE2A 1PL0A 2Z57A 1BVRA 3O8OA 1L1FA 2R8RA 2OZKA 5C32A 2XBMA 2PEYA 1CZKA 5EFZA 1PK8A 3F6RA 4TQGA 1SUFA 1P1FA 4GDFA 3UC5A 2DBZA 1E92A 4PAWA 3FTCA 1AGYA 1TE2A 5FOVA 2QU8A 4RCVA 5HIAA 3I6QA 4GICA 1QVAA 1UBCA 1RRKA 2CEKA 4PVDA 3EBLA 1XJQA 3NVAA 4OUKX 2WWIA 4TMKA 5G0SA 3FVWA 1AMNA 1F3LA 4RSRA 1E6EA 4V3BA 2MR6A 3C15C 5DTRA 5B1DA 4CHGA 1YFKA 4O2LA 3RVLA 3BCHA 1OU0A 3KE8A 1CS4C 1EINA 1QFYA 2RHDA 3T7IA 3RUPA 2D0PB 2Y66A 3AU9A 1TEVA 2BTQB 4OJYA 3HJGA 4B0PA 1IVNA 5DYIA 4KIUA 4QQKA 3JQGB 2CHGA 4BMNA 3F6CA 1NHGA 4RIHA 5CD1A 5AIBA 1GFWA 1QOZA 2B8WA 1V6CA 3DZBA 1NJ1A 1KYTA 1Q0PA 4CI9A 2QN3A 2EARA 4GM4A 4WBSA 5JS6A 1CZNA 3H17A 4MAFA 1NWCA 2X23A 2V55B 4QOJA 2M1XA 2H63A 4AY3A 4L6AA 5FRDA 3BUSA 1M67A 1M6VA 4MR8B 5DBHX 4OB6A 1ZOIA 2VA8A 1EFKA 1TKAA 4BUJA 4BKMA 3RKSA 1HYQA 1WUKS 2VYFA 3BAFA 4NV3A 3WDMA 3PRYA 3FG9A 3RJ5A 4ERNA 4GGOA 1GU1A 2YW2A 2OYCA 4B1FA 1LPPA 3H2BA 4P7FA 3UAZA 3ZS9A 2A0YA 2ZWIA 5ELXA 3V6LA 3F7MA 4YJHB 5KYYA 1X7YB 2HDOA 1T4CB 4FU0A 5M5BA 4PBRA 1QVZA 2EDAA 1VZ2A 1UKAA 2MOKA 1US8B 1QGUA 2E48A 2NU7A 5B30A 1DE0A 3BC1A 3DMPA 4QYWA 2R7KA 2A1IA 1GEEA 3KVVA 4CM7A 5C8YF 2PZEA 2XUAA 3LVQE 1DOHA 2D74A 4LI0A 4HEA1 3TTUA 3C97A 4G67A 1U9YA 4J03A 3E6AA 1T2AA 3RIMA 2HX1A 3O73A 2NV6A 2QG4A 2Z1MA 4D3FA 2P3QA 3DAGA 2QTNA 2I6QA 3G02A 3OQIA 1ZIDA 1Y5NA 3CXUA 1E61A 1KZ9A 1N7IA 3CIFA 3G0HA 1YULA 4H4EA 3LBAA 4C4YA 4P0QB 1N25A 1ZNQO 3HZOA 3V00A 1RI4A 5F76A 2FLVA 4JLAA 4R5MA 3EQ7A 5M29A 3UWDA 5EERA 3TW6A 3UAXA 1JQLB 2UZ1B 3DWIA 1FF9A 3RJTA 4BGVA 1U8EA 2REQB 4FLEA 2YVKA 1Z7YA 2QAJA 2ZSEA 1JS1X 3ZYCA 2QZ4A 1UMKA 3ANMA 1K4MA 2O6HA 4BNXA 3SJUA 3IAFA 1Z18A 3OQOA 4MQ4A 2ZUTA 3AERB 1ACMA 1GAWA 2DWUA 4LXIA 5BW5A 1S8FA 2ERYA 2H6EA 3WAKA 2EW8A 1E6WA 3L5KA 3LNCA 4NQRA 3CVXA 1J0AA 1YS2X 2ZYDA 2DRIA 3D1VA 4G1CA 3L8ZA 1E5XA 1UQRA 2KMLA 4M8KA 5CA1B 4UBLA 3H1BA 4I5GA 3Q0EA 4QUDA 2Q2WA 5LZ2A 4A6EA 3FOFC 1IUPA 1TK9A 4PNZA 5C46F 4KO2S 2Y1KA 2EX4A 3TFWA 1Z4LA 2X0IA 5CX1A 2WSSD 4MW7A 3WX0A 2JKYA 3K72B 5KAMA 1NMXA 1XR3A 4KR3A 3EEYA 4L7VA 3ESDA 1BMQA 2NZVG 1A88A 1QGZA 3RV4A 2XMPA 1SXQA 1U8ZA 1H22A 3QVWA 4Z4IA 3EG9A 4X94A 3VTZA 3WSVA 4MOWA 5FA8A 1U7HA 1MTZA 2JLCA 4ZGBA 2C84A 3T4EA 3UEOA 3A3OA 4URVR 1UOEA 1LPAB 4BN0A 3TLAA 3E8MA 3SEAA 4EZBA 2GRJA 3FHJA 2B92A 1PK9A 4UD2A 3QLUC 1TEHA 4CHTA 1T1JA 2DMRA 4CKBB 4PHHA 1RPAA 5EKSA 5KYWB 4GKJB 2P9JA 4CMBA 3EHEA 3ZNNA 3WZMA 1X1DA 3ZE0B 5KEIA 5KX5A 4XFJA 1CY8A 4AS3A 2PSJA 5I01A 5CJ2A 2XDQA 3JQDA 2XAAA 1PNRA 1GJRA 3AHIA 3F9RA 5LQDA 1TZMA 1QUFA 4RJ2A 5G3ZA 3G0BA 3EZNA 4ZVSA 3VMFA 3C3AA 3REQA 4J0JA 4XDHA 3DZGA 5EIOA 2CUTA 4C7BA 1UEIA 3KVRA 4CDRA 2WKQA 3TQCA 4UAUA 2DBYA 4H77A 4ZI7F 2WR8A 4M1WA 3W34A 1KJNA 2X0RA 3AV3A 2MYUA 3SPXA 1RPTA 1DX6A 3AM1A 4IXNA 3E48A 3EBOA 1MB4A 1Z8FA 2W2KA 2MSCB 3GAFA 2P11A 3EXFA 3IAAA 1RQPA 1GFZA 3L4BC 4J4BA 5FUXA 3ZOKA 4AD8A 4C03A 1K5GA 1Z6QA 5IBPA 2F43B 3A14A 3EWAA 3KX2A 1E9AA 2FUKA 3CUVA 5CCDA 2Q0QA 2V3VA 4Q3NA 2FSFA 5TS3A 3NKLA 4KC0A 5FLXA 1ZA2A 5A4MS 1JN0A 2UDPA 2QRGA 3VV2A 4CKCA 2ID4A 1Y8RA 3LLCA 3P52A