4HTFB

Crystal structure of s-adenosylmethionine-dependent methyltransferase from escherichia coli in complex with s-adenosylmethionine.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
255
structure length
247
Chain Sequence
MQDRNFDDIAEKFSRNIYGTTKGQLRQAILWQDLDRVLAEMGPQKLRVLDAGGGEGQTAIKMAERGHQVILCDLSAQMIDRAKQAAEAKGVSDNMQFIHCAAQDVASHLETPVDLILFHAVLEWVADPRSVLQTLWSVLRPGGVLSLMFYNAHGLLMHNMVAGNFDYVQAGMSPDYPRDPTQVYLWLEEAGWQIMGKTGVRVFHDYLREKHQQRDCYEALLELETRYCRQEPYITLGRYIHVTARKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine-dependent methyltransferase
publication title Crystal structure of S-adenosylmethionine-dependent methyltransferase from Escherichia coli in complex with S-adenosylmethionine.
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 88
structure length 247
sequence length 255
ec nomenclature
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4htfB00
2ZBPA 3FPJA 3O31A 3TFWA 1EAMA 4BLWA 2AOTB 3A7EA 4X1OA 3KPUA 1FJXA 1FP2A 3FUUA 3FUVA 3I9FA 1KXZA 1VP3A 1BKYA 5FADA 3KQWA 5GM2A 4PWYA 5K0CA 9MHTA 1VE3A 5DTMA 2GAFA 2I6GA 5HEKA 3HM2A 2FK8A 3EMBA 4DA4A 3KQQA 1M6EX 3EVZA 5EQJB 3UA3A 2YQZA 4PYKA 2G70A 4M36A 5GIOE 4DMGA 2P1DA 2PWPA 3GRZA 3K0BA 3NDIA 4AZVA 2GPYA 4FS8A 3KKZA 1KPHA 2H11A 1D2HA 1RJDA 2C7RA 3EVCA 4UOEA 3HVHA 4M37A 4PYQA 5CM2Z 4PYNA 3HVJA 3TKAA 5KQSA 2OBFA 4BLUA 3JWIA 1NV8A 1YB2A 4RTRA 2PJDA 2H1RA 3O4FA 1UIRA 2AOWA 3HCEA 3M33A 3LL7A 3BWYA 2P41A 1P91A 2OB2A 2YX1A 3AXSA 2WA1A 3CC8A 1O9HA 3CJRA 3EVBA 2AOUA 3KQTA 3GGDA 4O29A 3UWPA 5DX1A 3SMQA 3TKYA 4PYIA 4F86A 4GOND 4V0QA 2P40A 4RYLA 3FPEA 5DX0A 5T64A 3OU2A 3THSA 3T7TA 4HSGA 2YVLA 3CBGA 3OCJA 3HCDA 5DXAA 5E9QA 1M0EA 1RI4A 3PTAA 5CCXA 5EKUA 4RTPA 3C0KA 2HV9A 4FT2A 3MCZA 5HOQA 4C03A 5K0FA 2G8NA 4P7KA 5DM4A 4PINA 4PIMA 3FZGA 4KDRA 4DQ0A 2OY0A 1N2XA 2P7IA 2PVCA 3FRIA 2AOUB 5DPMA 3RW9A 5DM0A 1AQIA 1R18A 1TPYA 3G2OA 3K6RA 4DKJA 3R6TA 4AUKA 3TR6A 1NKVA 5M5BA 5DM1A 1P1BA 1V39A 3DOUA 3GO4A 3EVDA 4XCXA 5K0EA 1R00A 4F84A 2FRXA 3REOA 3UJAA 2ZBQA 5FUBA 3TLJA 3EEYA 4DM3A 3BGIA 4RTLA 1BC5A 5E1OA 4C05A 3DH0A 3IYLW 3V97A 5E8JA 4YV2A 4K6MA 3OZSA 1YUBA 3EVAA 4NECA 3LCVB 4HTFA 3I5UA 5FHRA 1G6Q1 1RJFA 4M38A 3EEOA 1I1NA 1VPTA 1NBHA 2GS9A 3EGEA 3OFJA 2IBSA 3T7RA 2ZZMA 3HCFA 3B3JA 5EKXA 2I7CA 5EPEA 4E33A 4X41A 2CKDA 3LHDA 2GA9A 1ORIA 4RTJA 2G1PA 5K0GA 2GH1A 3LDUA 2UYQA 1G60A 4QVGA 2YTZA 2ZW9A 5EZQA 2ESRA 1WS6A 3GRVA 5K03A 4QDKA 1XXLA 3FTFA 2ADMA 3DXZA 1D2GA 1DL5A 2BM8A 4QQNA 1XCJA 3FTDA 2OXTA 3T0IA 3UFBA 4A6DA 3CCFA 3SXJA 3TQSA 4RTNA 1ORHA 3GU3A 4R05A 2Z6UA 3LKDA 1QAQA 1PRYA 3HCBA 5DM2A 2ZBRA 1RI2A 2FHPA 2B3TA 3MCTA 3TM4A 1KR5A 3GCZA 2AOVA 3OZRA 2OYRA 2PT9A 2YXEA 2ZZKA 3DTNA 3JWGA 5CUQA 3LDGA 4AZWA 3BWCA 1R8YA 2FCAA 2QM3A 3I58A 3P9NA 5HIIA 3X0DA 1DCTA 3HTXA 3M6VA 5CCBA 1JTEA 3M6UA 5C9ZA 1XJ5A 5FCDA 4E32A 2VZ9A 3DLCA 4IKPA 4MQ4A 1RJGA 2ZIEA 2F8LA 1T43A 3SGLA 1NV9A 2NP6A 2B2CA 2NXNA 4P58A 4OQEA 3M4XA 1L3CA 4HRAA 5P8WA 3LBFA 1G8AA 4CXMA 5E2BA 4KIFA 1IY9A 3A7DA 5C1IA 3P9KA 1JG3A 2PGXA 3C3PA 2P8JA 2NYUA 1XVAA 2YUIA 2B25A 4IWNA 3HNRA 1F38A 1ZHFA 4KWCA 3RODA 4ER6A 5HZMA 1NW8A 2G71A 5H02A 2Y1XA 2PLWA 3PVCA 4RSRA 3NTVA 1R8XA 5K05A 3KPJA 3UJBA 1KHHA 2R6ZA 2E5WA 1JSXA 4CTKA 4X61A 4LECA 4OBXA 5G02A 5ICEA 3BZBA 1L9KA 3HA5A 1G38A 3R9XB 5GOZA 5C0OE 5F2NA 4MHTA 3NVMB 5DTQA 1WXWA 3G8BA 3MQ2A 4A6EA 3ELDA 3DR5A 2P3QA 2O06A 2P35A 3G8AA 3FUWA 3LECA 5K0NA 4X63A 5GM1A 5CVJA 2PXCA 1VIDA 3MTIA 4H0NA 3FPHA 4KW7A 4PYOA 5CVUA 4RX1A 4BP1A 2IFTA 1IXKA 4MIKA 2B9EA 1QYRA 1TW2A 3KQVA 4GF5A 4ATNA 3BT7A 3BWMA 3CVOA 3C3YA 1XCLA 3PX3A 1NT2A 3R24A 1YFJA 1FBNA 2PBFA 3OU7A 4U7TB 4ER3A 3THRA 1KPIA 3A4TA 2ZLBA 3A25A 3G2QA 4WXHA 4XUDA 1ZKDA 2OZVA 2AR0A 3CGGA 4OA5A 5D1HA 1IM8A 1VQ1A 3BGDA 3UJCA 4B17A 5FA8A 1AQJA 4HTFB 5T67A 5EEHA 2XYQA 2CWWA 1OR8A 1O9GA 2CL5A 3AJDA 1VP9A 3PFGA 3PFHA 3TMAA 1YZHA 3B7PA 3GIWA 4RTQA 4FT4A 3QOWA 5LQCA 3LGAA 1SQFA 2QY6A 2O57A 3D2LA 4GEKA 4L7VA 2AS0A 2HNKA 2BH2A 1NW7A 3E8SA 4LWPA 4M7RA 5DRTA 5BXYA 1F3LA 5U4XA 1WZNA 4GOLD 2C7QA 5BP7A 1D2CA 3VC2A 3SSMA 5HIKA 4BY9E 3NWEA 4QTUB 1EG2A 1NW5A 1L1EA 2UZ4A 1XDSA 1SVUA 4EQZA 2ZFUA 2OKCA 5EVJA 3DXXA 2VP3A 2EFJA 2N47A 3PB3A 2C7OA 1ZGJA 5K0BA 3G5TA 4E2WA 5GWXA 2AN4A 4HGYA 1WXXA 5ICFA 3P2EA 3NVKI 3MB5A 3DMGA 5F2KA 1KIAA 3ANXA 5GP1A 5CIYA 2XVAA 4QPNA 4DF3A 1N7JA 4FR0A 3B3GA 4Y2HA 5FTWA 4QVKA 3TPZA 1R6AA 2PT6A 1INLA 2KW5A 3ORHA 3SSNA 1WY7A 3MAGA 3DMHA 2B78A 1ZG3A 4IV8A 3ID6C 5EGSA 5DSXA 4EMSA 2AVDA 3ELYA 3NJRA 5FWDA 3MGGA 2IP2A 4RTKA 1X1CA 2NXEA 3FTEA 4FGZA 2EG5A 3LX6A 4RV9A 2OPBA 4LG1A 3ER8A 2EX4A 3FTCA 5CVEA 5FA5A 2H00A 3L8DA 3E23A 4IV0A 1ZGAA 3P2IA 4XUEA 3SVZA 1YZ3A 1G55A 2IDJA 4GOOD 4R6XA 2BR3A 3BUSA 5EOVA 1DUSA 2O0LA 1NW6A 1L3BA 4Y30A 3ELUA 3ME5A 4OQDA 4PCAA 10MHA 2VDUE 3KU1A 2WA2A 1MHTA 3IV6A 4YMGA 1XDUA 2R3SA 3GRRA 5E1DA 3QV2A 1X1DA 2HMYB 3ELWA 2PV0A 4DCGA 1N7IA 3MERA 5BW4A 2K4MA 1EJ6A 3C6MA 2QRVB 3CJTA 3HVIA 3MHTA 4PYLA 2IBTA 4OBWA 4YV0A 4YUXA 2IGTA 3BWBA 1KPGA 1KP9A 5E1BA 1EJ0A 1QAOA 3FYCA 1JR4A 1SUIA 3Q7EA 3HA7A 3OZTA 4EK9A 2ZULA 4GC5A 2Q41A 4P7GA 2VDVE 4FP9A 2VDWA 3V8VA 2WK1A 2P3OA 4U7PB 3E05A 3HCAA 3HEMA 4KVZA 1BOOA 3LDFA 1JQ3A 2Y1WA 5ERGB 2ZWVA 3SSOA 3GRUA 5CVVA 5GINE 3ERCA 3GJYA 1QANA 2NXCA 4ZTBA 4CTJA 4QPPA 3AY0A 3BXOA 2QRVA 3DULA 3KQPA 2CMHA 3AXTA 5CVDA 3FUTA 3FYDA 3OU6A 3G89A 3P9CA 4PGHA 3M70A 2YR0A 1RI1A 3P8ZA 2OO3A 4CKBA 1FPQA 3MTEA 2P7HA 3KHKA 2IH4A 1R74A 1NW3A 2UYCA 4FSDA 2XYVA 3CKKA 4P7FA 3LCCA 5BW5A 5F2OA 5JR3A 2FK7A 2V74B 1Q0TA 3G7UA 5FQOA 4YUZA 1SKMA 2XYRA 3EPPA 3UJ9A 2EJTA 3P97A 1QZZA 5EMMA 2AZTA 3SM3A 2YXLA 4GQBA 3BKXA 4CWAA 3T7SA 4Z2YA 4C07A 5LSAA 2BM9A 5B1SA 3KR9A 1JQDA 7MHTA 2V7EA 4PYMA 1U2ZA 3KQSA 1Q0SA 1SG9A 2FPOA 3G2PA 3KPVA 2ORED 2ERCA 3BGVA 5DX8A 5IH3A 3UJ7A 3GXOA 3B3FA 2UYOA 5K8VA 1H1DA 2JH8A 3EGVA 4RTOA 3KQYA 4FSXA 4EVIA 4PYJA 2C7PA 2YXDA 3KR0A 3LPMA 5K01A 2ZZNA 5FQNA 3ER9A 5LQNA 4HGZA 4PIPA 4ER7A 5LR6A 2ONYA 1QAMA 1P1CA 4XUCA 3R3HA 5IKMA 4V0RA 3HCCA 4QTTB 1NE2A 4OX9Y 4KIGA 3KPWA 5EMLA 2ZWAA 2AOTA 1BHJA 2P3LA 3OE4A 3UJ6A 5LQJA 3DP7A 5GIPE 1YF3A 4MWZA 2LD4A 4P7JA 1I4WA 1UWVA 3PT9A 4PCLA 3UZUA 3G88A 2IH5A 2JG3A 2AVNA 2Z6AA 2XBMA 5FHQA 2HR1A 2UYHA 5HILA 2JH9A 4HH4A 5MHTA 5EZSA 1TW3A 2I62A 4HG2A 3G5LA 4X60A 4GUAA 4RVFA 4AZTA 5D1NA 3KR1A 2AOXA 3R0QA 4E2ZA 5DXJA 3P2KA 2CMGA 1O54A 4CKCA 5KS2A 4G56A 4GOMD 4YUWA 3DLIA 5LQAA 3EVEA 5E9WA 2GB4A 1RJEA 3IHTA 4YV1A 1VLMA 3O7WA 3KPYA 1FP1D 3H2BA 4AZSA 2IPXA 3OPNA 3I53A 5EG5A 1ZQ9A 2O07A 3NWBA 3CJQA 3SR4A 5E2AA 4ER0A 2NNWB 3B5IA 5DSTA 4YMHA 2PX2A 4R8RA 1M6YA 1X19A 4JXJA 5KYGA 3EMDA 2ZTHA 4GC9A 1L3IA 5T6BA 5ICCA 2NP7A 3UJ8A 2PXXA 2VS1A 1MJFA 2HWKA 3QOXA 2ZIGA 2PWYA 3NW9A 2HTEA 4PGGA 4YUYA 4ER5A 2PX5A 3EGIA 3FUXA 3BKWA 4E30A 3Q87B 3GRYA 4KDCA 3KR2A 4POOA 5ICGA 5FWAA 1XTPA 1I9GA 3FRHA 3JWHA 2PKWA 3UBTA 3GWZA 3G2MA 3F4KA 1EIZA 5EHGA 3UJDA 1VBFA 3AWIA 3B89A 4OA8A 3TOSA 3EVFA 5HIMA 3S68A 3C6KA 5KVAA 2IIPA 5E9JA 3HP7A 3TRKA 2EJUA 2PXAA 1JSZA 4MTLA 3EVGA 5DT2A 3WSTA 4DCMA 4RTSA 1PJZA 2ONZA 1JTFA 3IEIA 1AV6A 2PX8A 1JG2A 4QDJA 5K0JA 3FPFA 5EIWA 4FZVA 2ZCJA 1NBIA 2JHPA 1JG4A 1SUSA 4C06A 5CD1A 2QYOA 3E7PA 5KQRA 5DRYA 5LQKA 1HNNA 4QQKA 5FULA 2QE6A 3A27A 4CKEA 1XDZA 4GBED 3HVKA 1Y8CA 2GLUA 3OE5A 3VYWA 3HA3A 2PY6A 3GNLA 2XVMA 3LCUA 4RVGA 5DTRA 3SX0A 3PLAE 5DWQA 2BR5A 4WVLA 4RVDA 3OFKA 4R8SA 4BP3A 1KYZA 4RTMA 3PX2A 4AX8A 2DULA 3P9IA 5JUWA 2FYTA 3LBYA 2IDKA 4F85A 2AN5A 5EMKA 4E2XA 1B42A 3P71T 2ZVJA 2AN3A 1G8SA 3PS9A 4PONA 4R6WA 4PNEA 5EIFA 2PX4A 1JG1A 3U81A 5LQRA 1RI5A 1RI3A 1Z3CA 2Z6QA 4KRGA 1P39A 2O05A 3RIEA 4EKGA 3KQMA 4E31A 2G72A 2BR4A 4YUVA 5E1MA 3TM5A 1HMYA 1X1AA 4RVHA 3DUWA 5E8RA 5EMJA 2PSSA 4HC4A 4BLVA 5EC8A 3LSTA 4LWOA 2I9KA 3NDJA 5HIJA 2ZIFA 3FPGA 3GDHA 5HFJA 5K0LA 3NMUF 2BZGA 3M6XA 2OB1A 4E2YA 2JHCA 4C04A 5EHIA 1VL5A 3JWJA 4RWZA 5DLYA 8MHTA 5LQUA 2JJQA 1KYWA 3KQOA 3VSEA 4C08A 1JQEA 3DMFA 3LKZA 2NXJA 3DXYA 4C4AA 3VC1A 2DPMA 2IH2A 3UA4A 2ZSUA 2JHAA 5EEGA 1SQGA 4EKIA 1YFLA 1EQAA 3A26A 1UFKA 4ISCA 3M6WA 1X1BA 4E70A 4DZRA 1WG8A 1AF7A 3I64A 2A14A 5K09A
chains in the Genus database with same CATH superfamily
1U7OA 3BG5A 3O31A 4ID3A 3SXPA 1KKMA 1WUIS 3G85A 4HQRA 2RGNC 3K0CC 1C7FA 1FP2A 1QYVA 1SY7A 3I8XA 3R44A 1GGKA 4DIFA 5LZ2A 2XZOA 2JGDB 2AFHA 4PEVA 1HFKA 3I2IA 2GAFA 1U5BA 4RC9A 4WJZA 4YAFA 5DTMA 3O3CA 1GSIA 1ZVJA 5TQJA 2WINI 1DZ3A 1G0OA 1GVHA 2QX9A 2X5OA 2YQZA 2YDYA 1F4PA 3PC6A 1EQUA 4UBMA 2P1DA 4Q21A 4JOQA 4F5ZA 5FTKA 2GPYA 3HR4A 4FS8A 1JDUA 5CPBA 5LYJA 1SKYE 3GJ0A 3WBJA 3Q8WA 4HS4A 3REQB 1AX9A 4A16A 5FOTA 5GAJA 3ZW7A 3OCVA 3FVQA 1PFQA 3TTVA 4B31A 4QZVA 2Q7DA 1UKYA 1NV8A 4YRGA 2QGNA 1KZ6A 2OV1A 4QM7A 2EL7A 3HRHA 5KU7A 3B48A 5HQTA 4BQSA 2REOA 2CVQA 3H0CA 5CT9A 2YX1A 3AXSA 5DCLA 1KJQA 3G02A 2MTBA 3OQVA 4PQEA 1H0RA 4B47A 1LVUA 1QUEA 2PRKA 4UBNA 4F2PA 3FHCB 3MXTA 5DHAA 2FMUA 1KFJB 4XQ9A 2XWJI 3EARA 3EFBA 3IBGA 2IITA 5BSFA 2UAGA 4RV4A 4R8LA 3H9QA 1YS1X 3N8HA 2CHGA 2RONA 3WGIA 1R0LA 4OGWA 5DK6A 4NDNE 2AUNA 2WKQA 3E5HA 3OCZA 4UUNA 1H0KA 4NENB 4O4HF 3U39A 5H8WA 1JAYA 4V0ME 3WFJA 4C89A 4F2GA 5TGTA 1MAAA 1Y3BE 1I2CA 2HU2A 3T52A 1YFLA 2CE7A 1P0FA 2P77A 3EPRA 1I1QB 4D7AA 1EB9A 5M5BA 4QGAA 2KM1A 4MS1A 1RR6A 2Y0EA 1LPNA 4WBNA 5JDCC 1SBHA 2FRXA 3L6CA 4G2NA 9ATCA 3OD5A 5J2UB 4JX8A 3SDBA 3KCNA 3BGIA 1RJWA 3M5DA 4RTLA 7AT1A 1LFAA 4PG6A 3UV3A 1T29A 4Z4CA 1ELOA 3TIFA 1A9OA 1TLLA 4M38A 4P3NA 1ZWLA 3KTFA 4C14A 4FZRA 3OLVA 1ZUIA 1A7KA 3CLUD 3KWLA 4OQMA 1JH9A 5H80A 1RWMA 4NI5A 4G5YA 4NYMQ 4J2OA 1C7QA 1T2VA 3LD9A 2L82A 1V5IA 2ENWA 2VHJA 1NIPA 3WWZA 4D43A 3EOZA 1RT9A 5BR1A 1F8UA 1M6VA 5IASA 3VKFA 3ECSA 2JLZA 2IXAA 1AE1A 4G9GA 3SHQA 1XXLA 1Y81A 2ADMA 3D4OA 1DL5A 3E82A 3GNTA 3LGXA 4O33A 4GSLA 4PFKA 5IBRA 3S5JA 3ZTTA 5AIBA 1HQCA 1OT5A 2H6EA 2QP3A 5JASA 2Z6UA 1JXAA 3W90A 2JF0A 1D6JA 1SKYB 4EQ6A 3K6KA 3PHGA 3PXAA 4F5YA 5BWMA 3C41J 3EWIA 2WIAA 1KR5A 2WZQA 3AM3A 4Q9DA 1PNTA 3E9MA 2CUNA 1JWBB 2NZXA 3HFJA 5ESDA 3E6AA 5K51A 3X44A 2XODA 3QW2A 4FMCF 2FPLA 4FXPA 3ZWWA 4KAJA 1A7UA 4G5XA 3NTUA 4S12A 3E4CA 2GD1O 4K6HA 3L1KA 4V1CA 1SGWA 1VSBA 2F3TA 3E7WA 2QM3A 3HV0A 3ICVA 4R0NA 5KSYA 5DYWA 1SIBE 1V9SA 2PSHA 4QTZA 3PP8A 4RHYA 1PWYE 2JL1A 1UINA 3G2KA 1C7ZA 1LLUA 2A33A 2VZ9A 2EDCA 4OJYA 5AOAA 4ZZ2A 4OAOA 3UJHA 1ZKMA 1WW2A 1W52X 3OLYA 5LZ8A 1HE1C 3SX4A 3JX9A 1PS9A 1G98A 2AT1A 5C35A 1IY9A 3A7DA 3MTAA 1CS0A 4L0MA 1A76A 3ZHZA 1GPJA 3GNQA 4FBGA 4DMMA 4R4JA 1PJRA 1C9MA 3FZYA 3OIDA 1S2NA 2RBEA 5DHSA 3PPVA 3QLUA 1TVKA 1W44A 4LXUA 3ZW8A 2HIHA 1JEDA 1AH2A 3RFCA 1H2YA 1UWCA 1IHPA 4RSRA 5ALKA 1C7RA 5IK2D 2DQ4A 1T2AA 3IV9A 3UJBA 1CDDA 3I9NA 4GVLA 3L4EA 4TYMA 1O58A 1UPUA 2YMLA 1PE0A 4D3XA 3AERA 4OIFA 2B8WA 3Q7QA 4YRZA 3DV0A 5K3BA 5ICEA 4E4YA 3EA4A 3MZ0A 4QGSA 1XPOA 3ZD6A 1GPDG 1A2BA 2CHVA 1DX9A 1OTXA 3R76A 4XIYA 2NGRA 2HRCA 4ETWA 4RVNA 5IULC 1QIKA 2B8TA 3V4VB 4B4KA 2ZYIA 5L6LB 2YJZA 1TTHA 4UVEA 3DE2X 2YZGA 4F1JA 4LYFA 4ZJPA 1E0AA 1NXXA 1KYTA 2P3QA 2O06A 2UUOA 2ZKIA 2VEOA 3LECA 1Q15A 1YIOA 2OVBA 3I9V1 4RMIA 5K0NA 5B3KA 1EVKA 3GFGA 3NYRA 3AF4A 1RAFA 5CVJA 2I1QA 3VU9A 5BPFA 2O20A 3I6YA 1GZSA 3LLUA 5L7TA 4WADA 5TF0A 2VPQA 3GFFA 1MFZA 3GIDA 3R3JA 4HDRA 1J0AA 1TXGA 1JQAA 3WYEA 4OMDA 1FBNA 1XEWY 2IXDA 2PBFA 3B1ZA 3IBTA 4KN8A 4G0NA 4BRSA 2UUCB 1KQOA 3HKCA 3LOPA 2ZR0A 3RBVA 3TZEA 1GV0A 2R4UA 3UG6A 5DNCA 1HWYA 1KI4A 2FSUA 5B58C 1RRVA 1L7XA 2GHTA 4YDHB 5EEHA 2FAXA 3DVAB 4ZYZA 3F6YA 3ZWQA 4FDLA 4F91B 3VHQA 3BJZA 4X65B 3SQLA 3F97A 3PWTA 4JBWA 3L0SA 4JS0A 2FLKA 2RGBA 3JZAA 3ER6A 1RHQA 3X1MA 2ZYUX 4YCMA 4OO3A 2QP9X 3WK4A 2PQ0A 5BOVA 4A6PA 5I9IA 5LLTA 2AS0A 1ADBA 3HB1A 1T10A 4G8CA 1GOTA 1VRCA 3E8SA 4LWPA 1GG8A 2AEJA 1EFAA 4P86A 1NFFA 2X0JA 3FFAA 3PT5A 2EP7A 2ZYVX 2V45A 4F5WA 1XAJA 4HUQB 4J0GA 1KRHA 3SIPA 1VI5A 2D2IA 2K87A 4RHTA 3RB8A 3SFTA 4JLOA 4NNJA 2XUAA 4DQXA 1VDMA 4F11A 3RBAA 1VKRA 1QH0A 5JNLA 1PL7A 1U2QA 3G5TA 4L22A 4B8YA 3H8SA 2P9ZA 3A3NA 3W8NA 2ARKA 2GN2A 1IH8A 3KOUA 5G0WA 2ZOSA 3I4LA 3F5MA 2X0IA 2XQVA 2CB9A 5F2KA 1PGNA 2A4MA 3MILA 2VSQA 4MSUA 3IT0A 4QOSA 4NRDA 4CL3A 2IYNA 4JP1A 3U37A 3QLVC 4E4TA 2J87A 4CMGA 3F73A 1CF9A 3L7LA 2P75A 3HL0A 3WGTA 1L5FA 2DBZA 1VLVA 2ORVA 3NUQA 4MR7A 1GNTA 2Q21A 1AVTA 4JCOA 1E6CA 1FE8A 5FWDA 1NX9A 3AIKA 4CVNA 1X1CA 2AD1A 4RV9A 4LG1A 1M2KA 3TZCA 3NWJA 1A9ZA 3HDGA 4GGMX 3WLSA 1V6AA 4I19A 1RWNA 4OCZA 2H3EA 4DA0A 4CQLA 5C53B 3HKEA 3W2TA 4BFCA 5CDFA 3H2SA 1TB4A 5D3QA 4DUZB 1CY8A 2WZCA 1NW6A 1PJLA 5REQB 2OT3B 3UMYA 4REQA 1DC5A 5E0OA 1UMBB 1QUFA 2QN2A 3AHIA 4J43A 1TOAA 1SD1A 5ETJA 1F51E 3ZDRA 4IJ6A 1F17A 3QV2A 4DEXA 3EJWA 2IU4A 3D2CA 2W2KA 3KRTA 4FBLA 2FN4A 5JLAA 3OA0A 3HGQA 3P4YA 4UBOA 3TRDA 2B35A 5HR5A 5B57C 2A0XA 2OUKA 3IELA 1ONOA 4C3VA 3WHPA 2I3GA 1YMUA 4RVSA 4LZWA 5D3ZA 2Y4OA 3TOVA 2O8CA 2D1YA 3IPAA 4RNDB 3WNCA 4DABA 1B0AA 5FOVA 5BNTA 4PTLA 3CLHA 4U7FA 4RXMA 4AF6A 3M5PA 3OMWA 1FLAA 2SCUA 2ID7A 3PNSA 1M8PA 2B21A 4U3JA 4AKGA 5DO9A 3AY0A 3RYHA 1ZCAA 4RHFA 2CMHA 3UTDA 3N70A 5HKBA 4P31A 1ZFNA 1VRWA 5M2QA 1RI1A 3ZI4A 2HFKA 4CV3A 1EP1B 3R3ZA 2VJLA 4BBAA 2ISCA 5ABPA 1ST3A 1NY5A 4G0ZA 3RC8A 1GPLA 2AZ4A 3V8NA 1I6LA 4QLAA 1YQXA 1LBHA 2JLSA 3RYIB 4DDMA 5BV0A 4JN6B 1N2GA 1Z5UA 1XN4A 3M82A 4NF2A 3UW1A 3AOEA 4UZEA 3OPVA 4IDEA 1SKMA 4E94A 1KEEB 1Q19A 2UXCB 3N58A 2AG8A 4KTVE 4MAMA 2QW8A 2JK1A 2XVYA 4PYMA 3V6MA 3IALA 2XMBA 1SPXA 2ODPA 3V42A 3EFOA 3OWOA 4M8KA 4YCLA 1P9NA 4DBVO 4DWOA 4P0QB 3EW7A 1H1DA 2VJYA 1MGPA 2IY7A 3FMGA 1PL0A 4HX5A 2QWXA 5JH7A 5ESXA 3ZE0B 4OATA 4P33A 1I13A 1XZJA 4WPGA 4KBFA 5K0TA 3ANTA 4IIFA 4OHCA 4URUR 4A92A 1I6WA 1SG0A 4IS3A 4LS3A 4XFJA 5E6SB 1NA5A 3JWEA 4Q3DA 4YCDA 5C1PA 1I4WA 4FKZA 4G36A 4RSMA 3VPFA 3SI7A 3T5MA 5JZVA 2HUNA 2YY5A 2ZRCA 1J09A 3ITEA 3PDCA 2NT3A 3LY9A 4KXMA 4ZOLF 5JO9A 4BIIA 3AVUA 4P7BA 4BWYA 5BNWA 3ZS9A 2YVKA 2AKAB 4CDRA 3L4JA 5EUBA 4JR1A 5B6PA 1CFZA 2J5XA 4D6YA 1ZC3A 1W19A 4QWMA 4MA0A 5KWEA 2MYNA 1XXHB 1P0PA 1A5ZA 3EVEA 3SS8A 4DJ5X 5KQPA 4KIUA 1RJEA 4ZVQA 2XDAA 1B6SA 4O8CA 1B0PA 1B26A 3N3AC 4WTOA 1QGUB 5JAOA 1Z6AA 3PVSA 5EE9A 4CM5A 4GMHA 3CF4A 4L28A 5JS8A 1XP5A 4BWVA 5CFOA 3HYTA 5J5CA 4KPFC 1MJFA 2OC4A 1A82A 3SF0A 3I5AA 1XX6A 1U1DA 5JNUA 1I7LA 4PGGA 1BYIA 4ER5A 3GD7A 3BD9A 5A5EA 1XNHA 1ZINA 1OXBB 1KQ3A 3H0KA 4N76A 1XTPA 2CDNA 3NETA 3H5RA 1HSZA 2XUJA 3NI2A 4DQKA 3UBTA 4LOJA 1XTKA 3FMIA 4RY8A 1ZRHA 3GHYA 3Q6MA 4D99A 1E9AA 1GPYA 3JCZA 4IKEA 4D5EA 1YR9A 4HF7A 1SC1A 5HF9A 2Z95A 4WOKA 5CT8A 4CM4B 5A6SA 2RHGB 1C2YA 2QUBA 2FV8A 5KC9A 2N42A 1ZU4A 5JJLA 4R0VA 4L07A 2GASA 4MZDA 4PLCA 4JI1B 4BE7B 2WG1A 3LTNC 4LVOA 3ECAA 4DG9A 4G63A 2QLTA 2VK2A 1O7JA 3Q9LA 5E6UB 3GLVA 5DRYA 3G9ZA 5JAZA 4JLNA 2E82A 3FW1A 2Z43A 4NV1A 1ENOA 2DRIA 3H65A 4D42A 2Q5IA 1L6IA 1V3QE 2V0NA 3D6FA 4RMHA 4QVIA 5EXXA 3HN6A 5JD6A 1GUYA 2G5CA 2QOEA 4I1UA 3WNDA 2IYFA 1UXHA 3OY7A 1Y4ZA 2W6JA 2X58A 3AB8A 3K35A 4G0MA 5DYIA 3RS8A 4CMBA 1MX3A 2CUTA 2YHSA 2QV0A 3TGPA 5JUWA 2FYTA 3WL8A 4DHEA 2GYWA 2P69A 1BX1A 1MX5A 1NBMD 1DJNA 2XNHA 2QZSA 1UJ5A 4PNEA 3GR6A 5E6UA 1AO3A 1XU4A 5EVCA 5IT9A 2AX3A 2AF4C 1PX0A 5T41A 3GA7A 2FP4B 3VR6A 1PTJA 2Z6QA 2JGNA 4LXTA 4JVNA 1QB8A 3KQMA 4KR2A 1FFYA 2G72A 2A2ZA 4D9IA 3ZV6A 1YJ8A 2MHCA 1GL6A 1BN6A 2IHBA 4YPVA 2ZR7A 2H57A 3L0IB 4JR2A 4RL4A 4LWOA 4ND7A 1OBVA 3OM1A 1OGYA 1C9DB 3E0XA 3H8JA 5CFRA 5IJ0A 3FDJA 1SOUA 1PV1A 3M6XA 4YCBA 4EFMA 5JROA 1H5NA 4YROA 1Z36A 1N0WA 4RS3A 2APJA 5JI3E 2F67A 3TUZC 1K89A 2B6NA 3PTLA 3SXUA 4X45A 4RM3A 3IB3A 4PRKA 1XTBA 1J49A 1FFDA 5EE0A 2GA8A 4D8TA 3QUSA 4RVCA 1YH3A 2OHOA 4UDYX 3I2KA 4EYSA 5AW7A 4B2YA 2FDCA 5AHWA 3ZE7A 3LPAA 4RUKA 1TM3E 1PBNA 2C2ZA 1ZVQA 3G1TA 4MQMA 1U1GA 4I7EA 1DBSA 4MKXA 4Q4DA 2NMVA 4TL8A 3RUPA 3IKVA 4TLBA 4YCCA 1KOGA 2GJ9A 5K09A 1C41A 1NLYA 3BWDD 4OMUA 5FWNA 2OSBA 1OGJA 3E9QA 4M49A 3TFWA 2AOTB 3A7EA 1MT3A 4N9WA 3ZE2B 4CV2A 3WMWA 1G42A 5IKPA 1FJXA 3UMVA 1GTSA 1ZITA 1SBTA 2EJWA 3PQ2A 4DIBA 2D1FA 4PZ0A 4DLLA 2O4UX 4JL6A 4TXMA 1CQPA 3C1TA 2FK8A 4MEBA 1T1IA 5JDCA 5EQJB 3H3JA 2HF9A 4YPOA 4KR7A 3GCGA 1G6HA 1KNQA 1RP1A 2YJ6A 3B1WA 3N1UA 3O1JC 4MTCA 4CLHA 4IDHA 1LVGA 2DECA 3D7RA 2WVJA 3NAMA 4MWBA 2QVGA 4D02A 2C7RA 3LVRE 1PJ3A 4C0WA 3FAKA 2DT8A 5AW5A 3RVOA 3HNOA 3WGJA 5B53A 1JE0A 1HOXA 3IS3A 3ZHOA 2XDQA 2OBFA 1MAHA 5KTOA 1V7ZA 1YACA 1YZGA 2EEZA 4WDQA 5AKLA 5G4LA 3C48A 4R83A 5JYDA 1DJMA 3U19A 1CJBA 3EXEA 1MRZA 1UIRA 3IXQA 4V03A 3LAWA 3SYLA 2O0HA 3LL7A 1PKXA 3BF7A 3LX5A 3LUCA 4MWSA 4DGSA 3LPCA 5D3MB 2JLBA 2WIDA 5IBCA 2X3UA 1XL1A 4GKJB 4MYSA 3FPEA 5SZKB 4PTYA 3TNLA 1OCEA 3CMCO 1O57A 3L0OA 1UDBA 4ESEA 1FUIA 3I6IA 4E09A 4YMVA 4MRAA 4W82A 2BFCB 4PHGA 4N6OA 3HJGA 2W48A 1S8AA 5AM1A 1HQDA 2G8NA 1DLJA 4P34A 5AW6A 3FZGA 3SFVA 4RZSA 3C3MA 1WVMA 4OI0A 1LDGA 3TRFA 2YIDA 1R5BA 3UHOA 4YJ3A 1EX1A 1D2NA 5JWRA 3VAZA 5L3SB 3C3XA 2XMDA 4MUBA 3TR6A 2R00C 1Z2DA 4HVCA 1RACA 4GL4A 3KNZA 3EVDA 1S3IA 2TSYB 3MWEB 4HS9A 1YJAA 4L8YA 3RV4A 2EBFX 2JEOA 2ZRHA 4J0CA 3G8YA 1UBKS 3C4QA 16PKA 4YRSA 2ON6A 3EVAA 4HFRA 2JBHA 1Y4AE 3IUQA 1CG6A 3LM8A 4HTFA 4M54A 4NDAA 3OG9A 4IIDA 1KERA 1XXHA 1J1UA 4F5DA 2QSJA 1NN3A 3ESYA 2IGBA 1BXGA 2PGAA 2YZKA 2PRJA 2BM1A 3HI4A 2CKDA 4WK4B 3ODGA 1GADO 1H2EA 3C6QA 3VGJA 2UYQA 1KNXA 1NVVR 1JLLB 1Z8DA 1YKGA 4B6PA 1Y63A 3HJNA 4C7XA 1O95A 1JVNA 3NP7A 2BKUA 4L1KA 4CTOA 1AHHA 3IQZA 1J07A 4WZBB 4CLEA 5IJ9A 2HNBA 5JATA 4NP6A 2XOXA 4HEJA 3JASA 4NFSA 1XZBA 1JSLA 4ZU1X 2FQ1A 3RHTA 3AF0A 3CCFA 3G9QA 4DLTA 2WSSD 5E2IA 4YP6A 1FXWA 3LKDA 4IIXA 1H2FA 2HEGA 3FZQA 3ZJ5A 2ZJ8A 3R7AA 1UFRA 3OIYA 2W6JD 3SJZA 3ESXA 2JFZA 3R6WA 4DARA 4DV5B 3LIIA 3WGOA 4A23A 4OHOA 2G7ZA 3TB4A 4M2LA 1FK8A 1QQTA 2RHRA 3CX8A 3FOCA 3L7IA 4EUFA 2DHQA 2W2OA 1VIYA 5EFZA 1NBME 4JJ8A 5ES4B 4HB3A 2BUBA 3GJTA 2LDBA 4GRDA 1M5TA 5H70A 2BE9A 1ECPA 1OBHA 2I76A 3NC4A 4XVUA 5ENVA 3ZBUA 1X80B 4YASA 2Q2NA 3W5IA 1OHHA 4KE7A 3SN6A 3KQNA 3STTA 1KBZA 1R3UA 1OH6A 1RQPA 1ZOOA 2DPLA 3RCBA 2YFYA 2YVUA 2SICE 2VL7A 3N2LA 1JLRA 4HVTA 5KYYB 2NVUA 1ES9A 1PIWA 4UASA 1IVSA 5FA6A 5FIUA 2VAMA 1UC8A 4YXFA 3LP6A 5FBVB 5CDYA 3F6PA 4KV9A 5LU9A 1G8HA 1RXVA 1G7RA 2VAWA 3FNEA 3ZK9A 2Q07A 1YB7A 1DTWA 1VOTA 2VWQA 3DV9A 5ARBA 3GLGE 1E4YA 4WCVA 1OAKA 3RAGA 1DC4A 4C4YA 4I5DA 1Z4PX 4DNPA 4NZYA 5DIZA 2CXPA 1W85B 2GI4A 4NCIA 3WRYA 1XYVA 1MENA 3T4PA 5EP3A 3DLHA 3HJFA 1F8XA 4KQ2A 1X8LA 2VN8A 2D7JA 1GL9B 3A9WA 4MR9B 4D0RA 1L4LA 2QTVA 2J0VA 4G86A 2A8YA 1SCKA 4F92B 3T9CA 4OBXA 3G0HA 1T24A 4PXSA 5G02A 1OIXA 4XQ0A 3G6KA 2YHIA 3MS7A 2XRFA 3MF4A 1Z7WA 2VATA 3D6JA 1SQ5A 3TMYA 1UDCA 4K6KA 4EG0A 1YOVB 2IODA 3CINA 4JYMA 4IIJA 5SYAA 2R2GA 4FE4A 2AIRA 4LXQA 2VDQB 3UIEA 1HNZB 1MA3A 1M83A 1V47A 3GEBA 3K8OE 3I2YX 4O1MA 3ETCA 1S96A 5AXBA 1RHRA 1TCBA 1QH1B 3CH6A 4H0NA 1ECFA 3QG1A 3EYAA 4GZ5A 1ZW6A 4I1YA 1ZIDA 3QW4B 4WY8A 5A71A 7REQB 4A3SA 3QE2A 1YHNA 3RG8A 1TW2A 4B4DA 4AX4A 1OH8A 4Q7EA 4EL0A 2BLLA 1KMHA 2L18A 4YP7A 4YRDA 3A25A 4AAYA 5KQSA 2IZ5A 1GFZA 2AR0A 5KVQA 2ZB3A 5JHHB 4Y8VA 2WJVA 3LYUA 4MW6A 2ZJ7A 5DP2A 4G1UC 1QYWA 1B8PA 1MG0A 2XYQA 5C8YB 2I7XA 3RFXA 1O9GA 2FMIA 2XUZA 3PFGA 3GCXA 1M0SA 1VM6A 2Z8YA 3PFHA 3U4GA 4F1WA 4R71A 1XZDA 4KNYA 3ROQA 1S4MA 3UJ3X 2QTVB 4L75A 4UE6A 1SQFA 4L50A 4J16C 4RF3A 3C4JA 4FK8A 1TQ6A 5ELMA 4D41A 3AVVA 1S9DA 3AEZA 3JQRA 1CQIB 1U6KA 4GOLD 3WY9A 1QRAA 4E1BA 2HDOA 2FVXA 2XNDA 1Q1AA 4RWEA 1CHNA 5JDIC 4N5NA 1U2GA 1N2ZA 3ICWA 3BQNB 1UBMS 5FV4A 3O4HA 1FTNA 2P9TA 3QYPA 1ECJA 4DGQA 1ZGJA 1N1MA 4MW1A 3K8YA 1TK3A 2PAFA 2ZPUA 4NCAA 1LS6A 1TMGE 2F43A 5KYTA 5IN5A 1B41A 5M7EA 2IS6A 2QVYX 2UZIR 3EH2A 1XZNA 1X1RA 4ALLA 1F9EA 1GXSA 4PLYA 2NVUB 3GL9A 3DMGA 2WHQA 4J0FA 3B53X 3LVQE 2AFIA 2WJWA 4O63O 3STYA 3A37A 4AURA 3S7TA 1E1QD 2JA1A 3CR8A 3NHUA 4BL5A 3GJZA 2C3MA 2NO0A 4IV8A 2O3TA 1WA5A 1YK1A 2AVDA 2QENA 2UVPB 5CLIA 4AUMA 2QK4A 3GZNA 3S1AA 4HUJA 3NQ41 2YYSA 3KHSA 3KWMA 1Y1KE 2HTFA 2Y0DA 3U6KA 4ZCMA 1RWOA 2FP3A 3FWYA 3UG7A 1AQNA 3AILA 5EIAA 2XQKA 4RLFA 1GAQA 1S9HA 1UKBA 2YRXA 4J3NA 2QRUA 3I72A 1JBKA 5CEJA 1QLJA 3KOWA 3KTAA 4CRWB 2I9PA 2ISSD 3WS7A 1ISSA 1U3CA 3KVNA 4OHFA 3OUTA 3BMQA 1GN8A 1NULA 2JLAA 5A5FA 1LI7A 2W90A 1ABFA 2QPOA 3PA8A 2V3WA 4IIBA 3UPTA 2W93A 1DWUA 1PV2A 1RXCA 2HMYB 3HGTA 3MIZA 4EL5A 2Q6OA 4KPEC 1L5KA 1LS1A 5BW4A 1HZZA 4DB4A 1OI4A 1EJ6A 1TRKA 3R3UA 3BRCA 5U4QA 3JTEA 2QHXA 2XJ9A 2Q3EA 3FYCA 3H9CA 3QKRB 4K3UA 4XPZA 2ET6A 1KEKA 4OX9B 1VJRA 2OK7A 4N5IX 1O87A 2QN8A 1QFJA 1YI1A 3FOWA 2DFLA 2YJ5A 3PXGA 3CG4A 1CY6A 4O2AF 3UAGA 9ABPA 3CURA 1BOOA 4CN8A 2KB0A 4XX1A 1GG9A 2QRHA 3SSOA 3ERCA 3WLQA 5TS3A 1D0VA 2ZR9A 4IEIA 3U3MA 1T35A 1ZM9A 3FUTA 4UAUA 2F2TA 3HEBA 2YRFA 4LOKA 2JFQA 3QU4A 3T94A 4TZ0A 2YV3A 4LCBA 5AKGA 5TB5A 1KZGB 2IHVA 1L5HA 3SX2A 4LF8B 1I33A 1QO0D 3UAOA 4NK5A 2PUGA 1FMLA 1SQ0A 1R74A 2C0QA 4UHFA 3RR2A 4EPWA 5IZ4A 4ARIA 3QBDA 4DLBA 1QWSA 2GK4A 4ABYA 4BP9A 1LPPA 1KJYA 1LJUA 1R0CA 2FEPA 2FW1A 5GONF 5CB4A 4C0KA 3UAWA 5AUQA 2HQOA 5IVKA 4IDOA 2GWRA 4O2BA 2G17A 2JI4A 3T7SA 1KFBB 1S2IA 2BSAA 3I39X 3LQQA 3MK31 4L08A 5B1SA 2BC9A 4A8JA 4LHEA 2CMKA 2V9ZA 2HXYA 1A3CA 4G09A 4PY2A 3NDRA 1AS0A 1G8PA 3B38A 1CK4A 3G2PA 4XE5A 3QV1A 4YR9A 1HDYA 1E59A 1N1DA 2BFNA 2W6PA 3LOUA 5G1NA 1JSRA 1T9GR 3TRHA 3LW7A 1BROA 3VV3A 3ABIA 3MJRA 2QLJA 2DWPA 4EGCB 1WETA 5JSHA 4DLSA 4JODA 4N3NA 1HT0A 1E6EA 4HGZA 3RVJA 4LMRA 5LDDC 2CN1A 4PSKA 4IG4A 2JAXA 3L7CA 4IQGA 5B3LA 1ORVA 4AJOA 4U6NA 2H65A 3BXHA 1W25A 3T5TA 2JFHA 3ZGVA 2BMJA 2W98A 1H9AA 2PL5A 4L27A 4AKSA 4TYPA 3IL2A 2JIBA 2C3OA 2WSIA 4DLKA 3B9QA 4ZDJA 3OURA 4LJYA 2R8RA 1PCXA 2YZMA 1GGJA 3L0CA 3ZWDA 1GTMA 5I5EA 4OLAA 1NM5C 3WO1A 2QXTA 4Y2TA 4PNPA 4II7A 4ND8A 4RACA 4AZTA 3K9CA 5C5CA 2YINC 4I46A 4JB3A 4IIVA 1E18A 1VBMA 4GLJA 5I5GA 1I2ZA 3VR5A 1QZ3A 1SHUX 5KS2A 3LT1A 4LEIA 4XB2A 1WXHA 3T06B 5J3JA 2WWYA 5LQAA 1R2QA 2VQSA 4HDNA 3RK4A 3OHMA 3A14A 2SKCA 3O7WA 1K88A 1U3WA 4OHZA 1EVLA 4IFIA 1R3DA 4HX2A 4IQ8A 1WUJS 1ULSA 3I53A 4PCVA 1GZ4A 2DR3A 4R68A 2ZRBA 5DW0A 2F1JA 4CLRB 2FPPB 1E4EA 4OHYA 5IDYA 3ED5A 1Z0DA 1MBZA 1JIUA 1JLKA 3AUKA 3KOMA 5AM3A 5F23A 1KR2A 4CE6A 4ZVMA 4BE4A 4ZI2A 4HLUA 1TRHA 1G3IA 1N2BA 2JFNA 4AVYA 4BAZA 2HQSA 2I6SA 1MXFA 3BKWA 3FCSB 4LX0A 5AUPB 2OESA 1E9FA 9LDTA 1A9PA 1MOPA 1R0BA 1A9XB 3GCWA 3IAEA 1G66A 1E77A 2JI7A 3EDRA 1T3ZA 3PUVA 3DW1X 2H7YA 2G0AA 4MIEA 3RU9A 4OA8A 3ABSB 5I51A 3RIHA 6Q21A 3GGCA 1R37A 4XIGS 3RRJA 9LDBA 3PXUA 2ONZA 3VZBA 3ZLVA 1YA4A 2H2IA 4AJHA 2YWHA 4K81B 1E6LA 1QQAA 3O73A 4JZYA 1YRQA 4O6VA 1M2EA 1P7PA 3SZUA 3D1LA 2I91A 1SOAA 4QQKA 5J40A 4HAXA 3HNPA 3EGDB 4D9MA 2V6FA 1A7AA 2Y27A 1IE3A 1EZZA 1G1AA 1PVVA 5G53C 4PQYA 5TT0A 1P2DA 1L4YA 4G4SP 1UBGA 3Q85A 1ZNZA 1ZSVA 1ZWKA 4O3FA 4RVGA 3CVWA 2BFDB 3RAFC 1I3KA 2FG7C 4FGSA 4OTZA 4YAOA 3CX4A 1JEEA 4OK3A 5IAKA 2FWIA 3NS7A 2C5LA 2QAGB 1TMKA 4HMPA 4TUYA 4AQ7A 1X7GA 2RJNA 1JFVA 2OGTA 3PUWA 2WHPB 1G3RA 5JG7A 2XA1A 1SBCA 3GP3A 4F6RA 1SURA 2FRDC 2HMSA 3R3WA 4GWLA 3P0HA 3Q7IA 4QO7A 1WE2A 3U44B 1KJNA 4HLQB 3VNQA 2O05A 4BV2A 4NCHA 4X00A 3HXOA 3MS2A 3WMGA 1ZEJA 1QG6A 5L51A 2FFQA 4IXDA 1ZL2A 3QWFA 1CUJA 5E7QA 1NXOA 4JBHA 4KPYA 4HB0A 4G0QA 1GM5A 1QFZA 1EDDA 1KMHB 4WD3A 1AGRA 3D0RA 4WXEA 4BV9A 3FNIA 4CF3A 4YJFA 5DLYA 3WGYA 5LDHA 4IIHA 2W00A 3IDFA 4L15A 1KYWA 1G6OA 1Z8NA 4XLTA 1KA9H 5IZCA 2IYYA 2CFRA 1JHMA 2E4AA 2Z5VA 2ZTVA 5TPWA 4DJDC 4GQAA 5T5QA 1TVMA 1UC4B 5KTNA 1QQ6A 1YO6A 2K6GA 2OYSA 2FSGA 4XLLA 2NSLA 2W6CX 3G5AA 4CLRA 4JJGA 4TMXA 5KC8A 3W5CA 3W6NA 1PO7A 3CLVA 3LLVA 2ZB4A 1PG0A 2ZJ5A 3BBPA 1H9CA 4MPTA 3T34A 2GN9A 4DCUA 2NU9A 1EFPA 2UUAB 4HDQB 2H2HA 3RT1A 3ZWBA 5ELLA 2OTCA 4JBXA 3PEVA 5CAEB 4LF5B 3C97A 3QNWA 3UUEA 1LGYA 2FPPA 3HM2A 4FOPA 2E5FA 4UM8B 1QOZA 4MJLA 5H82A 3GPLA 5BV1A 4DR4B 4JT9A 2RG1A 4MUFA 1G2IA 4FHEA 3R9IA 4ZO9A 4Q7JB 5A9SA 2GKOA 2Q0XA 4BJ6A 2QN7A 2W2XA 3CONA 3V2GA 3VXKA 2JCGA 3HR7A 1CIJA 1AZTA 3TDNA 2CKMA 2IY8A 2VK8A 2VTEA 3EEQA 1XF9A 3RJZA 1EWVA 3QKTA 4KFTA 2NOAA 4LA4A 1PJQA 4HX9A 2FUNB 4MCIA 4DV1B 4C0HA 4EYEA 1HLDA 1U63A 4UFNA 2VXYA 3WYDA 3GGDA 2FWBA 1RIIA 4K03A 3INGA 4ALIA 3E9EA 2P0YA 4FJ0A 1VHWA 4WJLA 2RC6A 3AEYA 4MW0A 4RYLA 2XNCA 4QYSA 2G3YA 2I4MA 5I7EA 4FJ1A 2XSZD 3NH9A 4NY1A 2W42A 2V1UA 5F12A 4MO9A 1DFHA 1L7NA 3KSDO 3GH3A 1ODJA 4E1VA 4RYDA 3F3KA 5TEWA 3FB4A 4HBZA 2OP1A 2Y6UA 3S2YA 3U9LA 1Q74A 4C03A 4BFSA 1CUSA 1Q3KA 4JD5A 2EGUA 4YVFA 4DQ0A 5K6AC 1SVNA 1Z35A 4YJGB 5LVAA 3DO6A 4AMVA 3OEHA 4LRYA 4EX7A 1R18A 1W5FA 5BSGA 3F7TA 1MC5A 4ID9A 3KVVA 2F7SA 2XUKA 2BFWA 4AULA 1QC5A 4NV0A 3P4XA 1S3FA 3TR0A 4OBBA 3TW8B 1LF5A 3DM5A 3HUDA 3P5SA 2PX6A 1OLSB 1VI2A 1QGYA 5FLEX 4TYWA 2WR8A 5HMMA 1XMIA 3N6XA 3UUGA 1WDMA 3V97A 2ERXA 5GJWC 3GMDA 1MX9A 5AJTA 1J0XO 3KP1A 4L8WB 3QG5A 4WH0A 5EESA 3TNDA 3NTXA 1N5JA 3ILYA 1Z62A 3KB1A 3KDAA 3MT9A 5FHRA 2O8VA 1G21B 1TMYA 3R9KA 2AWOA 4AWAA 3EEOA 3HDHA 3G2IA 2PZLA 4F2WA 5KEIA 3GH1A 3OJCA 3TTUA 4ZCPA 3AJRA 4G1FA 5AM2A 1FYDA 1U94A 3CUSA 3DBLA 2F59A 3FJ1A 4QDXA 4KOEC 1ZN2A 2P6NA 2XT6A 4JJIA 4IFTA 1DCFA 2A1TR 4MB2A 2C95A 4C7JA 3I0NA 3HBAA 3WFIA 4M60A 4XDYA 1OLSA 3L8GA 4RIHA 5CT5A 3U7EB 1Z6QA 2J3DA 1FLDA 1S8NA 1C4OA 4RHUA 4W5QA 3HCNA 2R0QC 2E4XA 2GPBA 4DCCA 3DBIA 1GNPA 5J59A 4DQUA 1TKBA 3JQPA 2ZRKA 3UHFA 4YJGA 2CBGA 3K9HA 2JJMA 2UZ0A 4KQ6A 3BWXA 3M6FA 1RHUA 4GD3Q 2O2ZA 3V8EA 2AOVA 1DU4A 4C88A 3U5ZB 2WB4A 2Q45A 4LJ5A 1PD1A 1RIFA 2IDZA 4TV9A 1FXSA 2JI6A 3M49A 1N3YA 1WO8A 1AMOA 4TTTS 2P9GA 1YWGO 2IK8A 3K1ZA 4J91A 1XR3A 3SIWA 1LD3A 4B45A 1E9RA 1PQUA 5E7MA 3RSSA 3RDPA 3USZA 4DEVA 1B74A 1DV1A 2GARA 1U0TA 3QPAA 1LY1A 2NP6A 2V7BA 3BTUA 1Y6GA 4HTAA 4XQGA 2G1AA 4Y2GA 5ALWA 3DOOA 5EJAA 2C57A 1V8FA 3LBFA 5GJCA 2ZWMA 4HPWA 1C8BA 1QCDA 1W0JA 4ZXFA 4KQKA 4I81A 5CFLA 2BP7B 4C3ZA 3EGXB 4JY7A 4DA7A 1IY1A 1VJCA 4NS4A 3O93A 2AQKA 4LY3A 3ENWA 1PEAA 3WJ1A 1A96A 1VIVA 2WAYA 3CNOA 5ECWA 5CA1F 2B25A 4LK3A 4BMOB 3BHMA 3EDYA 3DMNA 4N3CA 1NW8A 1XQ9A 3KO8A 4KH0A 5A3QA 4X91A 4EKEA 3UNXA 4C6SA 1D5CA 2XGGA 1E1MA 2QGZA 3ANMA 3DFFA 2XECA 3ZX4A 1E1LA 1VKJA 1UP4A 1WKBA 1BQ4A 4L4YA 1JSXA 3F4BA 1K2WA 1LZLA 1ZN7A 3Q5EA 3CNHA 3UN1A 4IDAA 2O50A 3TB6A 2VZLA 1DPFA 4O4HB 4X71A 2BW0A 2WWHA 4Q1CA 4DMKA 1Z9BA 1XEXA 4MHTA 4G0OA 3T3HA 1WVIA 1BA3A 3JPYA 1FLNA 1QS0B 3DZ8A 4BC1A 5F3RA 4AXXA 4CT4B 2AKEA 2WV9A 4GXTA 3Q98A 4ZEOA 3BZUA 1T13A 4EI8A 2C4MA 3HP4A 4NARA 2CWDA 4UU7A 4HLUC 2WKPA 1PN3A 4ZREA 4RJKA 3U48A 2ZE8A 1R66A 3VDRA 4ZTUB 2AK3A 5TNXA 2PKCA 5AKKA 2IE8A 2Q9CA 1BDMA 1I5OA 3FNBA 1O89A 2E4WA 5EIBC 2C99A 1RBYA 2GSWA 1IJBA 2IF2A 2HQRA 1MKYA 2OZVA 5D1HA 2XEXA 3U1TA 5HUJA 5JEDA 1ZK3A 1RQ7A 4MI1A 1GL7A 2PVSA 1NG1A 2QBYA 3EA5A 1JH8A 3BHIA 1PW7A 3OFSA 4MK4A 1DEKA 1KYVA 2H2FA 2Q2WA 4FFNA 3D54D 3TMAA 2C1XA 4LBWA 3IP7A 1L5MA 2VNJA 4HNRA 2V8BA 4QXAA 5DHFA 5F5LA 3QOWA 2OZEA 4FYJA 4HNAA 1JE1A 3LGAA 3ZHBA 1FTYA 5B1YA 2YKGA 2O57A 1E2EA 1QFSA 2WWFA 3BK7A 3F8WA 3O0TA 3UMJA 4HGPA 3LO8A 2ONKA 3H7AA 1HL3A 5DN6A 2FZKA 3QBVA 2PG3A 5GZ3A 1H66A 2QGFA 2VCHA 2WOOA 3DZBA 4IFBA 3HUUA 1Y89A 2XMZA 4NONA 1Q14A 3ZHXA 2ZFUA 2WUFA 1Y6ZA 1T36A 3MSXA 2JLRA 3FGPA 3KKMA 2VP3A 3KKKA 4HCJA 4JQCA 1S0UA 3T6KA 4QA9A 1RQ2A 2G9UA 3IUNA 6CHYA 1WXFA 1WXXA 4NVRA 4V3BA 3PXXA 2HQ1A 3RIYA 2QX6A 3G5MA 3HCPA 3ANXA 5TGZA 4BYGA 3CVXA 1BZYA 1UZUA 3PDJA 3PGKA 3G7SA 1FA9A 1SC6A 2VDNB 5EXSA 5CHYA 3B6KA 3O4VA 4TKUB 3LS2A 4LTNA 5JVDB 1IBMB 4JV5B 4HAVA 4Z7QB 1ULTA 2R6GA 3G0IA 3O47A 4PQFA 4BFWA 1T4CA 3GLHE 2OBXA 3FKQA 4QPJC 3FTEA 4JP5A 1NI5A 2JFVA 3DWEX 1SBIA 4JZKA 5DBHX 1TQHA 5BQPA 1Q0HA 2EX4A 3FB1A 3GEEA 3KTOA 4RY9A 5IMSA 2H00A 6REQB 4H3SA 1KGDA 5I7AA 1XA0A 6AT1A 4JT8A 4P4SA 4EGJA 1GNQA 4LOAA 4TL6A 5KMGB 2QMHA 3Q88A 4N47A 3SQXA 2DXIA 2YASA 1ZD2P 3DEJA 3KU1A 4X5OA 5KOJB 4G0UA 3NHFA 1XDUA 1EIWA 3WLJA 3A4IA 3NHPA 1DAFA 1F06A 2DBYA 1F2VA 2E0IA 2JKZA 1B4DA 1LQUA 1QGUA 2VRCD 1NX6A 3D4NA 3FNFA 2CLEB 3IUBA 3IQXA 4H7EA 2OECA 4HHEA 3BDVA 1UDAA 1H8ED 1UT5A 4DCSA 2BAGA 3HO1A 3SIXA 3W05A 1MTZA 2I1VB 1GUDA 3FMOB 1MW9X 2I33A 1GARA 2V4UA 3AYXB 3EQ6A 3WSWA 1N3LA 2LPMA 1RWBA 4JUCA 1LEHA 4UVGA 2TMYA 5INTA 1TU0A 1Z4LA 4RLQA 1IK4A 1VYHA 2NU6A 3DKVA 3HCAA 4RXUA 3LDFA 3UH0A 2JCVA 1NQWA 3OQMA 1XVLA 5C5IA 1QHXA 2DHDA 3MD0A 2QIOA 1L8OA 4ZTBA 3BHNA 2F00A 2G1JA 4FD3A 3SZMA 2PH5A 5IEJA 1FSSA 2PRIA 3HMKA 3V1MA 3KB2A 3IFSA 1QIHA 1DO2A 2FR8A 3AF2A 1IPEA 3GN2A 4PX5A 3PI6A 1M5RA 1JHVA 3H5NA 2P91A 2YJNA 4IIEA 3H84A 1Y4DE 1GGFA 1C8KA 5BY2A 3KOXA 1D2EA 4IX1A 2QUIA 2PZKA 4KVFA 2EXXA 4LV6A 3K5HA 4CQLB 1VFPA 3ZWMA 5IKEA 1PFVA 1QFYA 3ULKA 3N2IA 3A3OA 2WIKA 2BTQA 4GIBA 4KPUB 4LYYA 4NH0A 2WOJA 5EMMA 1U7HA 3ZV3A 3PRYA 3QLTA 3TF5A 2LCIA 3IEVA 4M3NA 4INZA 5AI9A 4ZOEA 4W1RA 1C80A 4A8HA 1U9JA 4ZVTA 5IT4A 2V5AA 4HN2A 5FLYA 3WWCA 2ERCA 1QHSA 1DTSA 3ETJA 2WFLB 4TXNA 4XWAA 2VSYA 2F64A 3QY9A 4IGFA 1G21E 4Q4HA 3L4SO 2HSZA 3KV1A 4WOPA 1C3EA 4CIBA 2PNJA 3D2BA 4CFSA 4ENQA 1Q6ZA 5ES3A 3RC2A 1X9HA 2IHKA 1UKVY 3KLBA 3N8DA 3AV0B 4Y2VA 3HBNA 4CF4A 1Z63A 2NPOA 4JI2B 3VC3A 3OCWA 2B69A 2FY8A 2ONYA 3FPCA 3K70D 1V2HE 4OFWA 5L95A 1XVVA 1V1RA 3KEMA 3MBIA 1XCOA 4BU1A 4MAAA 4QUAA 4RY2A 2R97A 2WW8A 5H4HA 2BDTA 1VPDA 2G88A 2IEGA 5IJAA 4P7JA 2WJ3A 4WNYA 4IH4A 3W5HA 2GF0A 1KIFA 1U9IA 2E4UA 2H9IA 2R8PA 2WTEA 5FHQA 3V7FA 4M7WA 5MHTA 1QLWA 4BNVA 1AZSC 1QYIA 3DDWA 3ZU6A 1FFSA 1UM9B 4X60A 1UAAA 1VCMA 1ZUWA 1A0OA 1EFRA 1ZUD1 4L5BA 2VTBB 2AOXA 4F4CA 3W06A 4DIUA 4QKQA 5IUNC 1D6MA 3JYNA 4LYEA 5A9SB 4CUKA 1YZFA 3OM9A 1E61A 1VFNA 3ET5A 5CIWA 1XLVA 1QCYA 2JHFA 1FC0A 1E2QA 4IAOA 4MVJD 3ES9A 3GFTA 1V37A 3QVJA 4DQVA 2QRQA 3L77A 3SWWA 2I0FA 2PU7A 3KFXA 3OPNA 4WNAB 3WDSA 3TW0A 1RAIA 1ABEA 1TE2A 4DC0A 2PX2A 2VQDA 1EHIA 1UPAA 3CLRC 3CG0A 1G5QA 5KVVA 5T6BA 3LO5A 4BVFA 4GLBA 1CULC 2VS1A 1Y37A 1N57A 3WMFA 2HWKA 2LIVA 2O7VA 3FBWA 4JWTA 1KDPA 5IJZA 3DZCA 4E30A 5TSDA 3CZAA 4M9XA 3RWBA 1X8JA 5AI5A 3RUFA 1L1RA 1PLKA 3N86A 4GKVA 1GR0A 1H94A 4MGYR 3GWZA 4G9EA 1NWCA 4P32A 3RVSA 4Z7NB 4ZVLA 3T12A 5EJ4A 5JRZA 4J0JA 1LPAB 2PNFA 2GN6A 2JS7A 2REQB 4QXPA 2J6CA 1HDOA 1R64A 2LCFA 2FH5B 2HEIA 1EI9A 2O3QA 5BRAA 3QEJA 1DX4A 2PM8A 5DI3B 1ZM4A 3TRKA 3TEFA 2VAPA 3JYHA 5DT2A 3ANLA 1IDOA 2AFIB 3ICCA 1JJFA 4BBJA 3DZJA 3BYZA 1TUGA 1U3TA 1TX4B 2VJOA 4L2IA 5J1SB 1KWKA 1KFEB 5TMBA 3KKEA 4QIHA 2QDKA 4I36A 4NXMB 1FL9A 2WLSA 4KQWA 4D45A 3PJFA 2AR9A 5KQRA 5CD1A 1HNNA 2I1LA 3DMRA 1VXRA 1QH8A 3OOEA 1VMAA 4WHMA 2XVXA 4C5AA 4OKIA 1BOFA 3UMRA 1U9YA 3JQ7B 4YDQA 3UTCA 2OCKA 5AJHA 3ZQUA 1CDZA 3GLIE 4C29A 5DWQA 2BR5A 2Q62A 4O4HA 2P3SA 5HQJA 2CFTA 4BP3A 4DKXA 3DYBA 1M34A 1RXEA 1V9LA 2FEWB 3HDYA 1ZH2A 2RIPA 4QHSA 3OWXA 1RXSA 4HLNA 3V2IA 4RTMA 2HT1A 4BUJA 1JDJA 2B5WA 3K05A 3PQFA 5LP1A 2VOEA 4O1HA 3LBIA 3ABZA 3M6IA 4AMGA 5JXGA 4M46A 4EUEA 2BGGA 1JB9A 3UGJA 4P93A 2QD5A 3TL2A 3ZK8A 1Z88A 4Q47A 5ALPA 3N0WA 1XPUA 1A2QA 4P9NA 4YUVA 4RIEA 4IF4A 5E1MA 4GQIA 4U9HS 5NLLA 5JAHA 1KMMA 3T3NA 1ZMRA 2C03A 4FFMA 5B2FA 4TLMB 5F7JA 3DHVA 3C5WP 1DHRA 3WTCA 3DLAA 1NOKA 1B0UA 5K4GA 2I2AA 3FPGA 3HKCB 3D7LA 3LUGA 3NONA 2DHCA 1HORA 2DWOA 3ORSA 2P2LA 1E3EA 4G5SA 2WTXA 4TRNA 2QD3A 2E49A 4MMYB 4MS4B 5LA6B 2PLAA 5D7BA 1BH2A 2GJKA 2VHUA 4BNHA 2XHEA 3JQAB 4C4RA 4BXOB 1YB4A 1AQ6A 4A91A 3N7AA 1AG9A 4BQPA 1XQ1A 4YLEA 1KVSA 2VF8A 4QXRA 4Y2XA 2JHAA 5EEGA 4BZQA 4ZYVA 1N4AA 3HPRA 3ZGLA 3F0TA 2GD0A 3BD7A 2OENG 2WAMA 1IATA 3C8HA 3R9XA 5CVCA 1XB2A 3GJXC 5ALZA 1E1KA 1WHSA 2R1UA 1YVRA 3TSOA 1ESEA 3H1FA 3F4LA 1ZGHA 2QTFA 2ZJ0A 4JGBA 2IUUA 2ZYTX 1BWQA 4DSZA 1PU2A 1T15A 4HEA6 1NUPA 3CEAA 4UHBA 4NZZA 1XKXA 1SXIA 2C77A 2YY7A 4WLFA 4BX9A 5K3FA 5KTTA 1GAEO 4LJ4A 1KMQA 2HA4A 2H8GA 3VR1A 4KGZA 5GIOE 4NBUA 1G9TA 3FPLA 2E9SA 3HXKA 4FOSA 4FDVA 2QM7A 3NDIA 4XDHA 2GZAA 2ODEA 2NUAA 1YL6A 2YBEA 2ZTMA 4G41A 1KHTA 2IWHA 4BN4A 1E1RD 1RZRA 5IF9A 2VLBA 4PYQA 3C6ZA 1ZSYA 2C4NA 3EQZA 3V7YA 4CV0A 1Z73A 2RGUA 3QX8A 2WHPA 4BLUA 4FYXA 5CEFA 5HKKD 3BJRA 1R88A 2H1RA 5CXUA 2WZBA 2NVWA 3K31A 1X7YA 2VYFA 4NENA 2OOKA 1IN4A 1C4KA 2OV4A 1GGNA 2R66A 2V55B 4M1ZA 4Z3DA 3TUJC 1PJAA 1XALA 4IVQA 4YIHA 5KDOA 4CEIB 2WTUA 3PL1A 2XMGA 4V0QA 3PWSA 5F1KA 2F9FA 3NASA 3FNQA 4YRLA 3UMGA 2YWRA 3CBGA 3DV2A 4MUNA 4NCBA 2X6QA 3DMDA 4Q7MB 4ZRNA 5CYGA 3PTAA 5KO2A 1FDOA 1KARA 3P9ZA 3WICA 2GRJA 4Q3OA 4RD3A 3VPHA 2DLCX 2OR3A 6YASA 1AXGA 1N78A 2BGUA 2PT7A 4CGZA 1YU6A 1NC3A 3FRIA 4TM8A 5DPMA 3VV2A 5AKEA 3RW9A 2OCDA 5KJEA 2IL1A 3VPAA 1I30A 4PZLA 3WTBA 3TOXA 4KFSA 2HW8A 3BRWA 1O5IA 1IUKA 5K0EA 2JI8A 5G0TA 4C30A 5D84A 1RWWA 1KOFA 4B3RB 1AXEA 3L0YA 2AR7A 4P83A 4R9RA 5HG0A 2JIZA 2Q3JA 3FG9A 4KO2S 4ZEVA 1B1AA 3ZZNA 3DH0A 2Y0CA 1CC1S 1CEQA 3UCEA 1BYUA 4PSVA 1JT9A 5EP2A 1GCIA 1T9HA 3ZGXA 3ZGZA 2J30A 2DUMA 3OJOA 1QIFA 2Z57A 1B1CA 5ITSA 2I2FA 4XXHA 2IQIA 4RJ2A 3VKHA 4XIIA 1XJQA 2CSXA 3MCUA 4WNAA 3LHDA 1HFWA 3HJCA 4I3FA 4E5UA 4C0LA 1BKSB 4CNQA 1FNNA 2JARA 1Y8QB 1TU3A 1XFAA 1JSCA 2E6UX 4IR7A 3E2IA 4MI3A 2WKSA 4C6TB 1Q0QA 2ECOA 1WS6A 1XEXB 2UZ1A 1J5PA 4QGHA 2DUUA 1II8A 5IZCC 3FTFA 1D2GA 1PEKE 4BO5A 3KBOA 3VO8A 1QGDA 4U8GA 3HFRA 3JD1A 4U2GA 4DEYA 1K7SN 1KETA 1Z16A 2C4UA 4KXLA 5ILOA 2CVOA 4P4GA 3DZDA 1CJSA 4CMEC 1RBQA 3U4HA 4KSYA 2EIHA 5B6IA 1P1KA 1U7ZA 4AKIA 4Z49A 2PR7A 4ASUA 2Q2VA 1MW8X 1QKJA 1M2VB 1D4AA 3BWCA 4JITA 4KQCA 3TQRA 5FAKA 2IBMA 1Z29A 2AW3A 4N5HX 1OZ0A 4YDRA 1JDVA 2Q29A 1NF3A 2X6RA 3G5UA 4M4SA 2PT5A 4MVYA 2IV7A 1K6MA 5A04A 4ZV9A 3V46A 4C7BA 1FCJA 1IZYA 1OTHA 2ALJA 2G09A 4IDCA 1IU9A 4YI3A 4FNGA 2O48X 3U7RA 1U6IA 3EJ6A 2AHOA 2C2HA 1NV9A 1PW5A 2EP5A 4YK7A 2B2CA 3L8MA 4P58A 4PLZA 2YN4A 3B12A 3NAZA 3AUSA 4KGVA 3EX7C 1CIPA 1FRQA 4IVPA 3OEED 4XLZA 5P8WA 3TCKA 3K1TA 1NUHA 3C15C 4EB8A 3DOEA 4HZIA 3B3AA 3UICA 4C6RA 2WDZA 1Y80A 4HAWA 2IVZA 3AJ8A 1A4RA 2I6FA 1Z7BA 3ENKA 3O3MB 4QXOA 5EJ6A 1JHDA 1X87A 4F46A 2AG5A 4CEJA 2NAFA 1NMSA 1ZHFA 2WPDD 3M4NA 2PBRA 4MW7A 5LDGA 1JJBA 5I9NA 2B9VA 3ZLTA 1W6UA 3DGFC 4A10A 1REQA 4DDTA 2ATEA 2J4CA 1YR6A 4EELA 4GSYA 2M1ZA 4P82A 5D5HA 1OU0A 1J5EB 4BGVA 4Y6LA 4C0SA 3FF4A 3M1YA 2XB6A 3CEHA 3HYLA 4MV0A 1LBQA 1GYRA 1H6CA 2Q0QA 1U4NA 3ZH9B 4YMSA 1CQIA 5LQMA 3AEUA 2YZ2A 3BB3A 1GAWA 1N6LA 1U7UA 1WXWA 2XTAA 3ETLA 3L8YA 4J16A 5AOVA 1H2WA 2VIIA 4L5YA 1OAOC 3MM4A 3D6HA 3E22A 4EI9A 2WQ6A 5CAEA 2ATCA 2R7MA 3K5WA 3NV7A 3QKUA 4GH5A 3R09A 1W36C 4AO6A 1E20A 5GM1A 4DL9A 4C2AA 3A0UA 1VIDA 3MMSA 3MTIA 2NZVG 5F7XA 4ZAYA 2ZU0C 3BCSA 1Z38A 2A9OA 5CVUA 4DT1A 4RX1A 3H83A 1IXKA 4RPCA 4HDMB 2G36A 1C4WA 2C0PA 3DLBA 4S2EA 1YFJA 3RSHA 2B83A 2UU9B 1LWNA 2GGSA 4UKDA 4H15A 3G2QA 3TINA 2QQGA 5DBFA 3TTWA 2HK8A 2PWZA 4KAAA 1VQ1A 1U2RA 1RLOA 1B8UA 1MRNA 3C39A 3TZLA 4E5DA 5I7OA 2J7PA 4I08A 4ZCIA 1WIWA 5LMCA 1ILWA 2XRMA 3OIUA 5DOZA 5BRNA 3RVDA 4ETMA 2HLNA 5E7JA 4B3GA 4AU1A 2B7LA 1E7MA 1MAVA 3DBRA 4DC9A 3S40A 1NM5A 1V71A 1XMVA 3ZWPA 3LHIA 3DL4A 1XLUA 1E2FA 1GA1A 2G9RA 3CNNA 1KFCB 2G0TA 1T9KA 2WFAA 5H3CA 4M7RA 5LOVF 2CHUA 4EHJA 1ULAA 3ZVKA 5LKAA 3R7BA 3M1IA 4X84A 1RPNA 3HPQA 4Z9FA 5FUVA 3IT3A 3X1KA 6NULA 2OQIA 5BSMA 3AP2A 4WKOA 2COEA 1Z39A 2YL2A 5BWLA 5LZ7A 5CDFE 4QGGA 3FA2A 3F9RA 1WMEA 4G1VA 2CJYA 2O0JA 2C2MA 4DAOA 3P9XA 4AMYA 1Z0ZA 4F8EA 1J7JA 5GONB 3D0OA 3KLMX 1KIAA 3WMEA 3NNNA 2Q7XA 5KNDD 1D6SA 2QAIA 2ZI7A 5CH3A 4ZAGA 3U62A 2WJ6A 4MWGA 3LWBA 3N2GA 3O03A 3AGQA 4ALJA 4TVKA 4PZUA 5GZ6A 2PD4A 1DARA 4K9RA 1WY7A 1Y1RA 1QVRA 3DT9A 1YRYE 1E2IA 2VKTA 1L4FA 3A1CA 3C3WA 4D9GA 2O0MA 4U6QA 4DPLA 4NHEA 1SUEA 2C7BA 3LQ4A 3DBRB 3I0MA 4KXVA 5LB4A 3SOZA 3VOBA 3SKYA 5JJBA 3ER8A 2QS9A 3KDPA 1KAQA 2ID8A 1ZGAA 1JJ7A 5KOIA 3UF0A 1QRRA 4Y7DA 2IDJA 3L0PA 2NAPA 5DU2A 4XM2A 3I9JA 1WP4A 3A0RB 5CPFA 4LDQA 2Y4NA 4N0MA 1YOVA 5G3YA 2H18A 2P2GA 3EWNA 1JDTA 3PR2B 5KSZA 5A5DA 3FKSA 3ZGOA 5A7FA 4F0JA 3N74A 4OBWA 1RCTE 3NC1C 3MC1A 1C9YA 1B8VA 1ONBA 1W2WB 2HHCA 4YP1A 3SZOA 1OREA 1EJ0A 3UBMA 1K6XA 5TT1A 3UT6A 3VU3A 5D86A 5FNVF 3OZTA 2R5NA 2ZULA 4MQFB 3UPDA 4P7GA 1ZC4A 3ZY2A 4WZBA 2B4RO 1V9CA 4TZTA 2X22A 2CDRA 2WTMA 3AEUB 3C70A 5ERGB 1POWA 4ZQBA 1QANA 2PGDA 4QPPA 4DAEA 4A8TA 1SVOA 1R9NA 1LV8A 1P2FA 4PGHA 5ICSA 3WYBA 2AV6A 3OAAD 4MR8B 4P35A 4RDCA 4TSRA 3SP1A 3ZZ1A 5JW6A 3HA2A 3GFSA 4UNQA 2OO3A 4WBNB 2QTNA 3MTEA 5DOVA 4KFRA 3NYIA 3ZIUA 3UV7A 4FSDA 1V5WA 1SG6A 1P2VA 1EWYA 1J0DA 3JQQA 2V74B 5C31A 3KUXA 1PZXA 2IPLA 1KDYA 3EZLA 2A94A 1PDWA 4P1ZA 3N0XA 3SM9A 1X80A 1A71A 5H3HA 1CJVC 4DYHA 5LSAA 5DEOA 3ZVLA 1E5LA 4CF5A 2F55A 4I1VA 1IQRA 3IQEA 1T3SA 4P5DA 4RANA 3P9PA 1Y5IA 1ACJA 2Z30A 1PQ4A 3GT4A 4YJ3B 2FPOA 2BBSA 3LP8A 4LNHA 4WZBE 3RREA 1CHDA 4RZ3A 3NBMA 3L04A 4KMOA 1AB6A 3C3JA 3RUCA 3P9SA 2NZWA 2I4RA 3IE0A 4KR3A 5JBIA 1Y4UA 4WLUA 4IGKA 1Q7EA 4R2JA 2SKDA 3BCUA 1OZGA 4RK4A 1PWZA 1XROA 3HBLA 4RJJA 4II3A 2R6R1 4CL0A 1A77A 2PKEA 5CGZA 4BFZA 1HLFA 2XD9A 5L45A 3EGCA 1ZIXA 1KSJA 4FFBA 4TUYF 3COSA 5DULA 4BO3A 4BQEA 5CLFA 2C3UA 4M9UA 4YRFA 2P9HA 1AD2A 1U0SY 3WYGA 3BA1A 4O02B 3EFOB 3UUFA 5CXXA 1EXNA 4MWZA 2LD4A 4ZQGA 1GGEA 3KZ1E 1P2SA 1Z0FA 4NPHA 4OSEA 1K5HA 1TD9A 2WVGA 4R40A 1PD0A 2AVNA 4AJPA 5DEIA 1L7MA 1QBGA 4CU5A 4GT1A 4K7JA 4ZTZB 2C2GA 1MH1A 4RKQA 3ZH2A 2H8KA 5MFPA 4C2UA 1FSPA 4GUAA 5A4MS 2QTLA 3LDHA 4MLZA 3OZCA 4OJMX 1DG3A 5JNRA 3CPSA 4YIKA 5JAQA 4E2ZA 3E7DA 3DTVB 2WUWE 3GUUA 4N3GA 4KN6A 4G56A 3QMVA 3ZJTA 4R1MA 4RSGA 3IMEA 4GS5A 1N3BA 4G5GA 2YHUA 3RS7A 2RHLA 2D5AA 2ZM5A 4ISBA 2GAAA 3IUSA 4YLGA 3EUFA 1VKOA 1CZOA 2C04A 1TQ4A 2H1FA 2XCIA 5H16A 1GU1A 5BMVA 5KYGA 4W1PA 1U2PA 1DE0A 4MUEA 4HNGA 2NP7A 1R4NA 2DEUA 1R10A 2PXXA 2QMZA 2GBGA 3JD0A 3QKRA 4YQFA 2VZ8A 1LV7A 2IUSA 4X85A 2VF7A 1JMKC 4EA7A 1IYZA 4O4IF 2HO5A 2DOKA 4IHJB 4Q4JA 5AVZA 5J43A 5F7OA 1HYHA 5ALMA 3KZVA 4MKGA 4RGVA 3BGOS 4PFSA 1JB1A 2R60A 1T0UA 1Q7CA 3TVDA 4Y0NA 1ZD9A 4EB0A 1P7CA 3B89A 3WLAA 5ED4A 3S68A 1ZGZA 4Q7LA 5FTMA 2JAOA 3Q10A 3WSTA 2KE5A 1TO2E 2XLCA 4IOLA 1DDIA 1PJZA 3CTPA 2I4LA 3HKEB 4QNMA 3EH1A 2FSFA 4B48A 1NXTA 2PX8A 4Q24A 1CQWA 4CIYA 3FCUB 2E1PA 3RYFB 2I66A 3IQGX 1LVHA 3G49A 4ZMBA 4RGYA 4AJ9A 2QYOA 3KJXA 4JEMA 1HDGO 1LNQA 2PV7A 5CYPA 4A7PA 3R5SA 4TWJA 4TS9A 2RD2A 2MMCA 2WU4A 4EM6A 4Q1DA 1B3BA 2QPAA 3WGUA 2FP4A 3FF1A 5JC1A 2PE5A 3VYWA 3C16C 2ZSBA 4D81A 1L4NA 4YAEA 3AESB 3ASZA 3PF9A 5CA1A 3Q0TA 3UAVA 3JZMA 1HT1E 2P2ZA 1XA3A 1I5EA 5UKDA 1HEUA 1OIVA 2C9ZA 1X1QA 2H0AA 2HADA 2AL7A 3GEIA 2X40A 2XDQB 1ULUA 4OHVA 4GKKB 2ZT6A 3A1WA 2HYDA 5DKFA 2ZVJA 1RHJA 4CR6A 1JAXA 5JJCA 2FDXA 1JG1A 1B0ZA 4KNVA 3IIJA 3U60B 4ZQIA 3MGBA 2O7RA 2OEPA 1MGOA 2YWXA 4B1FA 2J48A 4ND3A 1DQSA 3QWBA 4R2MA 2Q2QA 2JIQA 4V0LA 5TY0A 5KREA 3P4UA 3WSVA 4QOIA 4RVHA 3VDXA 4C2BA 5H83A 4YRKA 1IG0A 3WA6A 3OVMA 2CJFA 1XTUA 1VXOA 2R47A 2WYOA 3I9KA 4HQ0A 4LN1A 4ECAA 4DUYB 3GVHA 1LK5A 2GYUA 4BDTA 2OB1A 1QCCA 4BZZA 3WZLA 1VL5A 1ZK0A 3TJZA 4RU1A 4Y2QA 3LPDA 3QU7A 5ITWA 3LT4A 1B16A 3EZNA 5KNCA 2NLOA 5AQ1A 4C08A 2D3TA 2CC2A 3F6SA 5MGBA 1QHGA 1R0XA 2JGAA 3CZQA 3M81A 3HDVA 3X1WA 4B3HA 2PZ8A 3ICOA 5G0SA 3CVUA 1CVLA 2AFRA 4CQMA 3HKDB 4E4RA 1XNQB 1AT1A 1XV5A 3KWJA 1ISRA 3QKWA 2PTHA 4RKWA 1P7VA 1NYQA 5KNBD 1IUPA 3IILA 4PZ9A 3HU1A 3S2FA 3UWDA 2B1GA 4JC5A 5FL3A 4I9UA 2ODQA 5CK4A 1XWIA 4K6GA 4ZVKA 3SR3A 1DJLA 2IHZA 3W8EA 3I9FA 1XIVA 1YZNA 2CCJA 3OWHA 1JHPA 3PGVA 2VA8A 3IMKA 3EZ7A 5C3MA 1GKKA 4HLDA 2OAGA 5HIAA 3E3AA 3CLSD 4I9HA 4M36A 4UE3S 2O1WA 5GJVC 3PFCA 4FPXA 3V8PA 5LN1A 1ESZA 3RQSA 1WSWA 4DTIA 1PR5A 5HBGA 2O23A 1UC5B 4J0KA 1AGYA 5DHUA 3V1NA 3EDMA 3MBKA 4NAVA 1OYVA 4BLTA 3W5BA 3NAGA 4MRNA 1C8LA 3BREA 3N2ZB 4U7JA 1HI9A 5IXSA 1AUPA 3KZOA 4YA6A 1TGVA 2PJDA 3DD1A 3T7CA 3O4FA 5JSQA 1SRQA 3PC4A 3LT5A 5FORA 1FBTA 1K27A 3P2EA 4GRAA 3BE8A 3EVBA 3TX2A 2AOUA 1C3VA 3OIFA 5BN4B 2O8DB 2M98A 1NBEA 3O0DA 5SICE 4JWKA 3K2BA 4KV7A 1DCMA 5CXQA 4NG4A 1G5HA 2IBTA 2BONA 5D51S 1P0IA 2Q4TA 5C1OA 3UO8B 2RAPA 2R8OA 3G1WA 3PLRA 3AB7A 1ZM3A 3FVRA 1TIBA 1U6JA 5FBHA 5JC8A 5CFMA 4A0HA 3BAFA 4R9SA 3MCZA 5B58T 3VDNB 4BMVA 1MV8A 2HA3A 4P7KA 4PC6A 3ORQA 2WRZA 2RE8A 1Z26A 2ZRPA 3F6BX 4HAYA 2VF4X 4KQMA 4OXXA 4MVJA 3ZDFA 2WWWA 2CUKA 2VJCA 2W22A 4ZODA 3QA9A 4DDHA 4O2RA 3E1SA 2G5TA 2VJMB 1VLLA 4OBEA 4FEAA 1SOMA 1Y9AA 1Z7EA 3EIEA 3DEIA 1R00A 1SKBA 4ZQHA 4D79A 4F84A 5LU8A 4M87A 2X3FA 3FROA 4DM3A 4Z2AA 3E84A 2B99A 4V1CB 4XARA 2YWDA 1I9CA 4L78A 1MJ5A 4NG5A 4JK3A 2XXJA 3I5UA 4M9ZA 3VR2D 4QYXA 4FWTA 4B44A 1SVMA 5M34A 3AETB 2B1JA 4MDHA 3O7MA 3AEQB 1Q44A 2RARA 4DV0B 3ABOB 3Q9SA 4FMDF 1MO4A 1DSSG 3RC9A 3LDUA 4GUDA 3WC4A 4L6IA 2JBWA 4MVXA 4J7CA 5EZQA 2VWHA 1IBLB 1NR5A 2YV5A 3CB4A 4EIWA 3OQNA 3GG2A 4HD8A 3DHEA 4GVPA 2Y0BA 1WCYA 4Q1EA 2ANBA 4MKHA 3WK9A 3LBAA 4ND2A 4OGKA 4JHXA 2LWIA 3AETA 2OQ2A 3JYQA 4KQIA 2F62A 5DM2A 1O0CA 1SM4A 2ROQA 4RD0A 4I4IA 5EERA 1TAUA 3F49S 3G1UA 1E9EA 2XKJE 4AJJA 1RHKA 2EJBA 2DU8A 3LDGA 1FVFA 1T3LA 3U9SA 3VHXA 5KCZA 3KAJA 4S1VA 2Y93A 2HUPA 3UQYS 5FL7A 1E6WA 1HEIA 1PTJC 1WW8A 4MEAA 1J9ZA 2NXWA 4MI9A 4X1KB 4IJUA 1P3Y1 2R1VA 1T5TA 4OL0A 1JTEA 3M6UA 2ZVPX 4KWTA 5C9ZA 5DM60 4LSGA 3QBTA 4I8DA 4PZEA 3RUAA 2YFHA 3K72B 4LTMA 1D1TA 5ARDA 1Q3TA 1HE8B 1Q3HA 1T43A 4KFUA 3SGLA 4CEHB 2EZUA 2NSHA 4MVWA 1EVQA 4WLOA 5EZYB 3ZWCA 3OQHA 4LRUA 1U1IA 3MOIA 3WDMA 4ESHA 1Q17A 1OAAA 1J24A 3EUWA 3RIXA 4XVCA 1NQUA 1WWKA 1EM8A 3Q5GA 3PQEA 4URWR 3LYAA 3QLVA 4JLAA 3SEZA 4IDDA 4D92A 3PC3A 4GAEA 5AQEA 5LOVA 1F2UA 3K71B 1JT2A 3W79A 1Y6FA 4FB5A 3TE7A 3TNFA 2EBUA 1DV2A 1Z83A 2GRUA 4TKUA 5HZMA 4P4UA 2Y1XA 4O4JB 1M2OB 3TQTA 1NLUA 1ZO8A 2B2XA 2X7HA 1R8XA 3NTVA 3PA6A 1EWKA 1TYDE 3A4NA 5B3JC 3B1XA 1KHHA 3ZQJA 1WPRA 3ONEA 4PC2A 3EHDA 1VTKA 1NG9A 3JQGB 4WSOA 2GHRA 2IKQA 3B6IA 1EQ2A 5LKRA 1AHNA 3GRFA 2NYVA 1BWSA 1TKCA 2Q1SA 4FE7A 4MKRA 1Q7TA 1T2NA 2RJ3A 2QMEA 3B6ZA 1TK2A 2IS2A 4JLSA 3A1TA 4U2DA 5F78A 1QZXA 3IE2A 2Z3VA 3IKJA 4JBIA 1BW9A 5DTQA 5JS2A 3DL7A 1RPAA 4BLPA 3L1IA 4JKIA 1LDMA 4QO8A 2VCYA 1T4DA 1ISHA 4UU1A 4GI5A 3AM5A 4XVHA 5E4YA 1B23P 1XTIA 3NFRA 2YICA 1M73E 3GLRA 4NQRA 3VTKA 3LT0A 2I78A 4IYRA 1KEUA 2IFTA 2Y77A