1HTWA

Complex of hi0065 with adp and magnesium
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MESLTQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEADILVNIDYYDDARNIELIAQTNLGKNIISAFSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HI0065
publication title Crystal structure of the YjeE protein from Haemophilus influenzae: a putative Atpase involved in cell wall synthesis
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02367 TsaE Threonylcarbamoyl adenosine biosynthesis protein TsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1htwA00
2O8EA 1KK3A 1G3MA 3AEZA 3OAAD 4Q7JB 4B3FX 1GRQA 4II7A 2BMEA 3WMGA 5EP1A 1N25A 3QIAA 1OV4A 4ZIRB 1KJZA 4PZYA 3H4MA 1ELOA 2W6JA 2QPTA 3QXSA 4C3ZA 3K70C 4OL0A 2WV9A 2QAGB 5FOWA 4KI0A 2X77A 4MGIR 1W44A 5DIFA 5KU1A 1MO6A 3K0AB 1E9BA 1ZM2A 4KAXA 1E4YA 4RFVA 2ZAOA 1L4YA 3QOFA 3AQ4A 1W5TA 3Q85A 3AVYA 1CXZA 3N2EA 3LX5A 3O47A 2IC5A 2G1KA 3LQQA 1XPUA 3GLHB 3V00A 1CRPA 5H8WA 4AKGA 1E2IA 5L3RA 1US8A 5IK2A 3T35A 2NOAA 4GDFA 3W5IA 1G3UA 5J5CA 4HAUA 3P4XA 1T3LA 3JVUA 4I1UA 3VX3A 3GPLA 1VHTA 4TYYA 3W8RA 3KKMA 2G0NA 2DWQA 1AKYA 4QM7A 3SQXA 2YV5A 3EPJA 1JEDA 1W49A 2J0VA 1H8HA 4P4UA 3LW8A 3TSZA 3W8NA 3ZVMA 4OK5A 2P3SA 4HLDA 2PZFA 1BIFA 2LCFA 2GXUA 2ECKA 1D5CA 3LBIA 3LWNA 4DVGA 5KNBA 5KDOA 2ODEA 3K8YA 3EAQA 4F93B 4CEHB 1D2NA 3VKGA 3QQ5A 1LS6A 1T5IA 3IIMA 1HTWA 1P3JA 3V9PA 3FMOB 3DDCA 3LLUA 3EG5A 4D26A 3X1YA 4A0RA 1E9SA 1SXJE 4KFUA 3OE7A 2Z5FA 2YC4C 2Z83A 2KE5A 2C9YA 2EQBA 2NGRA 3PXGA 3W34A 3CNOA 4A2WA 1P2UA 1OYYA 2J59A 2J7PA 2GAOA 4A6XA 1R5OA 3ZZ0A 5EQTA 1CS4C 1L7VC 5J4LA 1MKYA 1YKSA 3U3JA 4X8MA 1TMKA 1ANKA 2Q3FA 4WZ6A 1W0KD 1RYFA 2ORWA 3EIHA 3G82C 3MAAC 1KI7A 2FN4A 2OBNA 5AR1A 5BN5A 3HWSA 1G18A 1PJRA 3B1WA 2JLQA 3VKWA 2ZSEA 1GDDA 2IXFA 2DHRA 4NYIQ 1P7CA 1XMJA 4RZXA 2G1JA 2LKCA 4NCJA 3UMRA 3VHLB 3MJHA 4Q4LA 3TLXA 1AGRA 4JVSB 4W9MC 1II8B 5FFMA 2QG6A 3I3SR 1CR2A 2F3RA 2NZ8A 4HUQA 1OFIA 5HE8A 4I99A 2GNOA 3QF7A 2KSQA 3LAWA 2RGGA 3PVSA 1CR4A 3DL0A 5DLQC 5EJEA 5GADl 2EYUA 1I4TD 3FFAA 3LO5A 2DPXA 3TAHA 1FX0A 1Q22A 2RKOA 4ZPXA 3N5CA 2ORVA 2NO0A 4DLZA 5HCIA 4JBXA 1OIVA 1CJUC 1G8FA 2FFQA 2B6HA 1VYTA 3D7MA 4Q9HA 2XTNA 3QY0A 1PLJA 3L82B 4NMMA 3RRYA 4PPGA 5DO9A 1T0HB 3CH4B 4GPTA 4BFYA 3EPHA 3LW7A 1E1RD 1E4VA 4KVGA 1VYUA 4DDUA 1OLOA 1A2BA 4YDSA 1J70A 4Q21A 2BHRA 4V0LA 2YINC 1VCNA 3QKRB 4BRWA 1QF9A 1DG1G 2VLIA 3JZAA 4B2PA 5AK0A 5DSZA 5FPYA 1NF3A 2OFOA 5KYKA 4HLUC 4C0QC 1Z0KA 4WVFA 5SZHB 3OIVA 3EC2A 4LBVA 4MYUA 2IUUA 1G7RA 1OKKA 2W0SA 3HR8A 4G5OA 1F2UA 1GL9B 3I72A 2EFHB 1XRJA 2G77B 3GFTA 3CRVA 2CDNA 4EJSC 4OYHA 4FMBB 1E0KA 1SVIA 4DSNA 1N5JA 2YVUA 1U8ZA 1RIFA 4NYJQ 4BUJA 4CEJB 3BD9A 3AP1A 2J0SA 3I5XA 1TF5A 1G3RA 1SQ5A 2FGKA 3AVWA 1C1YA 1IHUA 2V55B 2FPMA 4D4MA 1Z6XA 2RGNC 5H1YA 2WZQA 3LLMA 2J9RA 2FF7A 4PC1A 1FQJA 2ERXA 3KL4A 4TT3A 1OXUA 1FPMA 1OKKD 2V54A 2X1VA 4B3DA 4DCNA 5JS7A 1GNQA 2QM8A 2AFHE 4M1TA 4RD0A 5FPHA 5K8IA 2IX3A 3B9QA 2WPDD 2FMXA 3ASYA 3IGFA 2VBCA 4C0HA 2FZLA 3F5FA 4A1FA 5JWRA 3P20A 2H57A 4IFEA 4EDHA 4CRWB 2F55A 4QM6A 1SVKA 4BLPA 3ZS8A 1IXZA 1P9WA 4B32A 1PVOA 2XJ9A 1G3IA 1PLLA 3LBHA 2DFTA 3NEYA 2WJHA 3PUVA 2C95A 2QMEA 1JEEA 1PLKA 4DCUA 1ZCBA 4ZI3A 5TVKA 1G4UR 3CX8A 2WJJA 3C14C 4R71A 2H17A 5CDFA 4ZCMA 3RC8A 1F2TB 1KI6B 3A4NA 3SZRA 621PA 2AD1A 2IYRA 3GLGE 1W0KA 5F3WB 1LF5A 1XEXA 1X1RA 3SDZA 2GZDA 3QG1A 4O0MA 5JJIA 1V43A 1YU9A 3BORA 1WBDA 1P73A 2J7PD 1T3HA 2C5LA 5KSOA 2GK7A 2QL6A 3F3YA 4W7SA 3GLFE 5DISB 4WOPA 2ANCA 1G3QA 4Q66C 4RJLA 2ZITA 4A0HA 3FHCB 1S1CA 4DLWA 3PV0A 2RGCA 4JL5A 3RS0A 3AVUA 1NIPA 1Z22A 2VH5R 3IHLA 2EW1A 3TSOA 1T8UA 2OAP1 3CNNA 2HT1A 1QVRA 2AK3A 2QQ0A 1UADA 1OH5A 1E0SA 4AIIA 1E3MA 1FL9A 1GKYA 4H1VA 3PCRB 3FOZA 5CLLA 2EYQA 4M9XA 821PA 1FP7A 2D06A 4BFXA 4B3GA 4NCIA 2YWFA 1Q1QA 2QSYA 3RANA 3E1SA 2I1VB 1NKTA 3GJ0A 4TTRA 1IXRC 3GQBA 2WSMA 3B7GA 3UPUA 2E87A 5AJVB 1H8EA 2GVZC 4M9SA 4KXFB 4KFSA 1F60A 1HT1E 1SVSA 4HUQB 4P32A 4PANA 3CR7A 1TEVA 1E2JA 4G5SA 5JEDA 2OCBA 1WB9A 2GHIA 2OBMA 2OSBA 5FUYA 3FMPB 3WYAA 4JBWA 1JALA 4MKFA 1VG1A 4MA4A 1YR7A 5B64A 5EUQB 2WWFA 3IEVA 2XNSA 2GCOB 2WWYA 4TLEA 1XU4A 4IVPA 1KY3A 4ZIRA 2NMVA 1XZPA 4IEEA 3U2QA 4D25A 3MWLA 2VPPA 2JLSA 3ZZUA 4B6EA 5H70A 4MRNA 4LJ6A 4XWKA 2ZRKA 3CH5A 4L15A 4PSVA 3RRNA 4HB2A 4URVR 3X1XA 1TPZA 1IAQA 2KB0A 4IDPA 1GTVA 4OJQA 5JJLA 2WWWA 5D3MA 1BYIA 1ODFA 5J4KA 4ARZA 3L0OA 2GBLC 2TMKA 3U7GA 1CRQA 3OEHD 2HCJB 1TADA 4JVLA 4N0EA 3CUEF 3NHBA 2WVJA 2GWHA 1S4QA 4XD7D 5HPYB 1RRPA 1KI1A 2FEOA 3SJCA 4OQLA 1TUEA 1Z0JA 2DY1A 1E1QA 5JFGA 2ZM5A 4WZBE 1AK2A 4MDFA 3T61A 1HQYE 2F7SA 4IDNA 2LWIA 1E2PA 1KDOA 4P31A 5FBRB 1ONBA 1M7BA 3K9LA 5CJ2A 5FH9A 4XIGS 5TB5A 3TW8B 5FL7A 2AX4A 3BH6A 3KXIA 1Z6TA 2CE2X 1J99A 3VR6A 1KSGA 1DBSA 1VIAA 5JJKA 2W6JD 3D31A 1NKSA 2F1HA 1CLUA 5DNYB 1I2MA 4BFVA 4EQ6A 4LOAA 3WMEA 1Q3TA 1DAGA 2ONKA 3QJYA 4LPKA 2JDIA 1Z06A 4UKDA 1G6HA 1Q0UA 3ZIAA 2QT0A 1XD2B 4B33A 5D3QA 1ZUHA 4JVMA 4HI0E 4HB3A 5CB8A 2ZSAA 2R6DA 3H0KA 1NJGA 3X1ZA 1NSTA 1N0UA 4OKSA 2GRJA 3SU8A 1JQJC 2VQSA 5KHOC 1LTQA 4MDEA 5KNCA 1E0AA 4CDGA 1R4AA 5GJWC 1XTIA 2C03A 4ZDWA 2BEJA 4RVCA 5SZKB 4Q1FA 2IYTA 1LW7A 1ZVQA 2MSEB 1U9IC 3J81k 2FFHA 3EPLA 4PAQA 1V5WA 2UZ3A 2ZJBA 1GSIA 2RGEA 2ODWA 5FL3A 2QMHA 1UF9A 3WY9A 1ESMA 5AUQA 5EZ6B 2VF7A 4BFZA 1OH8A 1E1RA 4JYCA 4QGGA 4AYTA 1YR8A 1PV4A 1ZD1A 4PC2A 1S9HA 1A7JA 4C7OB 2JJ1D 1Q3HA 3PEVA 3NVAA 3SEAA 2PJRA 2A7QA 1Y63A 1GL7A 2CHVA 2JIZD 2DWOA 4Q1AA 3GFPA 4OBEA 1DS6A 1OFHA 3F8TA 3QXHA 4EIWA 2WJGA 1ZNYA 4DCSA 1R0ZA 5LB2A 4B2LA 2IF0A 2JASA 4HDOB 4A8JB 2ODNA 2X2EA 1IN7A 1I4DD 3TUIC 5B58C 2YWGA 1IY2A 3OF5A 3P4YA 1DAKA 3I8XA 2ONJA 4AK9A 5JRZA 5EE1A 2JLUA 1Z08A 2REOA 1YZQA 1VMAA 4DUGA 2NPFA 1XP8A 3VKHA 3IO3A 3U3KA 3U7EB 3M0EA 1E9FA 4CT5A 3QF4A 4URXR 1Q20A 2EFCB 1N6LA 4LJYA 3SC3A 1S3SA 4DIEA 1VECA 1XDBA 4PHHA 2KBEA 1FMLA 4O2RA 1E2MA 4NYJR 1XTQA 5E7MA 1D2MA 2IYWA 2YZ2A 1Q12A 3UMSA 5HE9A 1KKMA 1WMSA 221PA 4YDHB 1RJ9A 2GCPA 2IWRA 1P2VA 1QG4A 1W4RA 4EPYA 4A8JC 3SHWA 2ZREA 4FIDA 2XZLA 1ZM9A 1KMQA 3EZFA 1RVDA 1HYQA 1OFTA 2WJYA 4G0NA 4HUTA 4ZO4A 3I61A 3BOSA 3B2EA 1A2KC 1T3SA 2JATA 3C15C 4PZZA 3TW4A 4A92A 1S1MA 2ZQ5A 1XEXB 3I8SA 4RY2A 2QBYA 2CL0X 2RHDA 3B5JA 1N2CE 1SXJC 5D3MB 1QDEA 4IVQA 4M53A 4B3XA 3K70D 3QXCA 2PBRA 3QI2A 4C0KA 2P6RA 2V6IA 4JKYA 1KJWA 4QGAA 1YR6A 2R6AA 3NBYC 4GMXA 2WSSA 3RSLA 2NTYC 2BEKA 3GJ5A 2AWOA 1UKZA 3U6KA 5EE0A 4M0LA 4E5UA 2FSFA 3U44A 4BPBA 1IN4A 3PENA 4NE2A 5AUNB 4TZ6A 1SKYE 2QRZA 4QBHA 1ZBDA 5FOTA 1P2TA 4TMZA 3DHWC 1P75A 1OHHA 3THYB 3TQFA 5JHGB 2Q21A 4E03A 2OM2A 1WP9A 2F6RA 3L0IB 1IY1A 2ZEJA 1RYHA 3A58B 5K8TA 5F9HA 3VHXA 4D2IA 4IXNA 1TEXA 1QHIA 3C4JA 1W2HA 4XWOA 4JVNA 4LI0A 3MRSA 2R8RA 5EXTA 4HLCA 5L3SB 1K6MA 5FOSA 4G01B 3UWOA 3ZDQA 3TNFA 3KQHA 5G40A 2ODBA 2BBWA 2XSZD 4NKRA 3WMFA 2ZE7A 3FHOA 1JJ7A 5DGXA 2FEMA 3RHFA 2GESA 4HZIA 1Q1ZA 4OHWA 5FI0B 1UBFA 3K70B 1A1VA 5GVRA 1FQKA 4QKQA 3U3OA 5LDDC 4X8LA 1N5LA 4WXPA 1KO1A 1T9HA 4KLNA 1VYVA 3IEUA 5IF9A 3K53A 4M21A 3NG1A 3LNCA 1LFDB 1NRJB 4J0QA 3RVBA 4DLSA 5FBQB 1K5DA 1OH6A 2O8BB 4BFUA 1T0JB 3BC1A 4LV8B 4KITB 1DAFA 4F4JA 1CEEA 2YWHA 2O0HA 3WP0A 4W5HA 5UKDA 4A6PA 4FWTA 2HLDD 3BFVA 4JLVA 1OIWA 2BJVA 4E07A 2D4HA 3QKSB 1MO3A 2O8FA 1VG0B 3BB1A 2QMOA 4AYXA 5DH9A 5FTLA 5GJBA 1EG7A 4RD6A 2JLVA 3A4LA 3RDPA 1XPOA 3CRMA 1DARA 4V0ME 2P6UA 3I62A 2BBTA 3MWKA 1E2NA 2ZR0A 3WRYC 3MJRA 1TQ2A 2H92A 5CM9C 4GT1A 2I4IA 1W47A 4IRUB 1XXHE 3TR5A 1IN8A 1XEWX 2IYXA 3GLIA 4G1UC 1OPXA 3QUSA 4Q19A 1ZM3A 1NJFA 1DTSA 1KI2A 4DDVA 1N6NA 2B8WA 2PX0A 5AUOB 3GJ4A 4I1OA 4XOIA 4TMTA 4AG5A 5C4MA 3AP2A 1ZJ6A 4PQYA 4JZKA 3ZVLA 1Z6AA 4Q9IA 1T5LA 4L16A 4ARZB 2IBMA 4IKEA 4L4UA 2QSZA 4EJSB 4Q9KA 2WMNB 5CITA 3L8YA 1GZSA 1Z0IA 4LBZA 3UANA 2V1UA 4AI6A 3O8BA 3WNDA 1IOZA 3R8CA 3D8BA 5L3SA 3AP3A 1UKYA 4POAA 4JYBA 1FZQA 4Q4AB 4RD3A 5M04A 4NYIR 4H9GA 4TMXA 2WSSD 4Q9LA 3GJ6A 1IY0A 2W2XA 5FTMA 3K09A 3OIUA 4OI4A 5AJWA 2H8KA 3C16C 4Q47A 3KKPA 2ZYVX 3KFXA 1CJKC 3AVQA 5C4GB 4OQXA 4C0AC 4IOMA 3R7WA 4B2IA 3LFUA 3MWJA 4A15A 2C2HA 2F1RA 4R9UC 2WHXA 1H65A 3MLEA 2V6JA 1CULC 1J7KA 2AWNA 1OXTA 1NVUQ 2FJUA 2JAQA 1W4BA 5LB4A 2AK2A 1NI3A 3A1WA 3R8FA 3VNVA 3SR0A 3LVRE 4XTRA 2QENA 2IXEA 4DXAA 3L0PA 1M2OB 3MSXA 3KFVA 3TUJC 3U3MA 1MR3F 1YJ5A 4TQ9A 3KB1A 1EXMA 5EP3A 4DC9A 2A9KA 3DOFA 1Q57A 4C4PA 4KJZA 4MKHA 5FUWA 4MKGA 3GEHA 3PUWA 4LYFA 4Q00A 4DT1A 2VP0A 1KY2A 2J87A 2A5FA 2ZSFA 1E9EA 1Z0FA 4PO8A 2BMDA 1HQCA 2ZI3A 4YC7A 3TJZA 3X1WA 2IL1A 1TAGA 4JJKA 5ELXA 2WKRA 4RSGA 3KKQA 1ZIOA 2WKQA 3GLIB 2Z4SA 2QNRA 3NEJA 1JR3D 2EVWX 5KPDA 4JLJA 1K5GA 2ZI4A 4IVRA 3EPKA 4FD2A 5JCPA 3TSWA 3HYRA 2QN6A 1GNPA 2PH1A 2IUTA 1LV7A 4QOSA 5CK4A 3WYFA 1RFLA 5FOUA 1N0WA 2O8EB 1G8PA 3HU3A 4M2LA 3QSYA 4FCTA 1R10A 2W0MA 1E9DA 3T34A 1E2QA 2V4ZA 3U4QB 4AY2A 2IYSA 4X8HA 2QAGA 1IONA 1PZNA 2W2VA 4HAWA 3C8UA 1D9XA 1NY5A 1F48A 4Z8YA 4Q1DA 2GVDC 2OESA 2VSXA 3K0AA 3QXXA 3RABA 2ZJ2A 1GRRA 1DG3A 4G5RA 1SVLA 3VAAA 1W36C 1M7GA 1CP2A 2IS4A 1TF2A 2FG5A 4JIMA 1Z63A 1Z0DA 2IYVA 2ZRNA 4Q7LA 1G4AE 4DZZA 1XB2A 2J46A 4LK2A 3R7WB 4RZUA 1KDTA 2JGNA 2BOVA 4OHVA 2DWPA 4LYJA 4DLVA 2HT6A 3SBDA 1E69A 2EWVA 1X86B 4KCGA 1HUQA 2WICA 1QHYA 4C0BA 1UDWA 3HP1A 3B1VA 3Q7PA 4DLUA 2JLZA 4PHFA 1NN0A 1YZLA 4YMTA 2VIIA 4WXRA 1XEFA 2IHBA 4Z1MD 3AVXA 1IN6A 3THYA 2QTVB 4URWR 2AFIE 2X19A 5A0FA 4PR0A 2YOFA 1IN5A 3KJHA 4V03A 3A4MA 3QPVA 4TSFD 5C18A 4GOJA 3U60B 3SNHA 2IEZA 4UNSA 2H5EA 1MRSA 2NZJA 1WF3A 3EIQA 3IHWA 5FPSA 2B92A 4C30A 3ZJYA 2DFNA 3CLVA 3OEEA 5HZHA 4GP6A 1AQYA 1UEIA 1XCMA 1M1YE 1X8LA 2VA8A 1R2QA 3FB4A 2JLYA 2RHMA 2GF9A 4OQFA 4RCYA 3H84A 4JSYA 2PZEA 1M34E 1D6JA 1DEKA 3TH5A 3FVQA 2HLDA 3ICEA 5KTYA 2P0EA 3W9YA 2IS2A 4BLOA 4HB4A 4B73A 3PUYA 3T06B 2JLWA 2ZRCA 3TR0A 4ACAA 4LC1A 4HDCA 4PSKA 3BXZA 5JLJA 4GI7A 3NIBA 2PL3A 1Q21A 5CM8B 1XTKA 3BBPA 3BGWA 2B21A 1OHHD 5K8LA 5CJPA 4TQUS 2NQ2C 1E2LA 2O8BA 1P6XA 1CTQA 3EA5A 4XSHA 3KXKA 2J0UB 4AYWA 5J4YA 1ZNXA 4OHYA 3O8CA 3REFA 2WJVA 1RE0A 2XOKA 2W2TA 2X2FA 3QEOA 4LHVA 2PCLA 2Q3MA 2H18A 1NSFA 3B1ZA 2PEYA 2ZIAA 4Q1CA 1R0XA 4QG7A 1SXJA 4Q4HB 3Q3JB 4QNRA 1NLZA 1KOFA 3AVOA 3EZ7A 2ZVPX 3CZPA 3CONA 4KBGA 2Q9CA 1WE2A 2ZS7A 1NIJA 1R0YA 4TLDA 2ZRJA 4BEJA 2WIBA 2BMJA 2QMUA 5IRCD 3AKDA 2G6BA 1W4AA 1EWRA 3BB4A 4GNKA 3TQCA 2GXQA 4D6PA 1AKEA 2C98A 3CM0A 4TYPA 3SFZA 2FOLA 3GLGA 3CB4A 4LHWA 2B7CA 4V02A 2O0KA 3MG9A 1UAAA 4TYNA 1MO5A 1GAJA 4MRRA 2QAJA 5A5GA 2JJ8A 2G88A 2HF8A 4LV5B 4LHXA 2C8VA 3SJBA 1YRAA 3QPWA 3RRMA 1F2UB 1M7HA 4Q1BA 3MD0A 1PUIA 2OLJA 5BW8A 4BEBA 2N42A 1NN1A 1J90A 3LV8A 3P1JA 4W5WA 4ZDIA 2ZS8A 4BZQA 4BFTA 3QF4B 2FE4A 1JQLB 1NMXA 3A1TA 3KUDA 2C99A 3OHMA 3VR3A 3KQUA 1N5IA 2CMKA 2GCNA 3EW9A 3CPHA 3QG5A 3LVQE 3Q9LA 1TUIA 5L3QB 1EX6A 4C2TA 5JZVA 1OB2A 3AVTA 1N6PA 4TMKA 1Z47A 1JPNA 2VRWA 3VR5A 4QHSA 3THXA 1HY3A 1R8SA 3C41J 3EZ9A 3CKLA 3H86A 3NXSA 4IEIA 3PEUA 4JL8A 5FTNA 3ZZTA 2IXGA 1O87A 2I1QA 2ZPTX 5E95A 1W0JA 4X8OA 1JECA 2NO1A 3E5HA 1G291 1M6NA 4N0DA 4DB2A 1VCIA 3QVVA 3NBFA 4LJ9A 3EWAA 1A5TA 1Q1BA 3THWA 4HDQB 1X3SA 4KLZA 2L0XA 3A1UA 4AWXA 4P4SB 3RWMB 5JBQA 2CLCX 2XNDA 4RFSB 1TQDA 4NH0A 1DELA 2QGNA 2OV2A 1HE8B 1HH4A 4CW7A 2O8CB 3BJIC 4D4JA 3K0SA 4ZKDA 1KK2A 4DDTA 3SJZA 1ZNWA 1E99A 1MO4A 1R6BX 2OCPA 2GTPA 3UG7A 3ADBA 3CR8A 2FV8A 1D2EA 3BFKA 4TL9A 3CNLA 1U99A 1CKEA 4IOKA 3U5ZB 3ZIAD 1FTNA 1W7AA 3GCGA 3M6AA 2GJAA 1OIXA 2JDID 2WTUA 5ANRB 3ZQ6A 3PR1A 4LX0A 3SI7A 3LA6A 1ZMXA 1COWD 1JAHA 3KUCA 1KO7A 4A2PA 2ZJYA 2F43B 2D2EA 3O8DA 2WWIA 2ZU0C 2DCUA 2FSIA 4EPXA 2HJGA 4FXPA 5JSZB 2GZHA 3CRW1 4A36A 1ZRHA 4TQAA 2YHSA 1KI8A 3AGQA 3MWYW 2G83A 4DJTA 3SE0A 2R6GA 1E1QD 2H1LA 2ZETA 4KSCA 3TMKA 3ZVRA 4JLMA 5AJZA 1G41A 4XD7A 5SZIA 5FR1A 1OH7A 1CF4A 4QGHA 2R44A 5C46F 1VDZA 3IPXA 1ZIPA 2ZR9A 4DEYA 4ZDKA 4KV9A 4PPQA 3ND9A 3W3ZB 1OXVA 5TY0A 2HV8A 1P2SA 2P5TB 3PITA 1W48A 5F9FA 2GEVA 4Q4HA 2G3YA 1ZYUA 4MH0R 4XVUA 4PSAA 2J0QA 2I3BA 1XZQA 1DAHA 2HXSA 2NPIA 4XJXA 4M1SA 4RZ2A 2REBA 1MH1A 3DPUA 1UBGA 5FTJA 4FMCB 3AF1A 2CCGA 5EXPA 8OHMA 1GWNA 3LBNA 2WM9B 2ZE8A 2GEDA 1X8JA 1JB1A 4D0LB 4HEJA 4NZYA 5KDDA 1NVWQ 2XITA 3UKDA 5HZKA 3HPRA 4KVAA 2QT1A 1E79A 2ATVA 4HLQB 4IFBA 5JWHA 3WXMA 2FSHA 4ACBA 1CJMA 1U0LA 2Z6VA 1U8YA 2Z43A 3L2OB 3QKUA 3CO5A 4DKXA 4E09A 3ZYCA 4O25A 4ASUD 4UJ3A 1ZNZA 3G5UA 1KNQA 5HR5A 2X8AA 5BYJA 2P6NA 421PA 4M8NE 2GK6A 2CE7A 1NVXQ 3JVVA 4AKEA 1R7RA 2OHFA 3OE7D 4C2UA 2EFGA 4LJAA 1S0UA 1XNJA 3KB2A 4DLYA 2QQEA 3THWB 2Q9AA 3GEIA 4LJ8A 1O3YA 2QPAA 3ECCA 4LZZA 2Z0MA 2ZRLA 2C77A 3NKVA 1XPRA 3I4LA 1AS2A 1E2EA 4JLAA 3NH6A 4C9BA 2ZAMA 5L3QA 1Z29A 1TNDA 2YC2C 3RYTC 2FDCA 1B0UA 5AWFC 2ZJAA 3L0SA 2J45A 3UXMA 4TWZA 1WXQA 1XCPA 2PZGA 1J8YF 3CX7A 1H8HD 4I81A 1BKDR 1DE0A 2F9LA 2P67A 4TL6A 2OAQ1 2IW3A 1KKLA 2CL7X 1LF0A 1EFRD 4WA7A 2ZI5A 3SYKA 2AN9A 4K81B 1DAIA 4NTZA 4M1MA 3Q72A 1U0JA 2BV3A 2VHUA 1YQTA 3RSOA 4CVNA 1U98A 1ZM7A 1ZM4A 3WBJA 1II9A 4P4TA 4DLTA 1GP2A 3X1DA 3TK1A 2IWHA 1Z6GA 3A37A 3GJXC 5IK2D 1NMZA 4PPNA 2O0JA 2WJIA 5E7JA 2OT3B 4UXIA 3TAUA 4TMWA 5A4JA 1E79D 1MABA 2WWXA 1D9ZA 2ZI6A 3MMPA 4JJZA 3IQXA 2A5GA 2A78A 5DN6D 3W90A 4Q03A 2IS6A 5B2ZA 4LJ5A 5E3HA 1Z6YA 1PUJA 1DVRA 1E96A 2O8DA 3RS2A 4US0R 3RLFA 3X2SA 1S96A 1XMSA 3T5GA 4RD2A 2ZYUX 4F4IA 3BWDD 5JECA 4C7OA 2IA5A 3EZ6A 1E0JA 3GD7A 3ASZA 1JBKA 1G8YA 2R2AA 3FKSA 3IO5A 2GZAA 3RWOA 3VR2A 4LHYA 1EWQA 4XVQA 3OAAA 2FSGA 1W4CA 2GCOA 4MGKR 1ZUNB 4A2QA 4QJ5A 4TT3D 4R2HA 2QORA 4BFWA 3GJ8A 1WRBA 4PO9A 1XTSA 4M4SA 2FZ4A 3QPUA 1GVNB 1NNEA 4H1UA 2JLXA 1N6IA 4KFTA 2FPLA 4YONB 5FBWB 1UM8A 3ZD7A 1AN0A 2QZ4A 4QHTA 2BJWA 2WOJA 1W46A 2WMOB 1RJ9B 2ZUBA 5EXXA 1QHHA 3UK6A 5KSZA 4JBYA 5JSZA 4I4LA 1QBKC 1FUKA 4TYQA 1YE8A 4JSTA 3ONWA 3FPAA 2JJ2D 1E2FA 2OZEA 1W36D 5JMTA 2CL6X 3I1FA 4DB4A 4NP6A 4M9ZA 2JCSA 3FYHA 4IJMA 3REGA 3TBKA 2QBYB 3ICQB 2AR7A 4Y0VA 4S2EA 1CJVC 3NBXX 5FBLB 1RRCA 5JRJA 1US8B 1N6OA 1R0WA 3DVLA 1DO2A 2RB4A 3CW2A 4YLGA 4WIAA 5DHFA 1VG8A 4BLRA 1TTTA 2KI5A 4HAZA 3QXJA 2CEAA 2J5XA 3NDPA 4TLCA 4IOLA 1Z28A 4UNNA 2AD5A 5DI3A 3A1SA 2VYFA 1XFAA 4BE7B 2XTZA 4OHXA 1LNZA 4M1KA 1LS1A 5BQ5A 4URZR 4JKIA 1XWIA 1YZKA 1XMVA 1AZSC 4YMSA 4EPWA 3KJIA 1D8TA 1G64A 2A5YB 1MABB 1DOAA 1JPJA 3BB3A 2AXPA 1FFHA 3EXAA 3TGPA 3BFXA 1KI3A 2PEZA 4TZ0A 2ZE5A 3HDTA 5DE3A 6Q21A 3U61B 1OJLA 1W0JD 1ESNA 1VCMA 1Z83A 5IDVA 4ZI2A 4QGFA 4JLDA 4FN5A 1BS1A 5G41A 2QA5A 1S9DA 2ZUDA 3B85A 4ILEA 3GLIE 3T1TA 4QXAA 3SOPA 2XXAA 1X1SA 1KZGB 1MT0A 4IDOA 4XH9B 1SVWA 1IM2A 2RGXA 4NHOA 3SS8A 3U7FB 3RS4A 2ZTSA 4UNRA 2ZI7A 1NBME 1EFRA 3EC1A 3M1IA 5F2EA 3W5JA 4UNQA 1NVVQ 2RGAA 1KZ7B 4OHZA 1DO0A 2QTFA 3IUYA 3SYNA 4BWYA 2J7KA 3W6PA 1AIPA 2YNMA 1SVOA 5E4FA 2OUKA 1VG9B 2O8FB 1N6RA 3FTQA 4HAVA 1E94E 3BH7A 4DCVA 2PT5A 5K8UA 1NG1A 2PJZA 3R9XA 4LSGA 4BZPA 5TV2A 5L3VA 2EFDB 4WW0A 4B76A 1UKEA 4HSEA 4EAQA 4OI2A 3W6OA 2IYQA 1U9IA 1FUUA 1H8ED 1IBRA 2BC9A 4RKEA 1AA9A 2XZOA 4NCHA 4EPRA 2D62A 4KU4A 1FNNA 3ADCA 3LDAA 2DFLA 3U4QA 2ZS9A 5DHAA 2PT7A 2QPOA 1ZU4A 1XEWY 4FMDB 4E22A 1J8MF 3TUZC 1G20E 5FPTA 3Q8XB 1E2KA 5HTKA 3KKNA 4NU0A 3WRXC 2HEIA 4FCWA 4PHTA 1AJEA 1KK1A 1X8KA 2VTKA 4M1OA 3ND8A 2ZRDA 5KSPA 3PEWA 3K09C 3CWQA 4Q48A 1GOTA 4LGMA 3RS7A 2H16A 4R2IA 4D4KA 2VF8A 3NTUA 1JI0A 2IUSA 4Z54A 2MSCB 3IIKA 3K0CA 3LX8A 4B3BA 3Q5EA 1G16A 3C5HA 2J1LA 4PFSA 4FMCF 4GOXA 1JAIA 1C9KA 1NL3A 2ZE6A 3ZLJA 4LPSA 5C2JB 3AF3A 1OYWA 4CEIB 2CCKA 1T91A 3JZMA 4CF7A 4ASUA 3B6EA 4HLUA 3A8TA 3ADKA 4HAXA 4AG6A 3KTAB 4BFSA 1CU1A 3F0TA 4ITRC 4B44A 3IBYA 3QVUA 1F3OA 4CZ2A 1P61B 2NG1A 4HATA 4L9WA 3S1AA 1N6KA 4JLPA 1N6HA 3RNLA 2DR3A 1CJTC 3K9HA 2GKSA 2GJKA 2HF9A 4IXMA 2VO1A 2V3CC 3QNUA 4MQBA 4IHQA 4M9QA 1EESA 2EFEB 4NPHA 2N1BA 1G17A 2XTMA 4B3CA 2C96A 2Q6TA 2WPDA 2GETA 2D2FA 3EX7C 1GITA 4LJ7A 521PA 3I92A 1YZNA 2CNWA 2Y8EA 4D4LA 4LJ4A 4MGZR 4UQOA 5DYGA 1G9XA 3TE6A 4TSFA 2QUZA 4KYUA 1KMHB 2XAUA 4BASA 1HE1C 4KSBA 1OB5A 1QHNA 1AM4D 4G5QA 3AKYA 1P9NA 2CHGA 3DKPA 4PO1A 2ZRFA 4TL7A 5E7IA 4D82A 3E2IA 3NWJA 721PA 2KWIA 3SBEA 3D3QA 4NDZA 4UJ5A 4Z1MA 5LD2C 1P4SA 1GILA 4Q4JA 4EFLA 1E6CA 2OCYC 3PUZA 5LD2B 2HYIC 2IF2A 4P4SA 3FKQA 1CBUA 3AUYA 4Q02A 2HCBA 2VEDA 1WA5A 2QAGC 5CYOA 2PMDA 2UKDA 2BDTA 1W2GA 3AGPA 2CK3A 2EWWA 2R65A 4S35A 1NBMA 3GEEA 4RCZA 4NBSA 3I73A 3CF0A 5FR2A 5TMPA 1NLFA 1QRAA 2XGJA 1OF1A 4ESHA 1COWA 1KAGA 2ANBA 3HYTA 4FI3C 2JJ2A 2YOGA 1Z2CA 3VFDA 1SHZA 4PQFA 3CBQA 3U3RA 3QKSA 4U5XA 1UKVY 4LBYA 4MUBA 1N5KA 1ZD8A 2Q0HA 3G0HA 3SFVA 3H2YA 3WBKA 1AGPA 1G19A 1YZUA 2OBLA 2OXCA 4K8OA 4U00A 4O2LA 3FHTA 1KTVA 4MRVA 3AV0B 1ZC3A 4PC3A 1KJYA 1WCV1 2YYZA 5KNDA 4GL2A 5F98A 3T1QA 4TTPA 5KSYA 4ZDJA 2ZUCA 5FTKA 2QP4A 4B48A 2W6IA 2ERYA 3FKSD 4PZLA 2B8TA 1P5ZB 1RRFA 3NHAA 1G8HA 5CIWA 1VHLA 2CHQA 4DLXA 1VIYA 2GEUA 3VU9A 1KNXA 3S1AB 3R9IA 3AF2A 4C0JA 4PXAA 4B6FA 2LKDA 1OXSC 2F1IA 4B43A 4L5BA 2GAAA 2R6FA 1EFHA 2SHKA 2IK8A 4ESVA 2XX3A 1UPTA 3P27A 4EFMA 2O5VA 4B35A 5AJXA 1T4GA 5DN6A 4M1WA 3AVVA 2GJ9A 1TF7A 4B34A 2IYZA 1E2DA 2ASEA 1HV8A 4B47A 1MOZA 1ZP6A 2E1RA 4US1R 1Q1EA 2HUPA 2P5SA 1KDRA 4IW3B 1W36B 5JCZA 1EFTA 3B1XA 5KUTA 3FE2A 1G8GA 3QENA 3GP8A 1NVVR 2DFKB 2IYYA 4ON9A 4P33A 1G5RA 4C0LA 1G1MA 4XVRA 4DRZA 1E2GA 1KHTA 4Q18A 1X6VA 2D7DA 1CR1A 1XD8A 2WAYA 1UJ2A 4KHZA 3C5CA 4QNMA 4BLSA 4TN1A 1WBBA 2N46A 3FFBA 3OFND 3SYLA 1ZCAA 5LBIA 1EX7A 3V4FA 1FMJA 2A30A 1R5BA 2CLDX 3VMFA 5KO2A 3QE0A 1SKQA 1JR6A 2IEYA 4TLAA 4M1YA 4EJSA 4GFDA 3QBTA 1RPZA 1Z3IX 2R9VA 4DLRA 1ZW6A 2VSFA 4JT4A 3HU1A 4NONA 1YRBA 4LYAA 4D0NA 2YJTD 4P3YA 1IXSB 5IT5A 2MMCA 3HR7A 4G3XA 1DADA 2W00A 4B71A 2ZRPA 5TXGA 1OE0A 2ATXA 2XOKD 2DYKA 5B30A 3RC3A 1S2MA 4IDHA 4N1AA 4FINA 5HKKA 2CJWB 3B82A 1BMFD 1NN5A 1P9RA 3GLHE 3WHLA 1UBEA 3AM1A 2ORIA 2OEPA 2QRNA 2AHOA 5BYKA 2FA9A 4PTLA 3BE4A 4MITA 4OI0A 2KBFA 1GFIA 3Q5DA 4PAMA 5BXQC 1KI4A 2FH5B 2PMKA 2ZRGA 2QE7A 4BGDA 2XXAB 1L8QA 4Z8XA 5KPJA 2Q3HA 2JLRA 5FBVB 1E2HA 2K5UA 4D81A 1W5SA 1KAOA 3CZQA 3T1OA 3I5YA 3W6NA 1KO4A 3BAFA 2OXRA 1L4UA 1U8AA 2F3TA 3KJEA 5G53C 1SHKA 4BECA 5B57C 3ZH9B 1KGDA 2FFAA 1QHGA 2GF0A 3IQWA 1VCOA 4DDWA 1Z8FA 2PCJA 3OIYA 1E9AA 2GJ8A 4OK6A 3TIFA 1RKBA 4TMVA 1SXJB 3CRRA 4OJKA 1F2TA 2GDJA 2NO9A 1HURA 3PUXA 4UXHA 5DI9A 3CIOA 4QFMA 1TQ6A 5FUXA 2ZRAA 4NCKA 4QL3A 4KO8A 2ZRMA 2XB2A 4QJ4A 2VP5A 2BKEA 4YXWA 1VTKA 2IT1A 1E9RA 3DO6A 2BM1A 5CDFE 1L2TA 5J47A 4KODA 2QI9C 5J40A 1Y3AA 4K46A 3VR4A 3B9PA 4F7WA 1VKJA 2UVQA 4LWZA 2Z4RA 1TX4B 4LC0A 2UZIR 1Z2AA 4DSUA 2YWEA 5AJYA 3RRZA 3B60A 3C7KA 3D6TB 4JLOA 2VL7A 2W83A 2VSOA 1KSFX 3FGNA 3OEED 2ZYWX 3AVPA 1J2JA 3GLFA 3DM5A 2OILA 3GMTA 1KSHA 3LXXA 4HYYA 2QP3A 1IJFA 1LB1B 1QG2A 2HJVA 1HEIA 3KZ1E 4QHYA 3A36A 3EA0A 2HXYA 1P72A 2VP6A 1JXMA 1GRNA 3VR1A 3CPJB 5EE5B 2RH5A 4ZCLA 1WQ1R 4URUR 1QHHB 3VU9B 1QZXA 3VQTA 4BRUA 1XTJA 4CEIA 4LRWA 1G7CA 3LXRA 2REXB 1B23P 2CLSA 3K0CC 4ZV4A 4PQRA 1AS0A 4V0MA 1OW3B 2A5DA 3DZ8A 4AD8A 2D7CA 2A3RA 3UATA 4O3MA 2BBOA 3U6BA 1Z0AA 3DM9B 2XNDD 3OZXA 3KTAA 4D0GA 2PX3A 4OI1A 3UIEA 3AB3A 2BVNA 2QGZA 5CYPA 3BERA 1E32A 4JT2A 4RKFA 4I1SA 4CIDA 4DCTA 2NO7A 4ERNA 2QROA 1NLYA 4P0TA 2BKUA 3CX6A 4R98A 4CEJA 3MCAA 1GM5A 3DZDA 1G21E 5L8VA 3R20A 2OE2A 2VHCA 4F91B 3KXLA 2B7BA 5HKKD 3UWKA 1LVGA 3ZS9A 4B75A 3QKTA 1Z07A 2QY9A 2ZJ8A 3ZQJA 5JWOA 2C04A 1TU3A 1TL7C 2BM0A 3EIEA 5AUPB 1WDTA 2PLRA 2V1XA 4EQ6B 5JI2E 2ZSBA 3TRFA 5EUMA 3BH0A 1EFUA 2QM7A 3THOA 2O52A 4TLBA 1NY6A 4RD1A 2G9NA 4ABYA 4RFSA 2ZRIA 4MYCA 4TTQA 2FX3A 5G3ZA 5J4VA 5EP2A 3ETLA 4G5GA 2YKGA 4PPFA 2WKPA 5EE3A 4GZMA 2IS1A 1NMYA 3IPYA 4Q4JB 2ZVQX 3OFNA 1F5NA 5FOVA 4BLTA 3RS5A 4U7DA 1GNRA 2FPKA 2BCJQ 4CT4B 3MUFA 3I32A 5H68A 2C9OA 1R8QA 4JL6A 3U44B 4RD4A 1UEJA 1KK0A 2WAXA 3NC1C 4GP7A 4Q01A 4OQMA 1ZU5A 1XJQA 4QRHA 3K9NA 4NCNA 2MMGA 1OSNA 3WNCA 4QBIA 3V4RA 3K1JA 4EPVA 1JJVA 4LBWA 3CWZA 4EFNA 2QU8A 5J4HA 4GRAA 3GLGB 2P65A 1NG9A 1AZTA 3Q7QA 2QEQA 2F9MA 1CR0A 1YZTA 3E70C 2E9SA 3B13B 3A6PC 1RRGA 2FFBA 5BN4A 2V7QA 3ZGXA 2KJQA 3GLFB 3IDQA 1HA3A 3W3AA 1YVDA 4JLNA 4MRPA 4WBSA 1SXJD 5CLQA 3QKRA 3GLHA 3T15A 4HZUA 2VHTA 4A0GA 4NYMQ 2NIPA 3VTKA 1XJ0A 1DPFA 5CK5A 1F6BA 2AXNA 3FMFA 4QBGB 1KI9A 4AKHA 2R6CA 1C4OA 4FCVA 2BCGY 3NBZC 4TL8A 2EU8A 1UDXA 4I1VA 1ZUIA 1II0A 1JNYA 4Q4AA 3NDBB 2RCNA 5KDLA 3B8HA 2OFWA 5BWMA 2WIAA 1BOFA 2ZXUA 3LD9A 1A4RA 2VHJA 3KQLA 3BIFA 3QBVA 4AKIA 5DI3B 1K8RA 4LUCA 1KO8A 2VHQA 1I2DA 3FMIA 3SHFA 4DEXA 4LY6A 2C9CA 3P26A 4NYMR 1S8FA 2FU5C 1FP6A 5BN3A 4JLBA 2VP2A 4L9SA 5EXSA 3LY5A 2AKAB 3WHKA 3GFOA 2BBSA 4IDQA 3K0FA 4YMUA 4A0FA 4MRSA 2R62A 3DEFA 3SJAA 4FMDF 5GJVC 2QP9X 3BS4A 3WP1B 4W5JA 3CRQA 4YXWD 1G7SA 1KDPA 3IILA 1KYIA 3KDSE 3UG6A 4YMVA 2OLKA 1A82A 3T12A 2V9PA 3EZ2A 4KYIB 1MRNA 5CIQA 4BQSA 3THXB 4CEHA 3CF2A 3SQWA 1OFUX 2GBLA 1G5PA 1UBCA 2AKYA 2ZJZA 1XCGB 4URYR 2CNWD 4RZ3A 1GG2A 4GOKA 2CJWA 3L8ZA 3FWYA 2PLFA 2ZJOA 2J41A 2C78A 1SKYB 3NH9A 4GSYA 1EFCA 4GZLA 1CIPA 2O8DB 4Q1EA 4LHZA 4A82A 1BYUA 1XD9A 1GUAA 2ZR7A 5TDHA 1FNMA 2D3WA 3T1VA 3DMNA 3TVTA 4US2R 1G7TA 2CVFA 4M22A 4HAYA 1RZ3A 3LRPA 1T6NA 4PC6A 3WNBA 1N0VC 2G0TA 3KJGA 4ZCIA 3AH8A 4EPTA 2HDNB 2QE7D 4FWIB 1GIAA 4Y0AA 2F1JA 4FW9A 4HZUB 3IIJA 2OO7A 4UXJA 4PHGA 1XX6A 1ETUA 3VX4A 1VPLA 4GBMA 1BMFA 2WBLC 1Q44A 1QHSA 1XBTA 2J3EA 2DBYA 1NN3A 2GXAA 2O8CA 1P60A 3SN6A 1II8A 1S3GA 1YR9A 2WOOA 3QEJA 5G3YA 3P32A 2XSZA 3L43A 1JXOA 3A1VA 2W58A 2RGBA 4NL4H 2OFXA 3N70A 5C1BA 1XF9A 3CPEA 2VP9A 3NC0C 4EUNA 2V7QD 5FPKA 4WAUA 2FGJA 3MGCA 4UNPA 1FX0B 1OT3A 5DYIA 3PFIA 3AF0A 2ZSDA 4MYTA 3IKJA 3ZD6A 2V8OA 1JR3A 1XMIA 1U94A 4KFRA 2ZI9A 3EWSA 4B74A 4MYHA 1SGWA 2OG2A 4V0KA 3N2IA 1U90A 1YZGA 5GJCA 1IQPA 1KIMA 1QHXA 4QC2A 4TYWA 1T8TA 4MKIA 3OESA 4AC9A 1MV5A 1BH2A 2XB4A 3GJ7A 4ZKEA 1SULA 1ZAKA 2IYUA 4Q7KA 3U7HB 1DAMA 1XXHB 2F43A 2RGDA 3BRWD 3KKOA 3UMFA 3IBGA 4Q5IA 4F38A 5CB6A 5GVSA 1RC8A 3H1TA 4GMDA 3AUXA 3CF6R 3B1YA 1BO6A 1RW4A 4QJ3A 1XJCA 4XSGA 4XWAA 5FI1B 5SZJA 4BLQA 4XTCS 4PC7A 2GJSA 5FOXA 1G6OA 3T5DA 3BK7A 3LQRA 1UFQA 4PX9A 1YHNA 4F92B 4L8GA 2FWRA 2Q9BA 4LDJA 5JI3E 1U0HC 2W6ID 1U2RA 2H7VA 3DOEA 3ADDA 2CBZA 4BZXA 2BWJA 1KI6A 3EARA 5P21A 2JIZA 4DWJA 3EASA 3DKVA 1EGAA 3K9GA 4LYHA 1KMHA 4PAOA 4EKDA 2IHYA 4DBLC 4Q7MB 2JA1A 3PG5A 4KBFA 4U02A 2MSDB 4DHEA 1XD2A 4A4DA 3AKCA 1KO5A 2VP4A 2WWGA 2ZU6A 3HJNA 4MGYR 4Q9JA 2CVHA 2RGNA 3WYGA 4DUGD 1N3BA 2J0UA 2GILA 2NO6A 4A9AA 5JS8A 1I4LD 3K0FB 2GXSA 3PIRA 2RAPA 2BMFA 3O8RA 1G5TA 1SZPA 1SVMA 1XTRA 2ZANA 5LPNA 2HYDA 3KQNA 2ZJ5A 5TARA 5HCNA 1P62B 3B78A 2CK3D 2XZPA 2WWHA 2ZYTX 2YOHA 4V0OA 3RAPR 1R5NA 5IHPA 5KOYA 5EZ5A 1TU4A 1Z5ZA 3OIWA 3ZVNA 4JS0A 5EE9A 5JHHB 4Z51A 1GKIA 121PA 2JJ1A 3K0EA 1AS3A 1TQ4A 3R9WA 2DB3A 4JLKA 2BIFA 2QTHA 3VNUA 4DIDA 1M74A 4CGZA 1KSJA 3GJ3A 4HB0A 1NP6A 3PEYA 4MUAA 1QVAA 2ZRBA 4LV6A 2JEOA 4D80A 1ZINA 2P2LA 2XJ4A 1IJEA 1DAEA 4IOJA 1JR3E 4V0NA 2CXXA 4OQNA 3PQCA 5FUVA 4YMWA 3RS3A 1FTSA 1ZD9A 2RMKA 1U81A 3MFYA 4JMPA 4DT1B 1EK0A 2OCAA 1NBMD 4YQFA 1W1WA 2ZRHA 4C0SA 3AKEA 3M4YA 5FL7D 4A8JA 2A5JA 3FDIA 3TVDA 1LY1A 1ZC4A 4AURA 1E9CA 1AQUA 2IYLD 2XEXA 4LCBA 4CYMA 1E98A 2A2ZA 4DSTA 2CCJA 3KQKA 4WZAE 2AL7A 3TKLA 3DMDA 4OK3A 2GA8A 4DSOA 4F4CA 1FOEB 1GKUB 2D74A 4N3NA 5EP4A 3HPQA 3OEHA 2FNAA 1FW6A 1M8PA 5JEEA 1GL6A 3PJRA 4R7ZA 2ZROA 3LH5A 1OXXK 3HU2A 4QBFA 1XXHA 3KX2A 3AF4A 1HT2E
chains in the Genus database with same CATH superfamily
3UOWA 1KK3A 2FRDC 2JIOA 4II7A 2BMEA 5EFOA 3TTTA 3HK2A 2D4AA 5FBHA 1C3LA 1OD6A 4ZIRB 3QLUA 1EZ4A 1XTPA 1YAJA 2UVDA 4LIPD 2CLIB 4PZYA 3S2GA 1CUIA 1ELOA 2QPTA 4MS1A 4OL0A 2WV9A 5I51A 4E14A 4WJLA 5H02A 4G4JA 5ECDA 2PKEA 1MB4A 3KCQA 3OQIB 3QU4A 4TMYA 3C3PA 2X77A 5FADA 3F4BA 2V58A 4PYMA 3INTA 4ND8B 5DP2A 3FYUC 1E9BA 3R3WA 1ZM2A 1E3IA 1Y8AA 3C7AA 1W5TA 4XPIB 4ZODA 3LX5A 1TT7A 4HC4A 4AT1A 4OYLA 1HYBA 3RUAA 1T9BA 3GLHB 3CH6A 4C6SA 4Q15A 3TMAA 4AKGA 3GAZA 2GAFA 1US8A 3T95A 1NVMB 4BO1A 1YS1X 4KUHA 1LPSA 1JKJB 1MEEA 3T35A 4K9OA 2HMVA 5J5CA 4HAUA 2A4KA 4HDNA 4D4HA 3VX3A 2OECA 3PA6A 4NBUA 4EGQA 2BP7B 1TYZA 4QPJC 4KR7A 1UAGA 2EZ9A 3MS4A 4IP0A 1XNHA 2DWQA 1AKYA 2AG5A 1ZKMA 2YV5A 1JH8A 1W49A 1W1UA 2XWJI 1TQ8A 2RHTA 3DDZX 4P4UA 3TSZA 4N7BA 4YJDA 1XAHA 2P3SA 4L7VA 2LRHA 5IXYA 1EWYA 1V35A 1XYVA 4MV3A 1BIFA 2GXUA 2ECKA 3TFWA 1RTTA 3JRWA 1WDKA 2AOVA 3DMRA 5KDOA 3K8YA 2OO3A 3EAQA 1XCOA 2X3UA 5DOZA 3KOUA 4KIUA 4RY0A 1HTWA 3O4RA 2JCVA 1P3JA 1K4KA 2WZDA 1G2PA 3FMOB 3ORRA 2QRVA 3EG5A 4MHOA 3AESB 3BWYA 3X1YA 1E9SA 2BFPA 3K32A 3B89A 3OE7A 2Z5FA 2YC4C 1LK7A 3S40A 3FNBA 4PYLA 3KXDA 3NB0A 1NM5A 2II6A 1P0QA 3CNOA 5E2BA 4YPOA 1OYYA 1JILA 4BMSA 2GAOA 4D44A 4QA9A 3ZZ0A 1AMOA 1XMXA 1KJ9A 3ZHQA 5ICEA 1CS4C 3GT7A 3KQYA 3BEDA 2XUDA 5BO5A 2QMZA 1VPEA 3PNOA 4WZ6A 5DHPA 1RYFA 3G82C 1ZUWA 2VDOB 3MAAC 1KI7A 3NHWA 4WOBA 3IR6A 1PJRA 3B1WA 2JLQA 3SMQA 1JG3A 1XDUA 4UBIA 2DHRA 3S6JA 1WXFA 4RZXA 4NOLA 4ES6A 1QIJA 4YMLA 4EB8A 1JHPA 3G02A 3I64A 1I32A 3JQ8B 5U4QA 3TLXA 4DWVA 1II8B 1JMVA 4W82A 1TT5B 2X42A 5TQ2A 1MAWA 5GIOE 4K2AA 1J4AA 1CS0B 4OIFA 4AJJA 1FDSA 1NV9A 4D96A 3S29A 2REQA 1A8QA 3QF7A 3G0BA 3LAWA 5IARA 4BMYA 2GTHA 1CR4A 3DLTA 3DMGA 1MIOA 2FOIA 1WW3A 2XD9A 3TAXA 3A2MA 4F2GA 3E5NA 3P7MA 2JEYA 2DPXA 4H7PA 5FORA 4CKCA 3LHKA 3G8BA 1FX0A 1MN6A 2RKOA 1RABA 4FDMA 3F2IA 4ZPXA 4YI3A 4BUZA 5IDXA 2H08A 2HWUA 1YDWA 2WUVA 5EOVA 3TJMA 2H4XA 5KOHB 1ETHA 1N7GA 1VYTA 2ARKA 2B6HA 2HWKA 3AHGA 3KL2A 1N3IA 2DQZA 5FO1A 2IPOA 2O14A 3G85A 3HJAA 3ZI7A 4CNBA 2GEJA 3BD8A 4KN6A 1ZITA 2AJBA 4NK5A 4PPGA 5HFNA 3TXXA 3L5OA 2ID4A 1X7XA 2WRZA 3USES 2CNOA 1IZ0A 1QK5A 4K3UA 1NR7A 4HDNB 1IL0A 2PSHA 4KVGA 5BMVF 5KJFA 2PT9A 4D7AA 3PWKA 4DDUA 3ZDBA 3SF8B 1WUKS 4YDSA 1J70A 4IJUA 3WA7A 1JPUA 2O5RA 5IM5A 3G2HA 4BJ3A 4G1VA 1TVEA 1CZOA 3QUCA 1V9SA 2I4NA 5E9WA 3O94A 3JWEA 3W5AA 1HDRA 1VCNA 2YINC 3QKRB 4F7DA 1DG1G 2VLIA 4YQEA 3T4PA 5FPYA 3IT0A 3EC2A 4LBVA 4MYUA 4ZGWA 1OKKA 2Y77A 2FPGA 3DBHA 4G5OA 5B1SA 1F2UA 1IG0A 3OOEA 2JGDB 3R3ZA 1J8DA 1J2UA 2EFHB 2B78A 1KJNA 2G77B 1NX6A 2JFZA 3IBFA 4HQNA 3R0ZA 4O6VA 3DZHA 1X80B 5CCBA 1GZ5A 1U3TA 1SVIA 3IP5A 3WE7A 5B1YA 4YH1A 4BUJA 3IEKA 4CEJB 3QYPA 4KACA 4MUNA 1KQFA 1RRVA 1TKCA 3HCDA 3WLRA 1SQ5A 2FGKA 4Y9SA 5AW5A 1VE9A 3LUFA 5J43A 2V55B 3AF6A 2BI8A 3LQ2A 2XRMA 1K63A 1Z6XA 2V74B 3NAGA 3PNBA 3KT8A 3ICCA 2GWRA 3MVEA 4GQAA 5H1YA 3KL4A 2I7VA 2WLSA 4G5YA 4HGNA 2CD9A 3DL2A 4S24A 4EJ2A 3RT9A 2WVGA 2RH8A 4B3DA 1T6BY 1TCBA 1GNQA 2HRQA 4RD0A 1WHTB 3MJEA 2GBPA 3B9QA 3LBYA 1WLSA 3GDWA 1V1MA 3F5FA 4EDHA 4RYDA 3DLAA 3WMXA 1L4BA 1SVKA 5JMPA 3DQQA 3CR3C 4PGFA 4LHSA 4WCDA 1R0SA 5F64A 1LC3A 4LXIA 2QG9A 3QWAA 4JKOA 4HMOA 2NXEA 2DFTA 3NEYA 3D6MA 2WW8A 3A3NA 4H7KA 2QMEA 4HH1A 1JEEA 1PLKA 4MLCA 5AMXA 3FVVA 4ZI3A 1G4UR 2HX1A 2KYRA 2WJJA 3TZ6A 4QEKA 3WWZA 3IS3A 3RC8A 1F2TB 3A4NA 3GN1A 5IVDA 1DJOA 3X3HA 3ABRB 1ZA1A 1W0KA 4NV1A 3SDZA 2RK6A 3GIDA 4O0MA 4RPGA 1C8VB 4LYDA 1IVNA 1V43A 3VYRB 5KWSA 5DZSA 4LDZA 3D6FA 1EJ2A 3SYTA 2J7PD 2Q1UA 5KYTA 1B3BA 4FOTA 2GK7A 2QL6A 3UHOA 3GLFE 3O84A 4KQGA 3L4JA 5JAHA 4Q66C 3VR5A 2CYBA 1QIMA 2J9FB 3DUWA 3DYBA 3L4SO 3FHCB 5LNK6 4R0NA 5ENZA 3D3EA 2RGCA 3FJOA 3QKWA 2W2KB 5IBCA 1TLTA 3E9MA 1PJ2A 1N92A 1NHWA 3B6KA 4YV2A 2WUEA 3DTTA 3DZFA 1UBUS 5AI4A 4ZN6A 2IVFA 1FEZA 2A8YA 1QVRA 1XALA 1YFLA 2QTZA 3D6NB 4JB3A 5EINA 5DRTA 821PA 2EYQA 3FOZA 1Y8ZA 1KOGA 4Z49A 4AP5A 4MVJH 4C03A 4BFXA 2X76A 1I0LA 4QOEA 2YWFA 2Z2JA 4IEFB 1Q1QA 4X84A 2I3AA 4BQNA 1CYEA 1F3LA 1E3QA 1R00A 4IG9A 1T4CA 1U04A 4GBJA 2WTBA 2X6TA 3G2NA 5FCDA 3PA8A 1IXRC 2WD7A 3KLNA 2WSMA 3B7GA 3IQFA 3UPUA 2VG8A 4XEHA 3H16A 5AJVB 1BTOA 3VZRA 3ZBUA 5E7QA 3INYA 3NASA 2V7BA 4JK3A 2H1OA 1QV9A 1HT1E 5C1DA 1M1UA 1P81A 2JLCA 2ZB8A 4O29A 4XQEA 2SICE 3TZHA 1TEZA 5L4LA 2QYTA 3BJMA 4G5SA 4W1PA 1N8SA 4F21A 2OCBA 1YNOA 2GHIA 2OSBA 3FPFA 3WK9A 2VSYA 4XFKA 3BILA 4JBWA 1YJXA 3ML1A 3F5DA 4MA4A 3ZHRA 3PNVA 4DBLE 4M6WA 2GCOB 3UFXA 5KVCA 2FPGB 2X86A 4IVPA 1QV7A 1KY3A 4QDJA 3MRXA 1Y81A 3KVVA 4IEEA 3ZR4B 4I4TB 3VMMA 2NMVA 4O2BF 3MWLA 4RTJA 3BZBA 4BNUA 3TBFA 5AVTA 4QNNA 4ER5A 4D25A 4AJOA 3BZUA 5HRAA 1T2FA 1N77A 2VT7A 3DVAB 2TYSB 1M2GA 4LJ6A 3DNPA 1GZ3A 4XWKA 3N8KA 4J0EA 1H5UA 4HB2A 2ONZA 1MX3A 4WDQA 3ZU5A 1DCTA 3X1XA 5L51A 3FZNA 3SF8A 5CFMA 2KB0A 4ZALA 1GTVA 4W5RA 1KZHA 5JJLA 3PHHA 1O6ZA 1TK2A 2I4MA 2VZ0A 1WUJS 3RSGA 1M10A 3EGDA 3WLJA 3LY8A 4I9GA 1ZG3A 1ACMA 2FSPA 1ULZA 2GBLC 2TMKA 3CUWA 3OEHD 3O4IA 4IQ8A 3SY8A 2OG1A 3OQ1A 4N0EA 1TM3E 2WVJA 1S4QA 3JD4A 3KQVA 3JWIA 2EP5A 3HMQA 3T61A 1HQYE 3DBHB 1UWCA 3GRCA 3OM1A 3HY3A 1E2PA 3QV2A 4IDNA 1ODIA 1Y6RA 1M7BA 3ZXUB 3N9IA 4XIGS 5LUAA 4PZDA 4YNBA 2AG0A 5FL7A 3TW8B 1Z6TA 1J99A 1RXWA 1T2EA 3OA0A 1TC1A 2PL5A 3SSAA 2P11A 2W6JD 3DR3A 3GOHA 1I94B 3D31A 1G60A 1RJWA 4BGUA 1I2MA 3ANXA 4LOAA 5HK8A 2GEFA 3PQDA 3R5XA 2PYZA 3GHHA 1V95A 4EYGA 5D51S 2JDIA 1A9XB 4K0RA 5FX2A 1Z06A 3ZIAA 3GGSA 4NOJA 1OI2A 3QVXA 5DNVA 4G0YA 1MF7A 2A14A 2GH1A 2WQZA 3BE6A 4OLBA 4LF4B 4B33A 2PSDA 1JHOA 3FWPA 3RAJA 1T8PA 5U4XA 3UWMA 1XTUA 1U6JA 4O4JB 4YUYA 4WOCA 4U2KA 2AMLA 3MERA 1QFJA 4D02A 4NRDA 1N0UA 4RVSA 1JQJC 2VQSA 1TZCA 4MDEA 3ANYB 1E0AA 1AUPA 3W1EA 1SK9A 1U1DA 5JVDB 5KJ1A 1FRNA 3BRQA 2XNHA 5JY6A 4S1TA 3VKUA 4GPAA 5SZKB 3ZGLA 2W5UA 1PJLA 1AO3A 2E49A 4F2WA 2MSEB 5EZYA 2ZR8A 1T1IA 1BU8A 1U7UA 4DPMA 3J81k 2G4VA 2GNPA 3OCWA 3EPLA 3ELWA 5TGZA 2E0IA 4DA6A 2H07A 3BCHA 1HE2A 2ODWA 4MAAA 3RFXA 3H13A 1ORDA 3MRTA 3JQ7A 5FULA 2I6GA 3Q40A 2Q5LA 3CEHA 4X92A 5IABA 4MQFA 1J9GA 2W8ZA 4HDAA 4BFZA 1Z13A 4YUAA 2REQB 4WD3A 5D00A 2SKCA 3QELA 4OUDB 1ZK4A 1CS0A 4J4TA 4QARA 4DM3A 2F8TA 2OGWA 1NQUA 2O48X 4CGYA 1EUDB 3T3NA 1WEKA 4EQZA 1ILEA 7REQB 5ITVA 1MVOA 4IDDA 4ZQCB 1YRQA 3AHJA 4IGEA 3SC4A 5KYWB 1AZLA 1V47A 1W5FA 3QXHA 2DQSA 2G0AA 2WJGA 3CJQA 5L95A 2QD5A 2Z2XA 1KMMA 1U2TA 2GFIA 3TIVA 1R0ZA 2ACKA 3KEGA 1ZJ5A 2IF0A 2P30A 4QDXA 2X2EA 3E9DA 1A97A 2VCYA 4UZEA 2WIGA 3H8WA 2YWGA 1CZRA 3G79A 4EB0A 1DAKA 4N76A 1OR8A 5JRZA 5EE1A 4L8YA 2JLUA 4QU0A 3EY4A 2I4RA 1U8UA 4DRXB 3GAAA 5F7OA 3COZA 1FLDA 1PVVA 2OWEA 2R6ZA 3T5TA 4DUGA 2FEPA 4C76A 4TGLA 3BDVA 3UT6A 4Q3CA 4JOCA 3VKHA 3IO3A 4YK7A 4NXNB 2CVOA 4NNJA 3M0EA 2L18A 4IIHA 4LNHA 4AXBA 4CT5A 1DKMA 1EFVB 3AYXB 1P4HA 2HNAA 4FZRA 4LJYA 5AVJA 3SC3A 5JQGF 1OXKB 2OBBA 3DUFB 2PMEA 1KYQA 4Q6BA 4DIEA 2RD2A 2HHHB 1PGOA 3UCFA 1XDBA 4GP9A 3Q9NA 4DIDA 4U6SA 2KBEA 4O2RA 1ZS9A 3CWCA 1EGVB 1EUZA 4FDAA 5E7MA 2XUAA 1K0FA 3BA1A 1Q12A 2PUWA 2BM8A 2RAUA 3VR3D 3FPGA 3PL1A 5HE9A 3L6CA 3P2JA 5LC1A 4J3NA 3MTIA 5H16A 2C0CA 4ECEA 1BHSA 1K2VN 2WNIA 1P2VA 1QG4A 2BRUC 2WG2A 1W4RA 2HA2A 4YRRA 1BFDA 3SHWA 2VDUE 2XQVA 2XZLA 4O59O 2Z57A 3UAYA 2LNDA 1NF2A 3FWZA 1P2BA 4TZ6A 1OASA 1E5XA 7YASA 2AGVA 2GO1A 4DRYA 2FUG1 3EUWA 3GEBA 1HWYA 1W35A 3KSZO 4LQLA 1CF2O 1ONSA 3TRKA 3TW4A 2QRKA 5CVEA 4KH0A 2VYNA 2VDLB 2CL0X 1J0XO 1OV6A 1QE5A 5F12A 3WHPA 2DSTA 4YECA 5F23A 1SXJC 1WPGA 1Q77A 5D3MB 4IVQA 1EHIA 5AP9A 4OHOA 4ZCPA 3WLAA 3RSSA 3S2IA 4K1XA 5B6JA 5K3OA 1TA4A 3DKKA 2PBRA 4L50A 4IV0A 4OP2A 3C97A 4FS8A 5BN3B 2V6IA 2ECPA 3L41A 4JKYA 1K9SA 1YR6A 3NBYC 3IALA 4U7HA 1LJLA 2ZJ0A 2WSSA 4XKJA 4CHGA 4FOPA 4R9SA 3W04A 4CQMD 4DV5B 1XU7A 1BD4A 3EVBA 4TKVB 1IN4A 3DEIA 1MTZA 2AHRA 3NOQA 4QBHA 5FOTA 3RT1A 3LTNC 4TMZA 4BP9A 3DHWC 4I5IA 1PAUA 4OQZA 5AO9A 3N0WA 5IVIA 3AERA 4W99A 3TEJA 2Q21A 2L82A 4X63A 4HO1X 4RPJA 1KS2A 2F6RA 5HG0A 1IY1A 1XVVA 1LLDA 3FPBA 2CDRA 1NQTA 1TEXA 1QHIA 3PC6A 1U1GA 4NOKA 3F3MA 1ZKDA 4BIIA 3TXYA 4KQ6A 1FBNA 3EVGA 4U2FA 5K0BA 3S1SA 2K7ZA 4YCCA 4B6SA 1NUSA 1D0VA 3ZDCA 1K7XB 1KERA 4QTZA 3S2FA 3L7IA 4L4SA 1QAOA 1P74A 1V7QA 3GYGA 4L5IA 1TM5E 2XSZD 3DCIA 1LK5A 4RE6A 4KE7A 4R81A 1Q50A 2J9FA 2GESA 3I9KA 4RXTA 4UC0A 3RHFA 3IXLA 4XQCA 4B4WA 1HETA 4JI1B 1U4NA 2PUCA 4I9NA 4IH1A 4DMKA 4GR4A 1DU4A 2AUMA 1FQKA 4CNQA 1DWQA 1WXIA 1CSEE 1ESCA 2H7CA 3DOJA 3H5LA 4QRDA 3C98A 4JC5A 3VKVA 2JZOA 2ZUSA 5K3FA 3LY7A 4X8LA 1N5LA 4OU4A 2ZDGA 4GRDA 1NVFA 2V5AA 1VSTA 1I3OA 1VI2A 1Q19A 3ZWDA 1VL5A 1V8FA 4M21A 4UTNA 1UK6A 3GEGA 3GRVA 3K20A 1ZGJA 2FZEA 4GZ6A 4KK4A 1K5DA 2O8BB 1XKQA 4R54A 4BAUA 3NHRA 4NCXA 3H2ZA 3VR5H 1VLZA 2Y3IA 2YWHA 5BYBA 4W5HA 4FWTA 3TSYA 3ZHOA 1RNLA 3EVAA 4UDOA 3W2GA 2VHXA 4U8HA 3GQBB 2WIFA 2LCIA 4AVYA 3T9CA 5BQOA 3DE7X 1DQZA 1JDUA 1VG0B 2QMOA 4N48A 1CC1S 1NYQA 2F00A 2XBLA 3E3AA 4CHTA 1FP4A 3AJDA 4HWPA 1WR8A 4MB2A 3RROA 5CYGA 1O0SA 3A4LA 2V8BA 3RDPA 3OKPA 2JLVA 4HX5A 4F1WA 2Z8XA 1NBEA 1AXRA 2B0CA 2WYUA 3SVLA 3HVKA 1MFPA 3Q8LA 4X1IB 2BBTA 3MWKA 4KHPB 1CV2A 2B8EA 1FS5A 3HSYA 3OCYA 2O3JA 4MUYA 2H48A 2IHTA 5B4TA 1T9CA 2C83A 3F67A 4LZNA 1GA4A 5I7RA 5KI6A 3EXEB 4CMIB 5C5EA 1GTSA 2JB9A 4J0FA 1SZJG 2R79A 3G9XA 2ZZKA 2D59A 3HKBA 3PJEA 4R1NA 4YV7A 2PX0A 4N41A 2EF0A 2VJCA 3T3HA 3GWGA 2YZGA 3EIUA 1W581 1KEWA 1IUOA 2XD4A 4RVNA 4BPRA 4DMRA 5JCOC 4Q37A 3SICE 4PLGA 4MWSA 2HEGA 3ZX4A 3IYLW 3ZVLA 2NUBA 3RK4A 5BNIA 4L16A 2H06A 4P3NA 4WXYB 4ARZB 2D1TA 2YFQA 4WJKB 2NU8B 1ABBA 1IPHA 4L4UA 3H1AA 3FUUA 4JXJA 2HHAA 4Q9KA 3NAQA 3SYRA 1T2VA 1F7UA 1JBQA 1PJTA 1GZSA 2A58A 3VJKA 1WKCA 3I5UA 3UANA 2V1UA 2GN2A 4E5SA 1H94A 2RJ3A 4HH3C 3R8CA 2IPMA 4XYBA 3D8BA 4ZAGA 5HUHA 4OTZA 3H1GA 4FDTA 4B4UA 1MC4A 5L3SA 1O6FA 1U2PA 3C1AA 4PVDA 5J23A 4RD3A 4R1OA 3K8ZA 4ZVLA 3LT2A 1W4LA 1OI4A 2WT8A 4ZA2A 5JSYA 3HXOA 1OWOA 4CTOA 4M99A 1V3UA 1X0XA 5BSFA 3OIUA 3VR5D 5B7GA 4MLZA 1DKPA 1GPJA 3QVMA 2Y1EA 1QYRA 2CHUA 3C16C 1X19A 3KKPA 5AJWA 2IHNA 2ZYVX 2FCAA 3EY9A 1LDMA 4RK6A 3AVQA 5TJ9A 1L7DA 3HCOA 3T7KA 5LWQA 2PANA 3JQRA 4MUGA 3EIWA 1XZDA 3LFUA 3OBBA 3OH8A 4UCWA 2E7ZA 5G4KB 1UXJA 4R9UC 2WHXA 1QK4A 3L7JA 3MLEA 2V6JA 4NE7A 4CM9A 2JBAA 5G0TA 2ETVA 4M7WA 2DKNA 1NVUQ 1S01A 2GPTA 3BWXA 2QOEA 3A9WA 3U4IA 2NXNA 1DXQA 1QLWA 5LB4A 2QRJA 1NI3A 1ZHOA 3VNVA 5DFAA 1AHNA 3LPAA 3P52A 1TCUA 1Q16A 4BNKA 3D6AA 2QENA 4K9SA 3U1TA 4IICA 2X1MA 1LBSA 2C5BA 3IT1A 3KELA 3KFVA 4GR9A 4R84A 3PFHA 5EP3A 3KB1A 3RC7A 2BFNA 3E2MA 4GLLA 2CB9A 2P9EA 5GV7A 4C4PA 1ITZA 1W87A 4MKHA 4OV6B 3GEHA 2WD9A 4LYFA 4G5XA 3OP1A 3VOTA 3LOPA 1H69A 2CXOA 1KY2A 1VZ3A 2ZSFA 5DBEX 4A3SA 4FLMA 1VKZA 1HQCA 1AQIA 2BMDA 3X1WA 2IL1A 3U0VA 1TAGA 2OV4A 5ELXA 2IHKA 1FF9A 1BXGB 2A94A 4NICA 4R6WA 2CLOB 3BGOS 2R8OA 4RMJA 1H0RA 3HB7A 2I71A 4K6MA 1JR3D 2C0QA 3AU9A 3D5QA 3L6BA 4LJKA 3ZY3A 5KPDA 1K5GA 2ZIFA 4IVRA 1C4XA 3M3HA 3OQBA 1VHWA 4E5PA 2FUEA 4NAHA 5LQUA 4OXXA 1NXVA 2FW0A 1WWKA 1RM3A 2J32A 5JO9A 1MV8A 2O8EB 1G8PA 4RSMA 1TGYA 3K72B 4WLUA 3E9RA 1LBEA 5BSGA 4IMRA 4UTZA 5ALMA 3MPUA 3T34A 1RE1A 4CFSA 4UAJA 2QSUA 2ZTVA 3ZV3A 4RO0A 5BSWA 2IYSA 1GR0A 4X8HA 3ZCXA 1VE1A 1EUCA 4NJMA 1IONA 2QAIA 4M46A 2GX6A 1Z4JA 4UNIA 4Z8YA 1D9XA 3ZG6A 1QU2A 1SB8A 2QUIA 4IDEA 3QXXA 3RABA 3UJNA 2ZJ2A 1FU4A 3WK5A 1PQYA 2HMSA 1GQSA 2VHYA 4G5RA 1UBOS 3F49S 1PGQA 1M7GA 1CP2A 1U3DA 2AIRA 4FQ7A 3VAAA 2PZBA 1W36C 1GPWB 5DTRA 2HQ1A 3A6JA 3EAFA 4RF3A 3ZWVA 4BKUA 3GWZA 2X58A 4CV0A 5IJ9B 3JQFC 1XB2A 4GGOA 4BKPA 3E4CA 3EG9B 4EABA 1BGWA 3OHSX 4I6JA 5CA0B 1I7QB 2XKBA 3VSCA 5LFAA 4CIXA 1WVGA 2H4HA 3KAQA 5KOJB 4LXUA 1S4MA 3IAEA 5JCOA 2EWVA 3VJRA 2YIDA 1X86B 6NULA 1ZLYA 4II3A 3HP1A 3B1VA 2XMGA 3Q7PA 3OO1A 1EEXB 5DASA 4PHFA 4WUVA 3WLEA 1NN0A 5F5LA 4LI3X 4BBPA 2HIAA 3P5SA 3UPTA 4X54A 3SK0A 1D4FA 2PWBA 3DWFA 1TM1E 2I62A 3GEPA 3JY6A 1IN6A 4HNVA 3EGDB 4HDSA 1JQEA 2X19A 4XWTA 3WKDA 2HJRA 2NVUA 3EH2A 2GA9A 3RVQA 1FRQA 2QZJA 3D4PA 3UENA 2YOFA 4MQLA 1Z0ZA 1W5BA 1IN5A 1FRVA 4RVOA 2WU4A 4HRXA 3OCUA 4PG6A 4V03A 1BRTA 4TSFD 1USGA 5E9AA 4WLVA 4EGFA 1TM4E 1SZDA 3G5TA 4ZOQI 2NZJA 3IHWA 5HKAA 2B92A 1U6IA 2O3RA 3OLCX 4X9XA 5FF9A 4J43A 3OEEA 4ERXA 1XO1A 1JFLA 1XCMA 1IC6A 1X8LA 3DDOA 3FB4A 5LZ5A 3WB1A 2JLYA 3L6UA 1I6LA 2GF9A 4J8PA 1UINA 2IE8A 3PNQA 4RCYA 2IV3A 3H84A 5KMGA 5DM0A 2PMWB 1A9OA 1D6JA 2PZEA 4GWGA 4JJ4A 1ZVKA 4WLEA 1DFIA 3AERB 2D1QA 1M2KA 2P0EA 2R7KA 1E5TA 1LW6E 2O7QA 2QI9F 3LCJA 4FE4A 3STYA 2JH3A 3W1VA 4ZEMA 1NF8A 3PUYA 2WJ6A 3OIFA 5A4DA 1THZA 1SOUA 4LC1A 4MX8A 2DPYA 4X6YA 2PR7A 4GI7A 4J16C 1BN7A 4ZREA 5CM8B 3KTDA 3TL3A 5I7VA 1LH0A 3BGWA 1HG1A 4MW6A 5CCDA 1NXXA 1XA3A 2ZZNA 4L85A 3AV3A 3ER9A 3ZKWB 3LCMA 3SG0A 2V65A 3EXHC 2X8LA 3EA5A 4M36A 1EFLA 4FT2A 5DGCA 5LIPA 3O8CA 2GPJA 3MS2A 4E08A 4LJRA 1VMKA 3DV0A 3KVNA 2VSQA 4DXDA 1GZUA 5FP0A 1ONNA 1U7ZA 3KE8A 1A71A 3V2HA 5AW1A 1TVKB 2Q3MA 2H18A 3NIFB 4GPZA 4HJXA 1VI6A 2PDAA 3B1ZA 2OL4A 5TMEA 2PEYA 2ZIAA 4Q1CA 3I9NA 5JC8A 1IWPB 4Z2YA 2CLEB 3EZ7A 4TXMA 2Q5HA 4OLFA 1JZQA 3M5DA 3CONA 3FTEA 1J1IA 1MXHA 1Z12A 3DEKA 4OL9A 5IDQA 4L1KA 3L4EA 4NQZA 4ZQFA 3QUBA 4XXHA 2ENUA 4BEJA 1KAMA 1EK1A 2BMJA 3VYSB 3COYA 3JRXA 1T5HX 1JHDA 2BTOA 3PSAA 4GM0A 2G1UA 1CUCA 1EWRA 4KQMA 4AQDA 5JXWA 1JDBB 1O9BA 3BB4A 5T7BA 1KA9H 2WHEA 1X7XB 1SQSA 3PNKA 4QULA 3V7FA 1P8AA 2GXQA 3H5NA 1UANA 1IE3A 4CQMA 1EUQA 1WETA 2C98A 4NULA 2R1VB 3IOBA 2PJDA 3CB4A 1SBQA 4XQGA 1SCIA 1SBTA 2Y05A 4QPDA 3GY0A 3PCTA 1IVSA 3PTLA 1Y89A 1KJIA 1SVUA 1GAJA 3ILSA 2GFQA 3HKEB 3CZ9A 3KOZA 1E18A 1GEGA 1Z0UA 2OCDA 3VO9A 3L4BA 3PQ2A 3SEQA 1SKUA 1W29A 2C8VA 2RC5A 2VS1A 2OWDA 3ESQA 2GS9A 4MQEB 3RRMA 2UUPA 3SQOA 4DAEA 1HMPA 1SK8A 4H0CA 1F2UB 4Q1BA 1OMOA 4BNZA 3MD0A 2PQ6A 2XUJA 3WBBA 2OLJA 4O2BA 4BEBA 5BW8A 2P9HA 5CRIA 4TROA 1FVFA 4G09A 1P45A 2KW5A 1I2BA 3BGVA 1JG7A 2X4DA 1JHMA 1UDCA 1WB6A 2ZS8A 3LLCA 2FE4A 1JQLB 4LRQA 4OB8A 5FQOA 4BFTA 4YAUA 3OHMA 2VBFA 2IJGX 1ECFA 5T67A 1GQRA 2BM9A 3EW9A 4INOA 3RSZA 5COQA 3QFCA 4F8YA 5L3QB 3MT9A 4C2TA 5T6BA 4BB6A 5JZVA 3M9LA 1Z47A 1GO2A 1JPNA 2G82A 2VRWA 3HVUA 1U5CA 3L8FA 1U2QA 4X3CA 4ZAXA 5GOTA 4LFCB 4EEXA 3THXA 3EODA 4KNYA 3ZZTA 3CG0A 4KKVA 3ZDDA 3PC3A 4J1TC 3WYEA 1XQWA 2I1QA 2NXCA 1W0JA 2NO1A 3ID6C 2VPYA 1G291 1T5BA 5H3LA 1WZCA 5BW5A 2Y4NA 1M6NA 2WUDA 4DB2A 1XXLA 1P0PA 2NTEA 4IVNA 1SU4A 4MOWA 1RZRA 2E2WA 4TRRA 4XJVA 1ZI8A 2L0XA 3A1UA 3FI9A 4HEA6 1Q0QA 5KKCA 2DUWA 1IZ7A 4G0OA 4D8XA 5JAUA 2XNDA 3IXQA 4RFSB 5ALGA 1TQDA 4BO7A 2JZCA 1CDEA 1RBZA 4Z53A 3C5EA 3BWEA 1SPXA 1WABA 1X7YB 3NATA 4J7UA 1VLVA 5E8JA 4OD0A 3A28A 2WI8A 1HH4A 3OZRA 2EZ8A 1KFKB 1LLUA 4FK8A 3GDGA 4P34A 1CNEA 2GYYA 1ECCA 3PYLA 1FX1A 3HVHA 1XKXA 2V7UA 1MO4A 2FLKA 1VJTA 3OT1A 4RENA 2NSYA 2X8JB 3BN3A 4YO7A 1UZUA 1KQPA 5HGXA 2D8MA 4QG3A 3CKKA 2C7PA 4GPD1 5TT1A 3GCGA 3M6AA 3GFVA 3FBWA 4F5YA 3E22B 3KJXA 1NF9A 3I6IA 3QPBA 4LX0A 3SI7A 3OFKA 4FE3A 4BOYA 4DSAA 1NQOA 3GUVA 1JAHA 4JI5B 3H83A 3KUCA 3DYIA 1LZKA 3P9PA 1KE2A 1P1JA 1W19A 3AHIA 3NNSA 5CXQA 3T52A 4EF4A 2ZBPA 5B55A 2I6XA 1YS9A 2AZMA 2DCUA 1C9YA 2C7GA 2FSIA 3K6RA 4KZPA 4EPXA 3DF7A 3LOQA 5JSZB 1U1IA 1EZ1A 2GZHA 3H18A 3TBHA 3JATB 4A36A 3KJNA 3H5RA 3PCXA 5CA1B 2ZVDA 3MWYW 1R50A 2QMQA 1H9CA 4YO8A 1FSGA 4DQUA 1JJAA 1E8MA 1N75A 1T2CA 4FYXA 1AA6A 2H1LA 2ZETA 4G1FA 3A6GA 3F78A 1NVGA 5LBTA 4XD2A 2GD1O 4W8HA 4ZJUA 1PZFA 5IYZF 1QR2A 2CD7A 2R44A 4OMUA 1KRHA 3ES9A 1RWXA 3AK4A 4ZDKA 4PPQA 5J2TB 5TY0A 1N1DA 1V7CA 2VNSA 3OPMA 3PITA 1W48A 4RV9A 4F2DA 2QHXA 2HIHA 2CLHB 4RHYA 3NFRA 4HMQA 4N39A 5JZSA 4CG3A 2NPIA 1DAHA 1Z36A 2HXSA 5JZBA 2REBA 3IDOA 3VM6A 2OXEA 2BTEA 1UUFA 2OPHA 1E1CB 1L7OA 4C0WA 4XB6B 5FA5A 2EL7A 2FZGA 7ABPA 1GWNA 3LBNA 2GEDA 4R1TA 2DG2A 4DJ5X 1NSYA 5EIEA 1FJHA 3TN7A 1CT9A 1EK5A 3O2QB 4MDYA 2GOYA 2WMDA 4O63O 3C6ZA 5ECGC 1JQ5A 1NVWQ 2XITA 4P2BA 4LY3A 4IL5A 2JHFA 4FGLA 4KG7A 4KVAA 2ATVA 4PGHA 1ZOSA 4U7TB 4DPKA 2FSHA 2ZIVB 1FBTA 2VUUA 4U3JA 1WO8A 5JSQA 5L9AA 1KRXA 2OHGA 3W79A 1WSWA 1BE0A 3G6KA 4H3HB 3D8NA 4RM2A 1QIDA 3BWMA 3RFCA 4FYWA 5A4IS 5IJXA 1Y9EA 5HR5A 1KNQA 1Y6QA 1WUHS 1TTHA 1J22A 1F1JA 1AX9A 2FWJA 5CFPA 1MEJA 3AR3A 421PA 4L5CA 1NOJA 1SU7A 3HRHA 4KE8A 1VPVA 1T6YA 2J5KA 4RK4A 3VDNB 1AY0A 2G07A 2WQ7A 1EX1A 3CC8A 3IAXA 2I87A 2OHFA 2HHCA 2UDPA 1TZJA 4C2UA 1V0JA 3AFOA 1XNJA 2FJPA 2GSDA 3CZ5A 4XDHA 5CX1B 3THWB 4F5EA 2EX0A 1H2RS 3AFIA 4X7PA 4ENUA 5HK9A 4LZZA 1EGMB 3PP8A 1UM9B 1WTAA 4MV9A 5AVWA 4ZPJA 1EXVA 4JLAA 4MUFA 3NH6A 3D1LA 2ZAMA 1Z29A 1YDGA 4LDQA 1PR1A 1LDGA 5DBGA 1B0UA 3SS7X 2RGRA 3P9IA 2J45A 5LQRA 1SUWA 3IURA 4P08A 1GGJA 5KYUA 1J0BA 1XCPA 5A3QA 2ES4A 3PUJA 1HC7A 3DXZA 1H8HD 1ONOA 3A6EA 2P2SA 2PGIA 3AYZB 4TL6A 1DOZA 4IHJA 1GG9A 1NXQA 1QTQA 1EFRD 1GAQA 2N47A 4QQFA 3B1JA 3MJCA 1XCBA 3Q72A 4UHJA 1MORA 1YIDA 1ENYA 1NA5A 1C9EA 1JVNA 2VC2B 4IH4A 2NYAA 5E6SA 3THSA 3R9XB 3EVTA 2CWDA 2IWHA 1Z6GA 2IU0A 1A9PA 5JVDA 5IK2D 3H6GA 5TJHA 1G21B 3TAUA 1E1DA 4R01A 2DLDA 2EBFX 3HJBA 2AC2A 3MMPA 3QFRA 5AVZA 4NY1A 3T7RA 1ZK1A 3BPSA 4GGMX 2A78A 3VKFA 2YHIA 4Q03A 5J59A 1JHZA 4ZRNA 2P9JA 3T3MB 1ZDMA 1JDVA 1NW5A 3SKXA 5ITZB 2W7TA 4H7HA 4QU8A 2QTCA 4WKNA 4BTEA 1RLMA 3NHPA 2ADOA 5C80A 3BWDD 5JECA 4QSMA 3UTCA 4E1BA 2ZBDA 2I29A 3HRIA 3OPQA 3S7TA 1ZESA 4OFBA 2BEVA 2BKLA 2Z95A 4NDAA 1JBKA 1TYAE 4R2LA 2I54A 3ESBA 3X44A 4J16A 3DOUA 4BNDB 5THKA 5BRJA 1QF7A 2PQMA 1INLA 1EWQA 4XVQA 3OAAA 2FSGA 2PZJA 4UQLA 3IVCA 4O4IB 5JR3A 4TT3D 4BFWA 2QORA 4DR7B 2I22A 3EF1A 1P5FA 3JTEA 3FNIA 1NPDA 1GUBA 4M4SA 1DXHA 4UHKA 2A35A 4H1UA 1J39A 2BUCA 2GTIA 3EFOB 1WP4A 3FF1A 1JTEA 4WNAB 3ZD7A 2VJQA 1U80A 4HXFB 1DIRA 1P2GA 2W4QA 3M4NA 3NVDA 4K9PA 4WNCA 4QHTA 1CQXA 4UU7A 4QLBA 2R0QC 1W46A 3U1BA 5D86A 3ECAA 1RJ9B 2ZUBA 4RV5A 1VPTA 4I4LA 1Z38A 3AEKB 3T3DA 4RHUA 4EF5A 2Z6QA 4TYQA 1ZH4A 5AOCA 3FPAA 2QTAA 2JJ2D 4KN8A 5ARCA 5BVGA 1VBMA 4ZV9A 4EY7A 5F9MA 4H0FA 1VFPA 1UXIA 1Y98A 1CHDA 1SVNA 1UK9A 3LPNA 2CL6X 3I1FA 1KQNA 1QRUA 3GPIA 1X77A 3LVFO 3G2IA 1E6EA 2GZSA 2X41A 3BXGA 3ILYA 2HWWA 4L0QA 1ESZA 4LHEA 3E48A 4PG4A 5FHRA 4KDEA 2IRWA 1NBIA 3HHEA 3NBXX 1ZH2A 2GLTA 1FRFS 2UYYA 4EUEA 2RI1A 4O2BB 3DF9A 3QLTA