1QR6A

Human mitochondrial nad(p)-dependent malic enzyme
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
551
structure length
551
Chain Sequence
EKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MALIC ENZYME 2
publication title Crystal structure of human mitochondrial NAD(P)(+)-dependent malic enzyme: a new class of oxidative decarboxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 186
structure length 551
sequence length 551
chains with identical sequence B
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 1999-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1qr6A02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1qr6A01
1SMKA 3UICA 3NEPX 3H5NA 1M76A 1NXQA 5A3JA 5JCJD 5I9MA 5GZ3A 2PZJA 3JD0A 4UVHA 1IPFA 2HUNA 2OBNA 4ND4A 2JFFA 4GI2A 1K0UA 4RLSA 2O50A 3DZFA 1HZZA 1ENOA 3HG7A 4IINA 1V6AA 3GF4A 1PQWA 3H3FA 1HE2A 4JP2A 5JY1A 6ADHA 4Q3NA 1A7KA 1XU7A 2NWQA 4OKIA 3WJ7A 1JTVA 5GY7A 5ER6A 2DQ4A 3ZWNA 2B0JA 3NKLA 4HXYA 1PJLA 1Z6ZA 3OA2A 2DPHA 4A2CA 1DIHA 2HK9A 1A7AA 3PIDA 4FBGA 4LMRA 2P4HX 3EMKA 1VL6A 1RKXA 4ZGWA 2XPCA 1U5AA 2NNLD 4OHUA 3I9KA 4TZTA 5KNLA 3NDRA 4YWJA 3E5RA 3CUKA 4YT8A 1HRDA 3KHUA 2Q2QA 4WE3A 4X54A 4E5YA 3EVNA 5FWNA 2Q1WA 2OBYA 3B1KA 4XD2A 4HY3A 2HSDA 1WAMA 5EQDA 1BG6A 4B79A 2NU7A 1UDAA 4BO2A 4XGIA 1YO6A 4JBIA 2DBQA 3RBVA 1DRVA 2FPGA 3I5MA 2VYND 4K9DA 5TF4A 1BXZA 1O94A 3FCOA 4CLRB 4KUGA 3M6IA 3ONDA 2VRCA 3KYDB 4NPCA 1RM0A 1YB5A 3H65A 1QSGA 4ZD6A 3INTA 2DT5A 1E1LA 4K6CA 5HWSA 5CDTA 5THKA 5JNLA 3EAGA 3JYOA 2DM6A 2VWHA 4YAIA 4Z9FA 3RIHA 2FR1A 1ZO8A 5IAAA 4E4YA 4MPDA 2AA3A 2VUTA 3GLQA 3ICCA 4FFNA 1ZUD1 3MWDB 2I66A 2GZ2A 1WNTA 2O23A 4P22A 1E3LA 2G17A 3I6IA 3G79A 1BXGB 4TRRA 3BXXA 1OZAA 2I99A 3MZ0A 4WOJA 2VYNA 4CUJA 2EG9A 3FNHA 1Q0QA 1VLLA 4FFMA 2EIHA 3G1UA 3PDUA 4G5HA 4J0EA 3WSVA 2W2KB 3S8MA 4XEHA 4PLZA 1XQ1A 3JV7A 4W99A 4IXTA 5CEEA 5IXSA 1A71A 2WYVA 1ZXBA 4GH5A 1Z7EA 4J7UA 3LC2O 5TSDA 4BNLA 3ZWWA 4YXFA 5EMHA 4RPJA 4AJOA 1M2WA 1PL8A 2RBEA 3AU8A 1LJ8A 2RCYA 1RYDA 1H94A 3FNGA 3KLPX 4EEZA 1DPGA 4K1LA 2XOXA 4ALMA 1E3EA 4J9UE 1MC5A 3UFXA 4D44A 4R1SA 2DUWA 2W4QA 1BVRA 3TQHA 4PLPA 3WR5A 1NAHA 3KYBA 1ISMA 3VZSA 4RVDA 4AJPA 4O0LA 3NV9A 1EBUA 1P0CA 3K5PA 2VHXA 1DB3A 2OP1A 2NM0A 3RROA 4OQYA 3PWKA 4GVXA 1HDYA 3Q2KA 3FRJA 4HFMA 4OIMA 4BIIA 3S2EA 3DBRB 2O7QA 2NU6A 2EP7A 4IDGA 3DAGA 3CPSA 3K9QO 1NPTO 5A9TA 3RJ5A 1HZJA 3GGGA 4IGFA 3WJAA 4XRGA 3BTOA 4YT5A 5EIOA 2VWQA 1CIVA 2YQ5A 4W7HA 4BB5A 4YJHA 1PGPA 1VJ0A 3BMQA 4B3JA 2DTDA 2C59A 3P5SA 2ZTMA 4IJVA 1N5DA 3A9WA 2BKAA 3LT1A 4ROSA 1HYGA 4J1TA 1JU9A 4IJWA 1CF2O 4ZU3A 1LI4A 4ND2A 5CDGA 4DC0A 5T67A 2ZQZA 1E3JA 4ZQBA 1DC3A 2AQKA 3WWZA 4FFOA 4R69A 3AFMA 3FBTA 2LDXA 1NAIA 1M66A 3RWBA 3JCZA 4B4VA 3ONEA 1S6YA 1DIAA 1Z7BA 3A28A 3RUEA 4BNUA 4YDRA 1PGQA 3NDIA 3ZV4A 3W8EA 1T2FA 1NX6A 1YL5A 5K0ZA 1LSUA 2AE2A 1YB4A 3JD2A 3FF4A 3DOOA 4ALIA 1EVIA 5C7OO 3CINA 2WE7A 3TFQA 4A5OA 2VHZA 1MFPA 1VSVA 4CL8A 3LLSA 4O6VA 5F1PA 3EY4A 3F6YA 3F5SA 3PP8A 3HHPA 4W9NA 2VT3A 1ZFNA 5L7TA 5ICSA 3L9XA 4GX2A 2BFPA 5B12A 2YV1A 5JMWA 3HFGA 1Y5MA 2PGLA 1U1IA 4KTTE 1FDSA 1HDOA 3GRKA 1P3DA 3RC1A 4BGIA 4CR6A 1VRWA 2CZCA 4DWVA 1Y8QB 2A9FA 1F14A 1SNYA 1LDGA 3PJFA 3DAFA 2V6BA 1Y8QA 4I1IA 2EP5A 2O4CA 3MJSA 4WLUA 1KVUA 5IDQA 4P38A 4FC7A 4BNMA 3FR8A 4ILKA 2IYPA 2IZ0A 2V6GA 3PLRA 2I9PA 4WLNA 2XF8A 3CSDA 4HV4A 3GR6A 4K26A 2RH8A 5EINA 2NQ8A 2WEKA 1H6BA 2JJYA 3MOIA 4CLHA 3QSGA 4BUCA 4PG4A 1A9YA 3GHYA 3AFNA 4B3HA 4DBVO 1PTJA 2B4RO 3E82A 1XQ6A 2W98A 3WGQA 4CR8A 1I3NA 4Z0HO 5JPIA 3SXPA 4IS3A 4AL4A 2EF1A 5T8KA 3TNLA 2PZLA 1LQUA 1P1IA 3ETGA 1Z45A 2C20A 1XU9A 3HZZA 4N18A 3PIIA 1IUKA 3M2PA 3GH3A 3WBFA 5G4LA 2Q50A 4EW6A 2GUGA 4TZKA 3PPIA 4U0KA 3R3JA 5MGBA 1I8TA 3IUSA 3FHLA 4DBZA 3UW3A 3DWFA 4U7WA 1IB6A 1MC4A 1YQGA 3ZZNA 2GN6A 1E6UA 2A92A 2G0TA 1KEWA 1YOVB 3MEQA 4CR7A 4E21A 1UZMA 3NAQA 1C0PA 4YJFA 2X5OA 2GRAA 5JY6A 4GGOA 3IMFA 2UUOA 2BHLA 2DBZA 3P2OA 3KV3O 2O3TA 1FDWA 1ZK0A 1U9JA 3QHAA 4J1SA 4JJIA 1A9ZA 4EITA 1PJTA 2R00A 2IEBA 4IDAA 2O7SA 3WGGA 4UUNA 2WYUA 4W4TA 4BO9A 4BOYA 4Y6PA 4CODB 1Y1PA 2C5AA 3H9UA 1Y8RA 4R1TA 2G76A 3GRPA 3QWFA 5TX7A 3C1AA 3GAZA 1V9LA 1JA9A 1I33A 3HB5X 4OAQA 1GD1O 2C7VA 4PRLA 4ND5A 5AXAA 3TDKA 3UAGA 3DBVO 4HWKA 4JN6B 2QZ9A 2WMDA 1GQYA 3TWOA 5DULA 1EK6A 4EEXA 4G81A 1V3UA 2J5QA 2WTBA 3HN7A 5BQFA 5CEJA 4ND1A 2C7GA 2CDBA 1DHTA 4ALKA 4QFCA 4FIZA 4WK6A 1ZJZA 2HQ1A 1LSJA 2C2YA 4NFHA 4BNFA 2HAEA 2Q45A 5DN9A 1D1TA 3F46A 4NH4A 1TXGA 2EWMA 4I9HA 1T2DA 3WNQA 3KEOA 3K30A 1P33A 1PL6A 3WQSB 4YJFB 4GSLA 3AY6A 4JP3A 1AGNA 2VUSA 4CMEA 1D1SA 2UYYA 3IKTA 1YOVA 2E37A 3LT0A 3H6KA 1E5LA 3JQAB 3BIOA 2BI8A 5IF3A 3PGJA 4GX5A 3C85A 4OH1A 2GZ1A 3E9NA 2BF7A 4O5OA 8ADHA 1ONNA 2FY8A 1KY4A 1NPDA 2GASA 3F4LA 3JSAA 3VVCA 1V8BA 3WTCA 3H5RA 4GMGA 4DYVA 2ZQYA 2P9CA 4DTIA 3NX4A 1EFLA 4FFPA 1NWCA 5THQA 2IZZA 3L0DA 5A9SB 1SC6A 4RPLA 3SLGA 3HJAA 3EZLA 4UREA 1UXJA 5KKAA 1GEEA 2H5LA 1KC1A 1QP8A 4FOOA 4ZRNA 4BNTA 2GZ3A 3L6OO 4XA8A 2AMFA 2YV3A 4II2A 5TC4A 4FSHA 3DMTA 4D42A 1DDOA 1I24A 2NVUA 3C24A 3WYEA 3IKVA 4BO3A 4E13A 1E77A 3DMTC 3DHYA 3U4CA 4GSKA 3PEFA 3VKVA 4MVJE 3GUCA 2WJPA 5COQA 2UAGA 1UR5A 4ZVVA 3DAPA 1YKFA 4WOKA 4IUYA 2OORA 3OMLA 2I3AA 4UUOA 3JQ7B 4BNJA 4DLAA 2AQIA 3D64A 3PFFA 4WEOA 3GGPA 3RBZA 1B3BA 3JQBC 2ZJ1A 3RI3A 4UUMA 2GNAA 4LGVA 4UVDA 4WPGA 2VWPA 1ML3A 3WX0A 3JQCA 3H9JA 2VWGA 4BNGA 5HRUA 4GL4A 4IM7A 4CV2A 5JC1A 2VYVD 4OM8A 4RF4A 2E4AA 5C7IO 3WGHA 3I83A 3JYLA 4NI5A 2FZWA 4ZQEA 1QMGA 1S7CA 2GN9A 1XDWA 2ZTLA 2JL1A 1NFRA 3RVDA 2IZ1A 4F6CA 4M1QA 2C07A 3W6UA 3EHEA 1LBEA 2NVWA 2RHCA 2XXJA 1GUFA 2X5KO 5L45A 4CUKA 3B20A 4DIFA 1JLLA 4C7KA 1CERA 4EUFA 4MIEA 5AYVA 3WTBA 4RZIA 5MDHA 3OJLA 2I5PO 4PLGA 1UP4A 2X58A 3S1LA 3ZWMA 3QW2A 3L9WA 4L73A 1E1KA 5LCXA 4DL9A 4URFA 3JQAD 4MVJI 3DQPA 5HA5A 4KQXA 5EERA 1B15A 1KVRA 3GAFA 3W6ZA 4YB8A 1GZ6A 1QV6A 3PYMA 4YT4A 1DJNA 2D5CA 1PZGA 5IN4A 3ASUA 3QVTA 4N7RA 1C0KA 3RU7A 1A4IA 3AWDA 4TRNA 1E3WB 2J3JA 2HMVA 5G0WA 2DUUA 3M1AA 1DEHA 1X7DA 3AI2A 5CG2A 3DBRA 4N5LA 3H9EO 1NNUA 2PV7A 1EK5A 2X9NA 2ZCVA 1O95A 2QZZA 4L75A 3KLMX 4PLYA 5TNXA 3ULKA 1BW9B 2H6EA 2JFGA 2Q2WA 3DB2A 4XYMA 4CPDA 4RVSA 1LRLA 3C8MA 4MVJP 1HE4A 1P9LA 4PG5A 1J6UA 4E2ZA 3L4BA 4DIBA 3ZHYA 2FR8A 3FTPA 3NT4A 3R3SA 3GGOA 4NZ9A 5A05A 4CM1A 5IJZA 3L4BC 2B36A 1FK8A 2EW2A 3BMNB 4WASA 1QRRA 4E32A 4XJSA 5IZCC 3H9QA 4PLFA 4DLLA 2FOIA 2X0JA 1DIGA 4HBGA 1YE3A 3VKUA 1H9AA 5DDIP 5L40A 3DZJA 3ONFA 1V35A 3GC6A 3TOZA 3E03A 3ON5A 2D3TA 4OO3A 2HMTA 1JAYA 1YXMA 2NSDA 1UDBA 3ZWCA 2F00A 5JAZA 1U8XX 2YHUA 3BYZA 3OQBA 1W6UA 1ZJYA 3SEFA 2QX7A 2QW8A 2EV9A 1TVEA 2I65A 3PI7A 4NMHA 4RF5A 4MKXA 3V2GA 5GZ6A 3HFSA 4RPKA 3C7DB 4F45A 1BXGA 4Z3DA 4TROA 4JXKA 2ZB4A 1ZVMA 2QYSA 4EJMA 2UDPA 4E3ZA 1F8GA 3UOGA 2X86A 4OOEA 4YQYA 4ZQFA 4W6ZA 2CDCA 1LLCA 3WFJA 1IYZA 5U1PA 2QRKA 4R1UA 3HDJA 1GV0A 2FR0A 2HLPA 1CDOA 1D3AA 2VQ3A 4YA6A 1WXDA 4YBZA 4CLOA 3HDYA 3V1UA 5IDYA 3F1LA 3ZW9A 1YVEI 3JQFA 3ST7A 1M6HA 1G0NA 1X15A 2J3IA 2B4QA 1PR9A 3H9GA 1V0JA 3ANNA 4HX5A 1ONPA 4P4NA 3Q1LA 2B83A 4CMJA 4XQEA 2EERA 3DFZA 3LQFA 4PLVA 2CVZA 2D1YA 4PZEA 4PVCA 1NQTA 3RUAA 3EYWA 1LLUA 3PQDA 4W9NC 6LDHA 4FFRA 3BHJA 3RFTA 1UXIA 1DFGA 1T26A 1ADBA 1E7MA 4IGEA 5DF1A 5G4KB 4WKGA 2D4AA 1TLTA 4UEJA 3A1NA 1ENZA 2HDHA 2PZKA 4LSWA 1RM4A 4J4HA 2J5RA 2W2LD 4B8ZA 4MKRA 4I5DA 2H63A 1ADGA 1R4MA 1TT5A 4WJZA 4BVAA 1PS0A 1HT0A 3QJ5A 1MA0A 5IN5A 2FPPA 3JQ9A 1HYHA 2C54A 3MJ4A 2UV8A 1ADFA 3QQPA 3ZGYA 1T2EA 3KTDA 3MJTA 1GEGA 3GEGA 4D43A 1JAXA 4JCOA 2O3JA 2NVBA 1U2DA 4Z9XA 3KRTA 5B4TA 3Q6IA 1KVQA 4CMAA 4E5NA 4FDAA 2EGHA 4L8VA 1Q7CA 1I5RA 1PGOA 1K6IA 2O2SA 2PH5A 2Q1SA 4FC6A 4GKBA 1YB1A 4BO0A 5H82A 3STHA 4DQUA 5L9AA 3SJ7A 3K73O 3AY3A 3QE3A 1HL3A 1OFGA 3VPGA 2H1SA 4QSMA 7ADHA 1H2BA 3ZH2A 5TGDA 3LF2A 4J49A 4XDZA 5KJ1A 1IE3A 1JKFA 4NQZA 1TI7A 5KJ6A 3AK4A 5A03A 4TMFA 4IDEA 2YFQA 3P2YA 3CH6A 2Y67A 5KVSA 2GDZA 3W8DA 3OJEA 1GQ2A 2W8ZA 3WG9A 1NHWA 2EW8A 4EUHA 4PG6A 1IZ9A 1HTBA 3TSCA 4XIYA 4MOWA 1HLPA 4ID9A 3OM9A 3CTMA 5F1KA 4HFNA 5ADHA 1QG6A 1K6XA 2J8ZA 4J7XA 1DC5A 4K6FA 4OXKA 5IFLA 3O8QB 3RC7A 3H5AA 1N7GA 1R37A 3V2UA 4KUEA 3GNQA 4A0SA 4CMIA 4XRRA 4AG3A 4Z6KA 3TN7A 5K6AA 1T2CA 1P45A 1DIBA 4WLEA 1GDHA 3ROPA 4Y6RA 4R68A 2DBVO 3AU9A 5F5LA 2XXBA 4MP3A 3HDHA 4CJXA 2W90A 3RFVA 3NRCA 4L4XA 4B3IA 4Q3BA 4DUPA 2DTXA 2O3UA 1KEPA 4XB1A 1GPJA 1C1DB 3RKRA 4KQWA 5DCUA 4ONEA 1H6AA 4BGVA 4YJGB 3RUIA 3WB9A 3F4BA 5DNAA 2JHFA 2VOJA 3DONA 1C0LA 4WLVA 4BGEA 4CMBA 3D4OA 4IMPA 3H8VA 4R1NA 4XYEA 4ZN6A 2YQ4A 3PHJA 3GZNA 4EI2A 3INGA 2OMEA 1PU2A 4E30A 1ZSVA 3N74A 3WWYA 4DQXA 2X9GA 3VZRA 3ENNA 3ENKA 4KTVE 4R54A 4DPMA 2YY7A 3ZDFA 5I9LA 2O48X 2FSVA 1M75A 3D5QA 3KVOA 2AEMA 1KVSA 1R4NA 1HDGO 1YRLA 3FNFA 4FGWA 4GWKA 4OGWA 5HS4A 1KY5A 4LMPA 1O5IA 2BMAA 3G1TA 2FWMX 4ZQGA 1LDBA 1KS9A 3I23A 4ESOA 5ES3A 3ZV6A 3KO8A 4MVJM 5CG1A 2BELA 3TL2A 2D5AA 3FPCA 1NR7A 3IP3A 4PZCA 2DPGA 1FDTA 4OMUA 3L07A 1N7HA 2EGGA 1H2HA 4J4BA 4HADA 5HS6A 3ROQA 2AG8A 4MP6A 5JXWA 1E1NA 2DC1A 4KDFA 4YR9A 2JD0A 9LDTA 1BXKA 2ILTA 3WQRA 1YBAA 3H2ZA 3MOGA 4D0RA 2V65A 2ZTUA 3N7UA 4BHTA 3TZKA 3ZNQA 1VC2A 4NFSA 4GQAA 2ZYDA 4EZBA 1AHIA 2DVMA 2WE8A 3JQ7A 3QY9A 4FB5A 3DBLA 1L7EA 2O3RA 3ITDA 4NJMA 5BSFA 3P7MA 1J4AA 4D3SA 1GQQA 3KM0A 3R6DA 4R9RA 4KMSA 4A03A 3I3OA 5JSFA 1PQPA 2VN8A 1E7QA 3KOUA 1EDOA 4ZA2A 2YYYA 4NBUA 4R9SA 3JYQA 2ZYAA 5DOVA 3SVTA 5CPBA 3IP1A 3OP4A 3JD1A 4XGNA 2NVUB 4YYZA 3BTSA 1ARZA 4J1NA 3B1FA 3ZU5A 3HN2A 4BO5A 1Z73A 3RSHA 4CLOB 4M89A 4R5MA 3VOSA 1HE3A 1RWBA 1UAYA 1D7OA 3L6DA 3CZRA 5F5NA 4QFDA 1YH3A 3F9IA 2PR2A 1SBYA 5TJHA 5IDWA 4RF2A 2I6TA 1B2LA 1V3VA 5JMPA 3W4JA 1VL0A 1CEQA 1NQAO 2CVOA 5TT1A 4M55A 1GPDG 4RQUA 2G82A 4KWIA 2BFMA 2VNSA 4QT0A 2HJSA 7MDHA 3T7CA 4YAEA 4MO2A 2OXIA 4YAJA 4DQVA 3PJEA 1IL0A 2YV2A 1PJ4A 5EESA 3S2GA 5I9NA 4EUEA 1GTMA 2WYWA 5DP2A 3TZ6A 3IL2A 3OECA 4ZQHA 1ISJA 1Q0LA 4I8XA 1PGJA 1F12A 4Z9YA 2AHRA 3WIDA 1D4FA 4F3YA 1LTHR 3PZRA 1TB4A 2CUKA 1FJHA 4D46A 4FJ1A 4FOSA 3VH2A 4CMKA 2B5VA 3BAZA 4FJ2A 2DFVA 4OXYA 5F1OA 4A73A 3O4RA 3R0IA 2Z5LA 2Q3EA 4KUHA 2WSBA 1E7WA 2AQHA 3M2TA 2RHRA 1J49A 3FWNA 4PLWA 1HDXA 3UVEA 4Q9NA 1NHGA 4J91A 4NNJA 2ZJ0A 3GDFA 1EDZA 2PGJA 2WM3A 2RH4A 5K9ZA 2YDXA 3AUTA 4RGBA 3L6EA 3VAZA 3PHHA 4CV3A 3SC6A 2O4UX 3VZQA 3WGOA 2OHXA 5AXBA 1QYCA 4C4OA 3JQ8A 3KSZO 3WLFA 3NGLA 1WDMA 3CZMA 5KIAA 1KERA 1E3WA 5AQ1A 4FPXA 1N9GA 1QV7A 1R66A 1YDEA 3I52A 3PRJA 4JBHA 3SBOA 3DZIA 1LNQA 1AUPA 5C3MA 3OETA 4OJNA 1W8DA 5BT9A 3RKUA 4CM4B 4DGSA 1I0ZA 3A14A 4QX6A 2GO1A 1UUFA 3I9OA 3FI9A 5ILGA 4E12A 1T25A 2ZCUA 3AOGA 3ZU4A 4DPKA 1U7TA 5L95A 4CMEC 4WUVA 3RBXA 4BO8A 2CMDA 4WECA 4RJTA 2P4QA 3QVWA 1QORA 3PDJA 3PZBA 2ZB7A 1R12A 1NP3A 4L4RA 4PVDA 4QUKA 3AJRA 2B5WA 2UUPA 2VYVA 3LT4A 4IJUA 4U6SA 1ZNQO 2PH3A 4KZPA 1RM5A 3EC7A 4BS9A 4CMCA 3WMWA 1RPNA 1G0OA 3ZWOA 1E6EA 3JQGA 3MJVA 1SEPA 4CLDA 3L4SO 1Z75A 3DHNA 4IPTA 3C1OA 2HK8A 3SLKA 3DOCA 4R3NA 4UEKA 4WGGA 4XWYA 4IXWA 5L7YA 1U28A 2IODA 5I7SA 1ZSNA 3I1JA 1SOVA 3NTOA 4QECA 4NBTA 4OSPA 3BMNA 2PD6A 1U4OA 4RZHA 1NM5A 1PGNA 1PIWA 1NQ5A 1ZXLA 2NLOA 3W1VA 4YCAA 1HDCA 4E0BA 1CQJA 1NWHA 3TJRA 4GGPA 4CV0A 4XB2A 1GR0A 1UXHA 5EPOA 5CHEA 2W2LA 3BMOB 3L77A 4CM7A 4CM8B 1Y9AA 3QVXA 1Y8RB 1CJCA 8LDHA 1P31A 4L0QA 2BI7A 1KC3A 3CIFA 3KXDA 4G2NA 5KJEA 4MP8A 3U3XA 2QRJA 3B70A 4CM9A 1XCBA 4XZ3A 4IY1A 4P4GA 3OF2A 4UUPA 2TMGA 5EQFA 1ID1A 1XEAA 2OOSA 2VT2A 5JBIA 1E7YA 1UXKA 1K3TA 2VUUA 2X9VA 2IYOA 3DHEA 1I30A 4NJOA 4R3WA 4DMMA 1NVMB 3VH4A 1X1EA 3JQDA 2IRWA 2V7PA 3MWEB 3UCFA 3FN4A 5TIIA 2FMUA 1Y5RA 3UH1A 2NADA 3Q3CA 4HNGA 4JBGA 2JAPA 3BMQB 4RF3A 2X8LA 4XGKA 3PYXA 3FWZA 5JE8A 4BO4A 4PLCA 3LC1O 4PRKA 3IAHA 1VPDA 3PHGA 1AXEA 2VHYA 1B8VA 3ZU2A 4MVJA 3PXXA 1KETA 3OIDA 1BDBA 1Y6JA 4MVJF 4ND3A 3TFOA 1JW9B 3HE3A 3CKYA 4Y9DA 4BNZA 2NACA 3GDOA 3GK3A 1EMDA 1QYVA 1F8FA 1VSUA 2DTEA 3AW9A 4NFYA 4BNKA 3PJGA 4ZRMA 4YT2A 2VHWA 3BHMA 3D4PA 4AJEA 1F17A 3JQBA 2X1HA 5LDGA 2VHVA 4JGBA 5L4SA 2J5KA 4BB6A 2F1KA 2J3KA 1LU9A 3UKOA 3E18A 4R51A 3ZHZA 4IIUA 3K8ZA 3D3WB 2ET6A 5JYEA 2CSUA 1JDJA 2X5JO 2JHGA 5A1TA 4XR9A 5CDUA 3DTYA 2VCYA 1OOEA 1H5QA 3LF1A 5A5EA 5BSEA 4A27A 4KP7A 4IDBA 4NR0A 2BH9A 2QIOA 1ZMOA 1KBZA 1I01A 1SAYA 3WLEA 4H3VA 1P1FA 2GLXA 3DC2A 2V6FA 3H4VA 4TRJA 1KYQA 5AXDA 5JAIA 4DMLA 2JD1A 2I67A 3NT5A 3COSA 4BNNA 2YFHA 3NYWA 5JS6A 3IUPA 1XSEA 4OOFA 3SX2A 3VPFA 3B6ZA 4CLXA 5DCWA 4CV1A 4LN1A 1Q7GA 3GVHA 3GZ4A 1J5PA 3WDSA 2O3QA 1EUDA 2OL4A 2EXXA 2WDZA 4Y98A 4XCVA 1LLDA 1WMAA 1ZCJA 2C29D 2GCGA 5HBRA 3RU9A 4D3FA 4DYDA 2Q1TA 3BHIA 3ANLA 1ADCA 1OAAA 1JN0A 1T2AA 2HMUA 4PCVA 4CM4A 3GUYA 3WXBA 4NDNE 1HDRA 3KYDA 2PK3A 2VZ9A 2Z95A 5KVCA 3WIEA 5LC1A 1W4ZA 4M49A 1HLDA 4YTEA 4WCFC 4IZHA 9LDBA 3GG9A 4R4JA 4Q3AA 2A4KA 2IXAA 3I9LA 2HU2A 3NTRA 1PJCA 4RVGA 2CF6A 2VOEA 3A4VA 1SO8A 2R6JA 3AM4A 4Z0TA 4LCJA 4RDHA 5AVOA 3HDQA 3OJOA 4J43A 4MIOA 4NU5A 3PQFA 4E31A 1ZEJA 4LVCA 4DVJA 3R1IA 4TVBA 1EE9A 1ZMTA 3PWSA 3IJPA 3UN1A 2PA3A 5AOVA 3KUXA 3UUWA 3O9ZA 1ULSA 2NU9A 1ZK3A 3TL3A 1EQUA 1QYDA 1XR3A 2IXBA 3B1JA 1YWGO 2CVQA 2Y1DA 1GL3A 2Y0EA 3K2BA 5LDHA 1VE9A 1I36A 1XHLA 1ZK2A 1X7HA 2Q99A 5AXCA 4FQ8A 5COBA 2IDZA 4OSOA 3RD5A 1NBOA 4BO6A 1PZFA 3GMSA 1FMCA 2B37A 2C2XA 1BHSA 2PGDA 2PKRA 5EN4A 1YGYA 4I08A 4OQZA 4I9NA 1DXYA 4BQRA 3QRWA 1LSOA 2EKPA 3TF5A 4RVHA 2EJVA 3RC2A 1YQXA 4AJJA 5EL0A 2JD2A 4Z0PA 5G0TA 2QQ5A 3SC4A 1BSVA 1B8UA 3HUDA 1X13A 1A5ZA 4QQRA 2CY0A 4AJ1A 1OBFO 1J0XO 1ZBQA 3D0OA 4N54A 1VKOA 5ILOA 3FBGA 5JDIC 4NU6A 4ALNA 4CMGA 2HCTA 1VKNA 5TQVA 2WWRA 1ZH8A 5T6BA 1I2ZA 4AJIA 5TRTA 3W8FA 2C5EA 2Y05A 3LVFO 1VL8A 1UJMA 3JQFC 4JIGA 3TPCA 5ICMA 1RJWA 3OIGA 1EVYA 3BTVA 3O38A 4E5MA 5KCZA 3LK7A 5CEFA 1G1AA 4HKTA 1ULUA 4IDCA 1FF9A 2YZ7A 3GHHA 3C7AA 1PEDA 4CQLA 1RYEA 4HFRA 4D7AA 5DCYA 4PG7A 5KJFA 4BKPA 1B14A 3K96A 3PLNA 4M87A 5F3RA 3D4NA 5F21A 2D0IA 3PYLA 2Y93A 1O89A 1LDEA 1HYEA 5H81A 4B7UA 2YDYA 3ANMA 3WGYA 5JAMA 2FZEA 1N2SA 3UF0A 3VH3A 4MINA 1R6DA 1I3LA 4MKZA 3GVIA 3PHLA 1EE2A 3DZKA 3U9LA 3KYCA 5A4DA 3MJCA 5CPFA 3WICA 1LRKA 1LDMA 3ZNNA 5TLSA 2X0RA 5FFFA 3HB4X 3I4CA 3GY0A 2NU8A 3IDSA 1GYPA 2E48A 2J6IA 4MVJD 4Q3EA 3WMXA 3E9MA 5JYDA 1MX3A 1GYQA 1X7GA 2X23A 3PHIA 5EJ2A 3ABIA 1GUZA 4M8SA 1B16A 1BRMA 3JQGB 4LK3A 2NTJA 2VRCD 3GFGA 3ADOA 4TSKA 1EQ2A 1ZIDA 2D59A 2W2KA 2BFAA 4XIJA 4BKUA 3WSWA 4NHEA 1MFZA 4P4LA 2PLAA 5T5QA 1QYXA 3AM3A 4RV9A 4JX8A 5IZ4A 5HTOA 3CEAA 1DRWA 2Y0CA 3PJDA 1V3TA 3V2HA 1DRUA 4XYLA 2GN4A 5COAA 3DZHA 5C7LO 1DLIA 1HF3A 1R0KA 4BNWA 4ALLA 1GV1A 2EKLA 4PLHA 3G49A 1O0SA 1KEVA 1IY8A 1KIFA 1PJSA 5BSHA 1LUAA 3CMMA 4LW8A 5C5IA 2DU8A 5CAEA 4LRSB 1E3SA 1LDNA 1P77A 3FD8A 3LT2A 2BFOA 1NVTA 2AW5A 1T1SA 5FI5A 4KWHA 4CLRA 3T4EA 4FGSA 3VDQA 1T4BA 5DZSA 2RIRA 5A3VA 4PGFA 3OJFA 1EEHA 4INAA 3DMYA 1VM6A 1R15A 1ZEMA 2EKQA 3OIFA 2BD0A 4EBFA 1JVSA 3OQ1A 2B35A 2DKNA 1YL6A 1H93A 2O3SA 2P91A 4G65A 3WYBA 4L4SA 5J23A 2HRBA 1DSSG 3BA1A 4OYRA 4FR5A 3VZPA 4I9UA 3E9QA 2FRDA 1MV8A 1MB4A 1T1RA 1E7SA 2CDAA 1ONOA 3KSDO 4BNYA 2C82A 4RL6A 4IZIA 1Q0HA 2DLDA 3FNEA 4BL5A 4XX0A 2Z1MA 3VC7A 1KVTA 3PQEA 3G0OA 1ZZEA 3OFSA 4NK5A 1EZ4A 1BMDA 1L7DA 4AICA 1W0CA 4Z3KA 4DRYA 3DOJA 3MTGA 4M86A 1YJ8A 3V5NA 4AJ2A 3INRA 3PWZA 5TT0A 1HEUA 2ZB8A 2QRLA 2JCVA 1E1MA 2D2IA 3EGOA 4GVLA 4MJLA 3DXFA 1B0AA 2BGMA 1IULA 1EUZA 4J3FA 2PNFA 5BR7A 5FEUA 4CQLB 3I9MA 4U0JA 5GZ1A 2X0IA 1DFIA 1WDKA 1X1TA 3D3EA 4FD3A 1GZ3A 5BNIA 1B3RA 3ZHXA 1MXFA 2Y99A 4GBJA 3RC9A 1MGOA 1GYRA 2NV6A 3Q0EA 3W4KA 5ENDA 4CLEA 2NQTA 1CETA 3HNPA 3IIEA 4PFJA 4RVUA 1R16A 4RORA 5T8KC 1U4SA 2HRZA 3IC5A 4E2YA 2GF2A 3U4DA 4BNHA 2SCUA 2EHDA 4JJFA 1H6DA 1IHXA 1O6ZA 1CYDA 3UHAA 3LC7O 2VZ8A 4IIVA 2E82A 1EFKA 4RDIA 1HXHA 1UZNA 1QYWA 3E8XA 4IDDA 1WVGA 4RCVA 3F1KA 1DIRA 1R4MB 1TT5B 4BGUA 4E6PA 3GMDA 4RLHA 1WPQA 3IOYA 2JCYA 1IPEA 3OEWA 2TMDA 4GX0A 1XG5A 1GAEO 2ZB3A 4R01A 4E2XA 5G4KA 5B37A 3JD4A 4B4WA 2JFHA 4JJGA 3OH8A 1DC4A 3QWBA 3DDNA 1HETA 4QXMA 4UVGA 4BV9A 1DFHA 3G17A 4MDHA 1PZEA 2OZPA 4DLBA 2B4TO 4FW8A 1DAOA 4D3DA 3GVCA 1U3VA 2GD1O 4WLOA 4QO8A 2LDBA 5K6AC 1XIVA 3CMCO 3ZNPA 3E6AA 1WWKA 5JLAA 4Y6SA 1NTOA 3QVOA 4B4OA 1IHYA 5JO9A 4IDFA 1P74A 1T4DA 1WMBA 1I10A 3GPDG 3ICPA 1LSSA 1B7GO 1PZHA 3OEYA 4PN3A 2X4GA 1A4UA 3I9JA 2P2SA 3TZCA 1HDZA 1E92A 4LCEA 3RUDA 1IZ0A 1LRJA 3DBHB 4DC1A 3GEDA 3MTJA 1YS4A 3V8BA 1PJQA 2PKQO 4LISA 1BWSA 4TVOA 5BNFA 5HM8A 2AE1A 4WCFB 3E5MA 3FR7A 1QLJA 5A5FA 4A10A 1F0YA 1DO8A 1N1GA 3QWIA 4CL3A 3GZNB 1C1XB 3NUGA 3RAJA 2QYTA 2JKVA 1EUCA 3NDJA 3RUFA 1HE5A 4XR4A 1SB9A 4IQ0A 3HSKA 1PJ3A 2Y68A 4YJGA 4PG8A 3S2IA 1ZW1A 1DLJA 4Q3DA 4WNIA 3T7EA 4IQGA 3BMCB 4HNHA 2FP4A 2AEFA 5I8ZA 4YVFA 3ZI0A 2GN8A 3GDGA 1GADO 4CMHA 1P1JA 4XJTA 1WW8A 4R41A 5I7EA 2P9GA 2G5CA 3DTTA 3ITKA 4J16A 3PTZA 4I5GA 4IMRA 1K2WA 1NFFA 4OL9A 2YHIA 1CRWG 1PR3A 4XQCA 1LEHA 1U3TA 1NVGA 3D5TA 4RVFA 1DHRA 5G0VA 1ENYA 2G1UA 2YUTA 1AHHA 1OC2A 4B4UA 4CQMB 5C37A 4A7PA 3AM5A 3VH1A 4QO7A 3Q2IA 5DOZA 4BMSA 1PS9A 5JW6A 4P8RA 1G6KA 2EEZA 4A26A 5B4VA 1ENPA 1DC6A 3KB6A 4R16A 3Q9UA 1GCUA 3ASVA 3D3WA 3V1TC 1FDUA 4CM5A 1E3IA 3OQ6A 5ENVA 2GR9A 3H2SA 1AXGA 3ZU3A 3WOHA 3DZBA 2VTEA 4LSMA 5B1YA 4E5KA 4M54A 5CDSA 3PFWO 4GAEA 1CWUA 4J6FA 4WLFA 2VZ0A 3OBBA 4N5NA 4BO7A 3TRIA 1LX6A 4RPGA 4RQTA 1E0DA 4J90A 3EDMA 3GPIA 2P5UA 3KBOA 4YACA 2Y1EA 2VRBA 3JQEA 1ZK1A 4WNCA 3SJUA 1YBVA 3UCEA 4DA9A 4BO1A 3BTUA 4D0SA 4Q39A 2BLLA 1M6WA 1N8KA 1YQDA 1YL7A 2I76A 4MIYA 4QTZA 4U8GA 3ROMA 3DL2A 3U5TA 3C3XA 3WYCA 2PTGA 4EDFA 3EZYA 4EJ6A 2FHSA 3RCBA 3ZWAA 3PK0A 1DOHA 1NPYA 4AVYA 4D41A 1JWBB 3D1LA 3GN1A 4TQGA 4Y8VA 5KTKA 3MJEA 1WLYA 4YJDA 5G0UA 3U09A 5KJCA 1FXSA 3VTFA 4ZHSA 4E33A 2RAFA 1I32A 1U5CA 2AG5A 1MG5A 4XDYA 1XYGA 4L76A 1GZ4A 4IBOA 1Q1NA 1XGKA 2Q46A 4F6LA 1KOLA 5ER9A 4H15A 2XAAA 4BKRA 3ZWBA 1DBVO 2Y1OA 3AUAA 3CE6A 5CFZA 3KEQA 3ADPA 2WD7A 1VI2A 1N1EA 2QHXA 2ZYGA 4TKLA 1UAGA 1K6JA 4XYBA 2JAHA 3ETDA 3TZQA 3GQVA 5G0SA 4HFJA 4KOAA 3QIVA 2CFCA 1ISHA 2PKQP 4U5QA 5I8WA 3U4HA 3WFIA 4E5PA 1RM3A 1XELA 4J0FA 3D7LA 4AFNA 3EUWA 4GWGA 4CQMA 2POQX 4IJKA 5ITWA 2HKIA 4W82A 4CM8A 3BMOA 5JFOA 4XKJA 2P68A 4J2HA 1OC4A 1B26A 2JCXA 3NT2A 3G3EA 4NJMB 5KVQA 5I7VA 4CQMD 2FPIA 4LRTB 1HSOA 2Q49A 2I3GA 3DZGA 1BGVA 1DAPA 1ZSYA 3DEYX 3GVXA 3ZNOA 4L74A 2GGSA 3Q9NA 4CUZA 2ZK7A 4KDEA 2B69A 1Y81A 4BMNA 1PX0A 3QLJA 3X2FA 3NJ8A 3DR3A 4GLOA 3KZVA 3V1YA 5BSGA 1GUYA 2UVDA 3DO5A 1OI7A 3U4IA 4CM3A 1LLQA 1UP7A 2HK7A 3C7CB 3F47A 4FN4A 4YRAA 5FI3A 1GU7A 1KEUA 2DAPA 1C1XA 2C0CA 1MG0A 3JQAA 2NTNA 1B8PA 1ZK4A 3NTQA 3M1LA 3QV1A 1TT7A 4AJKA 1P1RA 1PQUA 4ZJUA 5FYDA 1P1HA 5DBFA 2OO5A 3N58A 3I9NA 4CM6A 5JO0A 4O63O 1MP0A 2Q4EA 1PL7A 3AUUA 1C0IA 1I2BA 3VHRA 3WGTA 1DJQA 1I3MA 1PJ2A 2AQ8A 1UZLA 1HKUA 4XQ9A 4J1QA 3K2EA 1YBMA 2BRUA 5JDCC 5GMOA 4NIMA 1SZJG 2CD9A 4NBRA 1P1KA 4BNXA 4H16A 5DT9A 3X2EA 4EJ0A 1U2GA 4TKMA 2P5YA 3UCXA 1E6WA 2R2GA 1X14A 1O9BA 2GERA 4NBWA 4MVJG 4OXNA 3HADA 1N9GB 4GPD1 1C1DA 2ZTVA 4II3A 3OJ0A 5JCJA 2FSSA 3TOXA 3U62A 4EYEA 1XA0A 3RFXA 3JQ8B 1WZEA 1PSDA 4B7XA 2X0NA 3EK2A 3ZV5A 1I3KA 5L3ZA 1BTOA 1F06A 3ZW8A 4BMVA 5B4UA 2WD7B 1I2CA 1SCUA 1GFSA 2PFGA 5IXYA 3WNVA 1H6CA 1SB8A 1Z82A 1TA4A 3ORFA 1MLDA 2Y1CA 1N92A 2YJZA 3S55A 3O8QA 2Y1GA 3O03A 5FF9A 4YAKA 1NYTA 2OGUA 1MXHA 1TEHA 2ZKLA 3VTZA 4AJNA 1X0VA 4CM9D 1LA2A 1U3UA 1WP4A 3JYPA 5CDYA 3F5QA 1R0LA 1GY8A 3H3JA 3JQ9C 1HWYA 3K92A 4GKVA 3BMCA 3ZWPA 1SEVA 3EW7A 4YRDA 4YPOA 4YAGA 3LLVA 2PWZA 1U3WA 3GN2A 4FFLA 1C14A 4D79A 5DBIA 5L7WA 4H7PA 2Q4BA 1OMOA 2OFPA 1Q7BA 4GMFA 2FN7A 2Z1NA 1BVUA 4YEDA 1JKJA 3E48A 4W7IA 2WD8A 3EVTA 3P19A 5JDIA 4MVJH 4C7JA 4K28A 4LVUA 3OA0A 5KKCA 1U7HA 4NK4A 4NG5A 2GPTA 4S3MA 4JQCA 2VTDA 3QA9A 1NASA 5TJ9A 1K5HA 1X0XA 1VJTA 2OUIA 2ZATA 3RJ9A 2ZIZA 3NGXA 1JKIA 3NJ4A 3RQSA 2VNAA 3VPXA 5A04A 4FCCA 4BQPA 2V6MA 2EJWA 1L1FA 3GNSA 4R5HA 1QKIA 3JD3A 2HMSA 3H7AA 4ALJA 5T64A 5DP1A 4JK3A 1WDLA 3CXRA 1LC0A 4TWRA 4J2OA 4QEDA 1WZIA 3AY7A 1ISFA 1E5QA 3BZUA 3IS3A 1A27A 3ZV3A 4UEOA 4WEQA 4NBVA 3UGKA 3AUSA 2YW9A 3QWAA 3U49A 4D45A 3MCVA 3ZWVA 1U8FO 3HWRA 2J3HA 1PJBA 3OSUA 4L9RA 5L4LA 1GCOA 3DBLB 5JCXA 5A9RA 2HO5A 2PD4A 4AJ4A 5IDXA 3LDHA 1JWAB 2IEDA 1ZKMA 2DFDA 1Z74A 2PZMA 3RASA 4ITUA 4PIVA 3OHSX 3RUHA 2O2YA 1PS8A 1HSZA 1XWFA 5A9SA 5DBGA 1P0FA 1SPXA 1LQTA 4YRBA 4I5EA 3ZWXA 1Q2XA 1W73A 3GNTA 3VDRA 5L51A 4Q3CA 2NTVA 1QLHA 3DFUA 1PWZA 4RPHA 1UDCA 5ITVA 4OKNA 1LXCA 3OICA 3GEMA 3VVBA 3VPHA 2PD3A 4BKQA 4IS2A 3ZCXA 3TZHA 3QVSA 4FJ0A 1NFQA 4FS3A 4O1MA 5L4NA 1PWXA 2Q2VA 2E49A 4YJHB 1MUUA 2BGLA 4UVEA 2BGKA 5U4QA 3WBBA 3VPSA 2Y66A 1XLTA 2X6TA 3UXYA 4ZICA 1FDVA 1EVZA 3S2FA 4DPLA 3DBHA 3QWHA 1O8CA 1R4NB 3K6JA 2A94A 2QG4A 4AJHA 5G2OA 3LU1A 4DIOA 1XKQA 4DREA 3LSYA 4J4TA 3FTNA 4UAGA 5TS3A 1T24A 3HQ4O 4DXHA 1JQBA 1IOLA 1K89A 1R0SA 3GG2A 1Y7TA 3WQQA 2D8AA 1EBFA 5H83A 3GFBA 4O59O 5L53A 5I7FA 4F46A 5JDCA 2GSDA 2GYYA 4TRMA 4AJLA 3LZ6A 3O26A 4YQZA 2R00C 4JROA 1M67A 2CF5A 2Y0DA 4BV8A 3GT0A 2E6UX 3LYLA 1QXSA 2X22A 3C1TA 3ETEA 3W4IA 1VJ1A 2OP0A 3I6QA 5JAQA 1UH5A 1H0KA 4N5MA 1JVBA 5KOIA 5IG2A 2PY6A 3U0BA 3JTMA 4BNIA 1YDWA 1UP6A 5U9CA 3AI1A 4I5FA 1YJQA 3KYCB 3WGIA 4WCDA 4UULA 4XYGA 1EVJA 1QR6A 1P44A 3ZHBA 1AN9A 2YHIB 4BNVA 4CMIB 4HUJA 4GLLA 4XQGA 4BKOA 2CNBA 4B8WA 2Q1UA 5IZCA 1BW9A 1NQOA 2NUAA 1UXGA 4HP8A 5A06A 2IE0A 3A06A 3FPLA 1CQIA 2Y1FA 3AOEC 3GA0A 3PGXA 2HMWA 4PZDA 3E1KA 3ZN2A 3ROKA 1SOWA 1ISIA 3AOEA 3JYNA 2AXQA 2H9IA 3T4XA 4J9VA 3GVPA 1ORRA 3JQ6A 4JNKA 2HJRA 3KSUA 1A72A 4E2WA 1C3VA 3IJRA 3PVZA 3AI3A 2DBRA 3QP9A 1YONA 3FSRA 3WS7A 4PLTA 3KETA 5A02A 4GX1A 5KWEA 3RUCA 5BNTA 4RO0A 4WCFA 4EGFA 1NR1A 4B7CA 5JC8A 1E7RA 1D8AA 1LC3A 1LDYA 2A35A 4UVIA 4Y67A 5KVVA 3WGZA 1AE1A 3IQDB 1Y9EA 3GOHA 4U6QA 1ISGA 2AEJA 3I4FA 1BDMA 2X7HA 3ZWYA 3K31A 4JLWA 3F3SA 5T57A 1H9BA 5CP8A 4S1VA 3Q11A 4IQ8A 2P9EA 4J7CA
chains in the Genus database with same CATH superfamily
4B6GA 5A3JA 1Q3TA 3D7SA 4KNVA 5I9MA 3S4YA 1IPFA 2PPVA 1BGXT 3U4AA 2JFFA 1GOTA 4LF8B 1MNAA 2IYNA 4RLSA 1JZSA 4QNMA 1HOXA 3LPAA 3NHYA 1ENOA 2GLUA 2XTNA 3Q7EA 1V6AA 2B1GA 1AK1A 1P61B 1V2HE 4Q34A 4L9AA 4Q82A 5JY1A 1WDTA 2ZIEA 2O6LA 4I1OA 5GWXA 1UIRA 4OKIA 1MBZA 1VLHA 3Q72A 1O6BA 3OZ7A 4WNAA 3ZWNA 4CCWA 3NKLA 1I94B 3K1JA 1PJLA 3IPYA 4LJ8A 2DPHA 4OJTA 2ZPUA 1A7AA 1Z7WA 4K46A 2AF3C 2GCPA 3OMWA 3SVLA 3HCBA 4BZZA 2OQRA 3ZQUA 1F51E 3TTVA 5LU8A 2NNLD 1BS9A 3FUVA 1D03A 1RXEA 1ESEA 4OHUA 3ZE1B 4EVIA 2IYXA 2OBFA 4YWJA 1PFWA 3H84A 3L7OA 3CUKA 4I3FA 3KHUA 3LPLA 4D5EA 1SCDA 3I2FA 4YT8A 3EVNA 3SQOA 2Q1WA 3TD2A 3MG9A 4F5ZA 2ZJOA 4XD2A 3FUWA 4YS6A 5IEBA 5I3ZA 3TRDA 2ZW9A 5LQCA 3W5DA 2MMGA 3FXAA 3IODA 1YO6A 3OAAA 5EPUA 2DBQA 5T4EA 5FUWA 2ZGVA 1UMDA 1PEAA 4P58A 4CEHA 1D2CA 1NRIA 1PTJC 1UC9A 2QVBA 3B9BA 4CLRB 3TQQA 3ONDA 3RRXA 1UQUA 4NPCA 4NL4H 2EX1A 3TXXA 5HZKA 5FOSA 5LA6F 5A71A 1S2NA 1ZYUA 3GEBA 4ZMSA 3LPCA 3V4PB 5J4KA 5H8WA 2QTBA 1MW8X 4YCCA 4DCUA 2FAXA 5BSKA 1VMAA 2VWHA 2G83A 4ZO9A 5IAAA 4MPDA 4WFIA 1EG2A 2HD4A 3SYLA 2IIQA 2JFUA 1SHKA 4K8OA 3G8BA 2NYUA 1P2UA 2ZT5A 2GZ2A 4AZ3A 1LVGA 2LCQA 2O23A 3T1QA 1N0VC 1EK1A 1E3LA 2G17A 3O4FA 4P22A 4IIGA 5ETJA 1M2VA 2WF8A 3URMA 2G28A 4IFTA 3L6CA 4TRRA 5FTLA 1OZAA 1CQIB 5CYGA 4PU0A 1CJBA 4ZODA 1FP4A 3F3KA 4ZVUA 2EG9A 3I28A 3K0AB 3KS9A 2XOEA 4TL8A 4XCXA 3WKAA 2VTKA 5H80A 3R7LA 5ITZB 2EIHA 2RG1A 5M3BA 5DYTA 4ZAVA 1VLZA 5FHRA 5T6MA 5B3KA 3W0LB 4P7KA 3IMKA 1E2QA 4PLZA 3DDZX 5AW9A 2JB9A 4W99A 5IXSA 4IXTA 2IP2A 1V8OA 1A71A 1EFTA 2BKVA 3G0CA 1MZPA 1WHTB 1RBMA 2H92A 1Z7EA 2HDOA 3B8HA 1N3IA 4J7UA 1XE3A 4U2CA 1KJYA 2JI4A 2FZLA 3DKRA 5IM5A 3RGWS 4ATNA 2PA0A 3HKEB 1FIUA 5KKNB 1XA4A 2JHAA 3W3AD 1C9JA 3AU8A 3S99A 1ODJA 1H94A 1W581 3FNGA 3KLPX 2PX4A 2FI1A 2XOXA 1RRPA 4PHCA 4ZTUB 4Z54A 3U7QB 1M73E 1MOSA 1BVRA 1G9TA 2C00A 4BJ5A 4RK4A 5EXPA 3TG2A 2C97A 3WLOA 1EVQA 2CLHB 3AEKB 1Z8NA 3DD5A 3W5HA 4HLNA 3WR5A 4PNEA 1JFTA 2WJIA 4RVDA 4O0LA 1E1RA 1PW5A 2VTBB 3K5PA 2DRIA 2QUHA 1K5GA 1L5YA 3EH1A 5FDFA 3IPRA 4CKWB 3H1AA 2XTJA 3PWKA 4XH9B 1N3BA 1WCYA 4D3XA 4D6YA 4EG4A 2NTEA 2EQAA 3FRJA 5A5GA 3IE1A 2O7QA 1CXZA 2EP7A 3WB0A 3CA8A 4RYDA 4H6XA 4P36A 1N6LA 3K9QO 4TLEA 5DSXA 2E18A 1NPTO 5ABPA 2IPLA 1BH6A 1CLEA 4Y2HA 5AVWA 1AKTA 4N5DA 3ZTTA 4I3HA 2WWFA 2PKYX 4C1BA 2ZYWX 3I5UA 4WOBA 1CKEA 1CUWA 4DCCA 1XF9A 3L8FA 1FEZA 4W8GA 3GJQA 5LZ5A 1EI9A 3FLMA 2FLVA 3V00A 2F1IA 2VJOA 3EXG2 3LT1A 3SNHA 1Q21A 1XVLA 3QFFA 1HYGA 3U44A 5D3QA 1XPUA 4X66B 1UJCA 2ZAYA 5CW1A 3KPUA 2IOHA 2YZGA 3KD3A 2DQKA 5T67A 3VR0A 2ZQZA 3E9RA 3FYTA 4TLAA 1E3JA 2WJGA 4NBKA 5HGXA 4F5YA 1XX6A 3FBTA 5K3AA 1GZUA 2VZLA 3ONEA 1MZVA 3A28A 3RUEA 4BNUA 2OD9A 1JG1A 2IEYA 3L0CA 4UHEA 1T2FA 4KXVA 4NAHA 1T36A 1OROA 1CVIA 1YHNA 1G8FA 1NOIA 5K0ZA 1LSUA 3CX8A 4ZAZA 1ZICA 2FG6C 4K9KA 4RU1A 1EVIA 5C7OO 3CINA 4NQRA 4HWSA 4QUDA 4ZAWA 1QH1B 4LRYA 4A5OA 4CEJA 3KHTA 2LR0A 1Y4UA 2VHZA 1Q83A 3SQWA 5CFQA 2BBWA 2FFHA 3LLSA 3IO3A 5C1PA 3AVPA 4QJIA 3EVCA 5LJLA 4C7OB 5CU7A 1TA0A 3WIUA 1TCVA 2RC5A 4DLSA 4EYQA 2YC4C 3F78A 2I8AA 2Q8PA 1M0WA 3RTAA 2BFPA 3AJAA 2YV1A 1TVMA 2Z5GA 1L8AA 1QGOA 2PGLA 5JMWA 3KT8A 3AHEA 2B2NA 1DEKA 1RU3A 1WHSB 1WJGA 2W43A 3UMGA 4HAVA 3HKBB 4BGIA 2A9FA 2GILA 3MOSA 4NICA 1DWOA 4MWGA 4MHSA 4EKEA 2FETA 2HNAA 2IF0A 3PJFA 3DAFA 2V6BA 1C7FA 4JX9A 5CVCA 5CVJA 5K3EA 2EP5A 2O4CA 1QHEA 3T1HB 1KVUA 2DERA 4MK4A 2MCFA 4H0FA 3I64A 2V6GA 1UPBA 1AUVA 1Z06A 3IIMA 3RTCA 1DJOA 2I9PA 1CRQA 1CRZA 2C5LA 3PPWA 4WLNA 3GLFE 2D2FA 4YDHB 2XF8A 4OQPA 1V16B 2VQ6A 4US2R 1U6IA 2MWMA 4M0LA 3QEBZ 5EINA 1S01A 2QRGA 1L5ZA 3B3GA 4RDCA 4N6GA 5AICA 1H6BA 4JI2B 3AKZA 3LHSA 2QM0A 4CLHA 4FMBB 1L8XA 3DMDA 3GHYA 3H17A 4B3HA 1D04A 3T35A 1PTJA 4US0R 2W98A 4KAFA 1DJMA 1O94C 1RKBA 3FG9A 1IY9A 1I3NA 1GPMA 2Q0XA 3BH0A 4R1OA 4ZRDA 3FZQA 1PUJA 4QOFA 5JPIA 4F1KA 4N76A 2PCJA 5CLIA 1H3NA 2B21A 3Q7SA 2PZLA 8GPBA 3TUZC 1VMIA 1Q7EA 1P1IA 2PTHA 6REQA 3SYRA 2C20A 4N7BA 2VDOB 2N1MA 3I0MA 4G5RA 4OX9B 3R2JA 5DYNA 1TTQB 2ORED 1V26A 3EHDA 3GH3A 3FKJA 1T8PA 3WBFA 1EE1A 3AR3A 4BVFA 3DLHA 4BLTA 4EW6A 1NUPA 4DTCA 1YR6A 3FFBA 1M8KA 4KPYA 3HP1A 3C8HA 3I58A 5MGBA 1PLJA 2CNDA 3IB3A 1S2DA 2OILA 1QO0D 4OHWA 3UMMA 4IIJF 5TPWA 3C4VA 3VZCA 5ADUS 4HMQA 4BRZA 1DKPA 1GTL1 3ODPA 2GN6A 1E6UA 1D4AA 5CM8B 2ID8A 3RNLA 1E9VA 1KEWA 1YOVB 3EZXA 2OTCA 3CYFA 3OD1A 1UZMA 3TVDA 3USES 2OO7A 2RHTA 4YJFA 2DQYA 1WZCA 1K6MA 2CJPA 1K3FA 1JX6A 2XOKD 1BJTA 3L8DA 4GGOA 4H3SA 1QG4A 4HDCA 3MJDA 1ZJ5A 4URYR 1KIMA 3FBWA 3MQFA 2O3TA 4UCFA 2KBEA 4K9MA 2WSMA 1OXVA 1XVVA 4HDRA 1ZK0A 3QHAA 4YRKA 2NU6B 4N4AA 5E1MA 4EITA 1TUIA 2WIBA 1JKMA 4M1SA 2I6XA 2IEBA 1J2RA 2WB4A 3WGGA 2TMKA 4D4JA 1MKYA 2IVFA 1RCTE 3MBKA 3N7TA 3QX8A 4Y6PA 3GGDA 3H9UA 1Y8RA 2J3MA 2L82A 3IOEA 3PITA 4NG4A 1G4UR 1XL0A 1ICEA 3C1AA 4PGGA 2JIMA 4IQ4A 2FEXA 3GAZA 5TX7A 1BVYF 3HB5X 1LBIA 3PUHA 3UAGA 3D4LA 2QLLA 4WVLA 1Q0SA 2WMDA 5CCDA 2JCGA 1L4EA 2ZIAA 4TL7A 4JKIA 5I47A 4EEXA 3I45A 3R4VA 2GS9A 2QENA 3IE2A 4UMEA 2Z1DA 2C7GA 4HVAA 5E6UB 5DRTA 5ERGB 4ALKA 1NLUA 1V8ZA 4WK6A 4DAEA 2WHRA 4O2RA 4EGSA 2JLUA 2C2YA 4NFHA 1HFJA 3CKKA 4BNFA 2HAEA 1DUSA 1ZM3A 4RQBA 2Z8YA 4OAOA 3RM3A 4NH4A 4OI0A 1TXGA 1PK7A 2EWMA 4YO8A 3K30A 2AV6A 1PL6A 1P4RA 1ZONA 4N9QA 4GSLA 3FTFA 1AGNA 1ZGCA 1JZTA 3RS3A 3B1YA 1YOVA 2J31A 2HT6A 2ZTHA 1QDUA 1HA3A 4XD7D 4DNOA 3UWPA 2XAUA 3RYFB 2OFWA 5KHOC 1Z6XA 2JIRA 4QYTA 2O5VA 2RJOA 3PGJA 2HSGA 1RVV1 3A3YA 1KQFA 3K9GA 1XTTA 5JALA 4OH1A 1QDEA 1QC5B 4AY3A 3MWEA 1ONNA 3MSCA 4X9XA 1NPDA 2QNIA 3IQIX 1C3LA 1CY8A 3F4LA 2XV1A 2KS6A 3MQ2A 5IM4F 3DC7A 2W58A 4UASA 5DXAA 1RWXA 3RSFA 1XC7A 2NN3C 4NZOA 2P9CA 4EG1A 2A0WA 4G41A 3ADKA 1YZVA 1AU9A 5F7ZA 1KO5A 3H1TA 4DV6B 4KRGA 1GN9A 1TCUA 2OMKA 5D3ZA 1YDGA 3PDWA 2GD6A 5JS8A 2OAP1 4WFKA 5KKAA 1GEEA 1QF6A 1E1CB 5KWJA 4FOOA 3RS7A 2JFYA 4BNTA 3TLAA 4QUHA 2AXEA 4Q37A 1SRQA 4II2A 5FORA 2PSFA 1B4DA 1VSQA 1ZJJA 4RK5A 1UKBA 3V7FA 3SLRA 1EP9A 5HE8A 3BB1A 1FB5A 2XUDA 3DMTC 1RFGE 1WRBA 1G9XA 3DHYA 3U4CA 2F1OA 3PEFA 2C2ZA 1EESA 4A1OA 1KYZA 2HWWA 2YH2A 2XKBA 1BNCA 7MHTA 2P11A 5COQA 1AB5A 2UAGA 5ALOA 4ZK2A 3KVVA 1UR5A 3COYA 1NF9A 4WTOA 3DAPA 2AOUA 2PIDA 1QNFA 2XVZA 1XAGA 2X8JA 3NC0C 4UHKA 3GFFA 1E69A 3GIDA 2P0AA 3TS1A 2W37A 4FU0A 3LCMA 4FVTA 5JXJA 3GGPA 4YJKA 1T5HX 5FNZA 1B3BA 3U4GA 3I34X 5A4JA 1D2AA 2GNAA 3LM8A 4LGVA 5FL3A 1YHZA 2OQ2A 3CRW1 4U2EA 4EATA 1N0HA 5NULA 4ZYUA 3QJGA 4PXSA 5JC1A 4GP6A 1GSIA 3P27A 4OM8A 2QP9X 4RF4A 4KDRA 5DTEA 2VPWA 3UMSA 1PZNA 2OZLB 4RTLA 3WGHA 1L8OA 3MUNA 1KK1A 2FZWA 2IHBA 3WYAA 4CEJB 4MRPA 3LT5A 3IR5A 4ZQEA 3DCIA 3EGCA 3BEOA 4PPFA 3W7BA 1E0AA 1MJ5A 2Q9BA 5DSTA 1KYXA 4KXUA 3I2IA 2WG1A 1WB9A 4N48A 2QVGA 1T8WA 4WUTA 1HFKA 1NZDA 2C07A 3SIWA 3TW8A 4FUQA 3EHEA 5KTNA 2VJAA 5LIPA 2M6LA 2XXJA 5L45A 2YHAA 1NLFA 2JIBA 1CERA 1GZVA 4QPJC 4MIEA 3KUDA 4B9EA 4Q03A 4F1WA 3U13A 2I5PO 4PLGA 1UP4A 3ZWMA 2JDIA 3QW2A 1SXGA 4L73A 5AM0A 4ZAXA 4BNDA 1E1KA 4DL9A 1H9CA 3G2LA 2GZHA 3DYBA 4X71A 4KVAA 5JCOC 5JH7B 5HA5A 3A7EA 1DO0A 4RIIA 3H0KA 2EL9A 3CV3A 4D26A 1TKCA 1B15A 1KA9H 1XZEA 4ER3A 5IKMA 4AY2A 4BQFA 5E7JA 2J59A 4HTAA 1DBRA 3I01A 3RVSA 3HUUA 2R7AA 4YXWD 2H4FA 2HN9A 4KAJA 3MK31 4DWOA 1CR1A 1PZGA 4XOUA 3RTDA 4OP3A 4IRMA 1TFRA 1C0KA 1A4IA 2WKWA 3IGFA 2XVXA 4IH9A 3WL5A 1JDVA 3QYJA 1E3WB 2JIZA 4P5PA 1PVOA 2B7BA 3M1AA 1IHOA 3PVCA 4FE7A 2I2WA 2RMKA 3AI2A 4G0NA 1MRZA 3DL4A 3LNCA 2AUNA 4R7TA 4C06A 4BGDA 1AK2A 5KZMB 1NNUA 2G1AA 4AP9A 3T5PA 4PZAA 3CY6A 2FPSA 5DLYA 1QG2A 3ONNA 1ECLA 1XWIA 2DPYA 3KLMX 3GWGA 3ULKA 4RLQA 2XRYA 2ZANA 1JIQA 2ADFA 4LHWA 5BY2A 3PEVA 4QOJA 2HV9A 1M33A 3C8MA 1HE4A 1V4BA 2YMPA 3AEKA 3FSGD 5EIBD 4O2BF 5G3ZA 4S24A 4DIBA 1Z63A 4H1UA 5JQGF 3FTPA 1ZITA 2J1LA 3GGOA 5A05A 5IJZA 3L4BC 4C03A 5BW8A 1QUEA 2BC9A 2EW2A 3BMNB 2JZOA 5BXYA 3THWB 1QRRA 4XJSA 5IZCC 4YRQA 1OGIA 2WK1A 3TDMA 3WQHA 2F4NA 5DTIA 4DLLA 1IEVA 4N5IX 1HPLA 4UU8A 4COKA 5L40A 3QE2A 3DZJA 3O8CA 3DGEC 1EAYA 2Z2JA 2AFVA 2VVTA 3E03A 3L18A 3S5JA 1UPCA 2HMTA 2IYTA 3VJKA 4BQEA 1GFZA 3SEZA 1UJ5A 1IATA 4IFIA 3BL8A 5C31A 3ZDQA 4JT8A 5KQMA 2BN4A 1FX0A 1WUJS 2ZUEA 2ODEA 3HRHA 5CB6A 2OHJA 1ZJYA 4Z1OA 4NCBA 1XEXB 1B0UA 2QX7A 4LY3A 4ITVA 4E1AA 3ZDDA 3OT4A 4BFTA 4JC8A 1TO6A 3G02A 3DF7A 1T9GR 3HFSA 1V7PC 4NMWA 2YXPX 5FPPA 1GGNA 2XCRB 3U4QA 3ZGVA 1NQWA 3OY7A 2FE4A 1S4QA 2QYSA 5I51A 3VNVA 2UDPA 4AZ3B 2HA4A 1TF7A 3O2NA 4HRVA 5LJIA 3ZY5A 1XPOA 1JEJA 4DXAA 3JALB 5FFMA 4W6ZA 3LZDA 4H59A 1LLCA 4H3HB 1B0PA 1U04A 3IBSA 2RGAA 1XEWX 3LOPA 5EFZA 4FFDA 1JE1A 1LPSA 4C4ZA 2WSIA 4JVLA 4GXNA 5JSZA 3R5JA 4TSRA 5CLLA 5EXDA 4I1YA 4CLOA 3HDYA 5DIFA 3V1UA 3VM6A 3X1XA 5ULLA 2DGDA 2WAOA 3FLBA 4RH1A 1YVEI 3E9DA 1YRQA 2R47A 3HFRA 1QDLB 3JQFA 1DKUA 4NWIA 4DCSA 2FF5A 1QG0A 1UMDB 2PZFA 3H5TA 5CLFA 1V0JA 3ANNA 4EL5A 1ONPA 2TSYB 4JCCA 1QF9A 2IK8A 2WYHA 3DFZA 3D1VA 3LQFA 3NH9A 3T7AA 3DJYA 4OP1A 3X44A 3TNYA 4KFTA 1Y5NA 1L5LA 1GQOA 5ES4B 4FM9A 1LLUA 1UPXA 4W9NC 4BCDA 2J33A 4RL4A 3K1TA 3BHJA 1TPYA 4IGEA 5D1HA 3IP6A 4G0MA 4EQ6A 3SS9X 1WOYA 2QRQA 4MKIA 4PAGA 5H9WA 3BWYA 2HDHA 4BZQA 3PA6A 1RM4A 3JX9A 3NDBB 3KJFA 1JA1A 4B8ZA 5BOSA 2FK8A 4Z8XA 2J9GA 1Y6FA 2BHTA 2P1DA 3KWJA 1K98A 1TGVA 1IMOA 3C5EA 5HIJA 4R98A 4N12A 3JQ9A 3PIRA 1EWKA 4GPIB 4PONA 3Q40A 2ZJFA 1C4OA 1PFKA 3QQPA 4E88A 2W42A 2HK6A 2HMYB 1FP6A 3S70A 3BXOA 4Z9XA 1U2DA 2BSXA 3ZIAA 1OLUA 4KO1S 5HGJA 1NMYA 1KVQA 4OK5A 4CMAA 3L7NA 4E5NA 3SGLA 2EGHA 3MCAA 4L8VA 1Q7CA 3MNFA 4OU5A 2ZRBA 1GGVA 4JEHA 1N8NA 2PH5A 3O2QB 1D1QA 2O5CA 3TIXB 4MV7A 3STHA 4F3KA 4P81A 2GK6A 2HRQA 1VXOA 5ALSA 3H1FA 3V1NA 4X94A 1RXVA 1HL3A 4JC5A 4HB3A 5CTAA 5HKLA 1U1CA 3MINA 5SY9A 3WLLA 4W7SA 3FGPA 4BPBA 3THRA 1H2BA 3W9YA 3KKZA 3Q8WA 5TGDA 4E4RA 4IHJB 4RTOA 1B93A 4RADA 3WHPA 2EBUA 3MF4A 4JZKA 2X42A 5KJ1A 1IE3A 4NE7A 4JA2A 4TTRA 1EIWA 4NQZA 1TI7A 1AKVA 4IOKA 4B4DA 2Z08A 4BC0A 3R7WB 5KWVA 4IDEA 1QGYA 4RKRA 3P2YA 1NYQA 1IPHA 5AW1A 4D3FA 5KVSA 4JAVC 4RIGA 3W8DA 3OFKA 2W8ZA 1EFDN 3K4QA 3M9WA 1FMJA 1H8HD 1OTYA 4HB2A 3L6BA 4QZVA 1RZRA 4A92A 2EFYA 4EUHA 4YMIA 5C81A 1Z5PA 1C9MA 5AK6A 4YRPA 3SBDA 1P5FA 3LBAA 1UM8A 1F2VA 4XIYA 4UU1A 2WICA 1LI5A 3U2QA 1AGPA 1XMOB 1QG6A 3C3MA 4YCDA 2BFBB 5FKJA 2J8ZA 5DJ5A 1SKYB 4J7XA 4DUZB 2BZSA 3L7CA 3IBGA 2QIPA 4X97A 5HSGA 1FTSA 4CI0B 3C7KA 5B53A 2CCJA 3O8QB 5SICE 1ORWA 2CYBA 4MRSA 5F73A 3G89A 5IC5A 3V2UA 2PX5A 4MJ7A 3CEPB 1RHKA 4JUAA 3T4PA 4A0SA 1Q12A 4AG3A 4ZVMA 4C08A 4Z6KA 5IH7A 3EGDB 2NZ8A 2C9CA 1Z2AA 4LNUB 1GDHA 1I3CA 2PQ2A 4AF7A 3RHSA 4CKYA 1N2BA 3PGVA 3TLEA 4Q00A 3OLXA 5F5LA 1RFLA 2OPBA 4NOMA 5HKAA 1PNTA 3RFVA 2C8JA 1G2QA 2WZBA 3AEZA 1U1FA 3PDIA 1DNPA 2DTXA 2VK1A 3LIIA 4MUMA 1D4OA 1KEPA 3X1ZA 1MMFB 2IV7A 4Z9AA 2A9OA 2NAPA 5DCUA 1H6AA 5BVHA 3WB9A 3WJ2A 1J56A 1PVVA 3Q9LA 4QTTB 5LQUA 2VOJA 5BT8A 4PXAA 3AV3A 4BGEA 2W71A 3U3RA 4IMPA 5H3HA 3U1BA 4XYEA 4PTZA 5CGQB 2QPAA 1OILA 3PHJA 3GZNA 1DT3A 5DIZA 4B6EA 2PJDA 4BB0A 1BN7A 4Z49A 4N3NA 1T3TA 3KEFA 3ZYCA 3VJRA 4R54A 4EPXA 2YY7A 4HDQB 5DNEA 4QODA 3D6UA 1HGXA 3WGMA 3ZDFA 4Y1EA 5I9LA 2I4IA 2ST1A 4ZO8A 1UDRA 3FDXA 4AZSA 2NO4A 4JI6B 4Z1MD 1M75A 2GZRA 5TPZD 4MUYA 2AEMA 1R4NA 3F6CA 1U3FA 3FNFA 4I66A 3WHLA 5KSOA 1T4CA 2RHBA 4BN4A 1JV2B 1ODLA 2PWPA 1E79A 2V97A 3G9ZA 4QKQA 5DM0A 4XM0A 4ZQGA 3H9BA 1NLMA 1IXKA 4Y2XA 3VR3D 1KS9A 1Y1TA 3I23A 4N5HX 4YECA 5ALXA 3ZV6A 3V4SA 1T0UA 1A8SA 1YJ5A 5FB3A 1FX0B 3KO8A 1M7GA 2GNPA 2NZVG 3I1YA 4L95C 4XFKA 2VNIA 5FOUA 5LPNA 3FPCA 3A1CA 4LBZA 5B2FA 4OMUA 3S2YA 1J25A 4U39A 3VKWA 2Y1WA 1AMOA 2WI8A 2PX0A 4E11A 4ETWA 4L5YA 5C8XA 5JXWA 4HADA 3ROQA 2AG8A 4MP6A 1X2EA 1IM8A 5E1DA 3BRWA 1W6RA 2DWUA 2DWPA 3A8TA 3N8KA 2BHNA 3L8MA 3UYKA 3WQRA 2J6CA 2V65A 4LOLA 2RHMA 2WUVA 3N7UA 4JU9A 1A98A 4HGRA 4MYCA 3W5VA 3MCTA 3BZWA 2Q6KA 2E4XA 5TEWA 7ABPA 3RUPA 3EPHA 2CN1A 1XJ5A 5CA1B 4LRUA 5ALLA 1IN8A 4KIUA 3IEKA 3VHLB 4M98A 3A05A 2P69A 4CN9A 3OE4A 3R4CA 1Z56C 1XZPA 3E3AA 3R0QA 3RS5A 5EA2A 3R41A 1L7EA 1TM4E 4M9QA 1QKKA 3NBFA 2HFJA 3JWEA 3NCHA 2LVBA 1LNZA 3I09A 3KVYA 4N6NA 3NVAA 5J47A 2O1EA 3RVRA 2VN8A 1E7QA 1YULA 1TDJA 1REQB 2YYYA 3HY6A 3I8XA 3KJHA 4Y9SA 4QPPA 1ZAYA 1NLZA 4BU0A 2FV8A 4XEUA 1X9GA 2H57A 1LPNA 3NM4A 1GJRA 3JD1A 4FGKA 4J0IA 1YB2A 4MR7B 4H18A 1G5TA 2WJWA 4EENA 2GCOB 3QTTA 4J1NA 3RSZA 4L2IB 1C2TA 3SSAA 4BZWA 1OZFA 1U3GA 2QMZA 4KLNA 4QHSA 3N87A 3L6DA 3KQMA 3RIEA 2FPXA 3SIXA 4QFDA 2I3BA 1ACLA 3HPQA 4H7KA 5DM60 1ORTA 4RE6A 5L3VA 2CT8A 2C8KA 2YXBA 4NYMR 3F9IA 1G6OA 3EIQA 3UWOA 2R97A 3MAJA 2ZPTX 3O7MA 4RF2A 1MJFA 4HB0A 5JMPA 1WP9A 1GHTA 1CEQA 4JSTA 5TT1A 3CTPA 3NONA 5KNDH 4RQUA 3BDIA 1WW3A 5G1OA 1SC4A 2F3QA 2AIRA 3N2NA 4DSAA 2VDQB 1CB0A 4C7BA 1OBOA 3PJEA 1IL0A 3TO5A 2WSYB 1UBNA 5TMPA 1UDWA 1TTPB 4EB0A 3QX9A 5DP2A 3TZ6A 4OQDA 3IL2A 4I8XA 2QQ0A 1T3ZA 4IVPA 5BYJA 1F12A 5EXXA 3V4LA 4CGZA 3W5CA 1U0HC 3ZIUA 4LECA 3SSNA 2P35A 1LBSA 3PZRA 4BMPB 5HKKD 2CUKA 1FJHA 3SM3A 2WV9A 4D46A 4ZOLF 3UGTA 4O4JF 1TF2A 3BAZA 2JG3A 5F1OA 3ZDYB 3R0IA 3I8OA 3AKEA 3HCOA 4OB6A 1HT3A 4LGYA 1O8BA 3MFYA 4YUWA 4JT9A 5BR4A 4B5LA 3C3KA 2F2TA 1IY2A 2DHRA 3A9CA 4Q7EA 1QCYA 1IRIA 4BEJA 4DR6B 3FWNA 2M32A 3QEMB 2BRUC 1BOOA 1K9VF 1HRKA 1PR0A 4H6WA 3UVEA 4BJ6A 3JQQA 1NHGA 4J91A 1YR2A 2QZ4A 2PGJA 2WM3A 3MGGA 3KT3A 1XQVA 2ZVJA 2J7PD 1Y7LA 1VG0B 2YDXA 3ESBA 3KKOA 4RK7A 3VAZA 4P84A 4UOEA 2HPVA 1JG3A 3PFBA 4F06A 1POWA 1KOJA 1TMKA 1KSGA 4CV3A 4F4IA 5IU6A 2YYSA 3VZQA 5AKYA 1J00A 1JYSA 1MJGM 1QYCA 4F0JA 3PKIA 1S0UA 4UM5A 5CB0A 4S2EA 1YZKA 2JASA 3NGLA 4JY7A 4LY9A 3VR4A 3ND9A 4PAOA 5KIAA 1ZJ4A 3I2JA 1OHHD 3GCZA 4JJ6A 2PCLA 1YDEA 4JBHA 3VDNB 3I52A 2RG7A 3W2FA 3EVAA 1XMSA 3DZIA 1LNQA 3FOWA 4ZU1X 3OETA 1A7JA 5CR9A 5AK3A 1YZNA 1SZDA 1FS4A 3DUWA 1XZ8A 3CZQA 4RJLA 3SC2A 4UARA 4B3FX 1QQAA 1A2KC 1JEEA 4MMZB 4CM4B 1RZ3A 1H2RS 1YJCA 3IOBA 4TMKA 5I7UA 3STXA 4A2PA 4OHVA 5AVJA 2DB3A 4JYCA 4P2BA 4X3CA 4J0GA 1ZOOA 4BE9A 4MW7A 3HA7A 3I9OA 3N2GB 3JWGA 4N3CA 5IBRA 1SVWA 3RANA 1I2AA 4P6VF 3SSMA 3C6ZA 3K94A 4GC9A 3ZU4A 1MD9A 1U9IA 3IA7A 3UJ8A 2HO4A 4BNDB 4ZEWA 5ADWA 1IJBA 1GLVA 3WBKA 5L95A 4WUVA 2W2OA 3RBXA 3QPBA 4BO8A 3L02A 4U00A 1P19A 4JLVA 5DTJA 1JDSA 3QU4A 1QTRA 2P4QA 4ER7A 3HRIA 3QVWA 4OGFA 4BVBA 4RJTA 3PDJA 4MGHA 1Y5LA 1OAOC 3S27A 1R12A 3G5TA 3LKZA 4PVDA 4Q6WA 1ZOPA 1GDTA 4PAWA 2D4HA 2LV8A 2UUPA 3FDJA 3LT4A 4IJUA 4UZEA 5LUAA 3OO1A 3ANXA 4LOAA 2IW1A 4KZPA 1MO5A 5FUQA 4ZCPA 4BWFB 2YJGA 1P2TA 4GS5A 4AZTA 3D2LA 3WMWA 1KK2A 2QE7D 4HXEB 2XE4A 1SEPA 3FMVA 3EC1A 1GPLA 4CLDA 4E08A 1H1TA 3PSAA 2EBHX 2XLCA 3Q0TA 3GPLA 4PPNA 1AXRA 2QTVB 2ZIXB 3AVOA 4O4JB 2ECKA 2WFAA 3HXLA 2EAUA 5D3MB 4BPRA 4WGGA 4DLPA 1JS1X 3R8CA 5BN3A 4ZT3A 3DW3X 3F74A 4TWJA 4PC3A 5K2MA 4Q4CA 1L7RA 4RTJA 2IY9A 1SOVA 2OBLA 1NM5C 3SF8A 3LD9A 4OSPA 1DGQA 4U7HA 2PD6A 3KAPA 1PNQA 4L28A 1YF3A 3TLKA 4C4AA 4Z4QA 1PGNA 3LY8A 2NLOA 1UBHS 1ZXLA 2H1VA 3W1VA 1HDCA 3WB2A 4GGPA 4CV0A 2YJ6A 1SELA 4QPCA 5EPOA 1JSXA 5EKSA 5B7QA 2PWBA 4RGVA 4D56A 2YVKA 3ADBA 1CUIA 2C95A 3JVVA 1B6GA 5KINB 3BWEA 3ISTA 2GRUA 3QVXA 4I4TA 1Y33E 1Y8RB 4C14A 4G1UC 8LDHA 3NALA 4L0QA 2XKKA 3EGIA 5LBTA 5KREA 3CIFA 4B3GA 5KJEA 2BUAA 3QXCA 4L5AA 1NU8A 1KJWA 2E21A 2QRJA 3AKYA 3QEKA 5IDVA 3CNNA 1Z0JA 3KTOA 1QZTA 4OBBA 5EEGA 2C4TA 2A84A 3HBFA 4P4GA 4PZLA 1CK4A 1RR6A 3KB2A 2NV2B 1XEAA 3JASA 5ERXA 1G3MA 5LBIA 1BU5A 1E1CA 5GONB 4E12A 2EFHB 4DIKA 3QH4A 2VT2A 5JBIA 4IO1A 2XNDA 5A4KA 1E7YA 3ZVRA 4RD0A 4JUDX 4MGEA 2WZQA 1BE8A 4LTNA 5KX5B 3PEWA 1R6TA 4FS8A 1SUFA 1V1RA 3P2EA 4QGGA 3VZBA 4ZZ0A 3H04A 5TPWB 1I51A 4QXOA 2AKEA 3B12A 3VV3A 3R7NA 1N57A 1VBFA 1Z25A 4M7PA 2UU9B 3CW9A 1X1EA 4Y2YA 3AF2A 1E2GA 1QIJA 1R9GA 2ODNA 3KLBA 3MWEB 3S1SA 2J0QA 2J7KA 1EFHA 2GZMA 1KO4A 2WMYA 3FN4A 2XRZA 1EFRA 1HK7A 2HSZA 3W2EA 3D3QA 4CCSA 5H5JA 4HNGA 2Z56A 2JAPA 2PGIA 3BMQB 1KMHB 4Y2SA 3TXAA 2JLZA 2XJ9A 3FWZA 5JE8A 1N32B 1Y8AA 5F12A 3LC1O 2QNRA 3TD6A 5HG0A 3SM9A 4GOLD 1O87A 3RPEA 3V4FA 2GT1A 3FTQA 3FUXA 2B5OA 3GXOA 3UO8B 1B8VA 3VVMA 4K3VA 1Z12A 2OA0A 3WOVA 1BDBA 1K1EA 4PYNA 4MVJF 1HOTA 4ND3A 2X7JA 2E7ZA 4LYJA 1ZH6A 3CKYA 2VFAA 2NACA 3SMVA 2V3CC 1V7CA 5A62A 3PA8A 1F8FA 1QRAA 4BNKA 5JCZA 4ZCLA 5EWLB 1QR2A 4YT2A 3BHMA 3UH0A 4AULA 5KX5F 1MIOB 2GAFA 4MV1A 1TMYA 1JE0A 1P7WA 2FVXA 3LRXA 4UAJA 3TQTA 3AKCA 3NNDA 3SDSA 5KYWA 3T1YB 1AX9A 1Y98A 3G85A 4JGBA 1WL8A 3VNQA 4F4JA 2Z3VA 3H1EA 4CNQA 3UKOA 3E18A 3HBNA 4R51A 1AB6A 1L4LA 1HO3A 1XLVA 5LD2C 2D06A 3HJCA 4DLRA 1H5NA 3FMOB 3IILA 4P1ZA 4BX9A 3QKRB 5HQ3B 1G3RA 1AOXA 1A96A 3TOCA 3HB1A 5LIRA 3KXKA 5C1IA 5BSEA 4JOCA 3IRUA 4EX6A 5FUVA 2LCFA 2G4LA 2GB4A 2YOFA 3PCTA 1MT3A 4YV0A 1AKEA 1VYHA 5M34A 4FZRA 2QL5A 2QTVA 2CXSA 1DQNA 2OCGA 3BB4A 2HWYA 4L5CA 1CE8A 3U3OA 1U7XA 1BKYA 1P1FA 4QOSA 4MQ5A 4XVQA 4FEYA 4YLYA 1M74A 4DKXA 3WGVA 1NW6A 1UADA 3GD5A 3P9ZA 5P21A 4G8BA 2I67A 1E9FA 2YFHA 4N0QA 1BCRA 1XMXA 3CZ9A 4R2XA 1XSEA 3K05A 2O8EA 2R2AA 4FZJA 3SX2A 1GIAA 1RC0A 2PX2A 1MEOA 5FLYA 1Q7GA 2A0KA 1MB9A 2ERYA 3WDSA 4B33A 2Q9AA 3OFVA 2FMTA 4XLLA 1CD5A 1EUDA 3GMIA 4HVLA 2EXXA 2QN3A 3X1KA 1I7DA 3IEVA 2HRRA 3TQRA 2B78A 5FUXA 1WUKS 2C29D 2GCGA 2R4QA 3RU9A 1X86B 3W8RA 3FLAA 1Z7GA 4FZVA 4A8HA 1XVTA 3NWEA 1N34B 5AW5A 4I14A 1KI3A 2HMUA 1E60A 4PCVA 1G5RA 4CM4A 2AR9A 1FP2A 3AFOA 5EVCA 3WXBA 1A8HA 4NDNE 4QVKA 1G8MA 2IPAB 4Q7QA 3KCNA 4L9SA 5I48A 1MDBA 1MQAA 3EMBA 4HGZA 5LC1A 2ZYIA 2ZRJA 4WCFC 5JBQA 1C30B 4R4JA 4H4EA 4Q3AA 3T3EA 1U3DA 5AVZA 2R6DA 4K5QA 2C2MA 2MR5A 4OFWA 4OXQA 1WD7A 3MCZA 1YCHA 3JAWA 5MGNA 2VF5X 3KELA 1RE0A 3GJTA 4KQIA 2VOEA 3A4VA 2HPHA 3HI4A 2OC4A 1G9SA 1UMCA 3EBLA 4HWTA 4AP6A 3AM4A 4Z0TA 2O8CB 3H16A 4RDHA 4JU8A 3DEFA 1AHNA 2YJTD 3OJOA 3HY4A 4MHOA 3SDBA 4NU5A 4G4SO 4H7HA 2AOWA 4DVJA 3WAJA 3ABSB 4P4SB 3R1IA 1TX4B 2I4RA 3DKIA 4P7JA 1EE9A 1GL9B 2V98A 5LYJA 3PWSA 3IJPA 2KJQA 3OM0A 3GI1A 4P7BA 5I9IA 3KUXA 5DI3B 1KHHA 3EW9A 3HA3A 4OJKA 5AHOA 3PQCA 1QYDA 5EP4A 2GN0A 1XR3A 2IXBA 3X1JA 3GD7A 2HWXA 4TQAA 3QLVA 2GUWA 2PLWA 4F91B 2WT8A 1GL3A 1VE9A 2WBLC 3HKCB 4B34A 1XHLA 2GFIA 1ZK2A 2Y27A 1P7PA 3CX3A 3M1YA 4GQBA 2ATCA 1X7YB 3V2IA 1OPRA 2Q99A 4LXUA 2Q5EA 2I54A 4L0MA 2XGJA 2VS1A 5COBA 1E89A 2PSDA 2GJ9A 1PBTA 3AJ9A 3NU1A 1DQRA 4Y7CA 3AM1A 2CV0A 3MFQA 3T54A 1PZFA 3FAKA 3ABQB 2D5IA 1FMCA 4RPCA 1BHSA 2BGGA 2VR1A 5I9TA 3A37A 4ZREA 3HR8A 1FPQA 2YIJA 4B3TB 1RMTA 2CEAA 2PKWA 4UHDA 4BQRA 1UC4B 2EKPA 3PL1A 4RVHA 2EJVA 3ROZA 1YQXA 2I62A 3ACCA 4BLWA 1E20A 4YIHA 5LQJA 3EXAA 1RXIA 2QQ5A 4HB4A 4MW5A 3CLHA 5ESWA 3HCEA 3SC4A 1M2VB 1W9HA 5EHXA 4INZA 1X13A 1OBFO 2G63A 4YJ2A 4JHXA 1VECA 5ILOA 3FBGA 3RTGA 3QUBA 3ZQ4A 5CB8A 3FGNA 1YJBA 2I8LA 1EIZA 2DZDA 2FW7A 2HCTA 3BIFA 3BCUA 3NH6A 3V4VB 2C7PA 5SYMA 5IKPA 1PW7A 2IXTA 2VP5A 3IE0A 2WWRA 4I1RA 4IDHA 5T6BA 4C0HA 3CC8A 2R60A 4CCYA 5JVDF 5K99A 3NMUF 4DKJA 3W8FA 3IQEA 4Q24A 4FK8A 4MCIA 4JIGA 1UJMA 3JAMA 4CF3A 1EVYA 1T1IA 5FRDA 3AGQA 3LK7A 3BL5A 3G8YA 4ASUA 1UWLA 2ES4A 1F2UA 1ULUA 3FI0A 3UV3A 4C88A 2A5YB 1VBKA 4CQLA 1REQA 4HFRA 4OB8A 1TEVA 2P9EA 5WRFA 3AQIA 1B14A 1YBHA 3O9MA 2PKXA 5F21A 2Y93A 1LDEA 1RT9A 2A14A 2O2DA 1X6VA 2YDYA 1Y80A 3OLVA 4KO3S 2FZEA 4QFBA 3WGYA 4JKYA 1N2SA 3PC8A 1RSZA 1UAAA 1C4WA 3FPSA 2W11A 3L01A 4MKZA 3GVIA 1YR9A 1EE2A 3FUCA 4XI9A 3LWZA 3U9LA 3PFCA 4WN3A 1KI4A 4PBTA 4O3FA 4ZWNA 2WQ6A 3WICA 4DJAA 1VMKA 3OZGA 3OX4A 4Z99A 3K8QA 2V0NA 2ZUFA 5TLSA 3JRWA 4URUR 3NANA 2X0RA 2FTKE 3U7EB 2VHCA 3HB4X 4LF5B 1LZKA 2D2XA 3E9MA 1EU1A 4AQYB 1X7GA 1BX3A 1GLNA 3PHIA 1ORVA 3IKLA 4GYKA 4UPDA 3VDMA 3B1ZA 2H4JA 3JQGB 1JUDA 2FN4A 3AH8A 3ANYB 2NTJA 3FOBA 1DKOA 2VIIA 4TSKA 1EQ2A 1ZIDA 3FH0A 2SBTA 2W2KA 4F4HA 2VSXA 2ZBUA 4NHEA 2EW1A 3WL8A 5JZOA 3KX2A 4IXNA<