3BA1A

Structure of hydroxyphenylpyruvate reductase from coleus blumei
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
312
structure length
312
Chain Sequence
EAIGVLMMCPMSTYLEQELDKRFKLFRYWTQPAQRDFLALQAESIRAVVGNSNAGADAELIDALPKLEIVSSFSVGLDKVDLIKCEEKGVRVTNTPDVLTDDVADLAIGLILAVLRRICECDKYVRRGAWKFGDFKLTTKFSGKRVGIIGLGRIGLAVAERAEAFDCPISYFSRSKKPNTNYTYYGSVVELASNSDILVVACPLTPETTHIINREVIDALGPKGVLINIGRGPHVDEPELVSALVEGRLGGAGLDVFEREPEVPEKLFGLENVVLLPHVGSGTVETRKVMADLVVGNLEAHFSGKPLLTPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxyphenylpyruvate reductase
publication title Structure and substrate docking of a hydroxy(phenyl)pyruvate reductase from the higher plant Coleus blumei Benth
doi rcsb
source organism Solenostemon scutellarioides
molecule tags Oxidoreductase
total genus 109
structure length 312
sequence length 312
ec nomenclature ec 1.1.1.237: Hydroxyphenylpyruvate reductase.
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ba1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ba1A01
2JD1A 2PZMA 1RKXA 4FPXA 3ROQA 4ALJA 2Y1CA 1QG6A 3L9XA 4Y8VA 1BDMA 3NTRA 1GQ2A 1PJTA 1SB8A 3W4KA 4U6QA 1DIGA 2NTVA 4MIOA 3PYMA 5IN5A 1V35A 2WSBA 3AUAA 1I24A 2NM0A 4TVOA 4IQ0A 1NWCA 2BLLA 2CDCA 5BT9A 4IGFA 1LNQA 1QYXA 3GGOA 4GPD1 3HJAA 4I5GA 4J91A 4OAQA 3FNFA 1YQXA 3FHLA 2V6MA 2ZJ1A 2EW8A 2BGLA 4DRYA 4XIYA 3NRCA 4BNGA 1RM3A 4CMKA 1A4UA 2HMSA 1PGPA 3O26A 1KETA 4II2A 5IDWA 3AM3A 5JAQA 4L0QA 4R41A 1PJCA 1EUCA 4JROA 3G3EA 4ALKA 3I5MA 1LLUA 1GDHA 1UZMA 2P9CA 3WYEA 4LCJA 3WB9A 1AN9A 1H2HA 1JU9A 1Q1NA 2VWQA 2G5CA 2Y0CA 3L9WA 2OBYA 2QYTA 4RF2A 1I0ZA 4XYEA 3UCEA 4J4BA 4RF4A 1HDRA 1U8XX 1GCUA 2X23A 3F5SA 3ULKA 2IE0A 1Y6JA 3GF4A 4MVJP 4MO2A 1JKIA 4Z9FA 1GTMA 3JYQA 1C14A 3JYNA 2PGLA 1WAMA 1Z74A 3DR3A 4XB1A 5L7YA 1ZSNA 3DAFA 4Q3EA 4ITUA 2EHDA 2I6TA 5FI5A 4NIMA 4N18A 4UUNA 1PL8A 2XXJA 2O3JA 4XQ9A 4KZPA 3BMNA 3WSWA 1I2BA 3WYCA 1HL3A 1QYWA 1YDEA 3KXDA 4EJMA 5FI3A 1E3JA 4NJOA 3UCFA 4RVHA 4FJ2A 3T7EA 2HRZA 3QRWA 4I9UA 2UUPA 6ADHA 3RUEA 3WMWA 3PFWO 3RFVA 1V3TA 3GN1A 3V1TC 3WICA 4HFRA 3Q0EA 2ZQZA 1ZK0A 3T4EA 3PHLA 4F6CA 2OL4A 3H4VA 2BELA 1WMBA 3VH2A 2BMAA 3NYWA 3GH3A 3OIFA 4JGBA 1IZ9A 4WGGA 5L9AA 1NPYA 1KC1A 1BHSA 3R1IA 3A06A 2I3AA 5KJEA 4BGEA 3VPXA 4OMUA 4XZ3A 2O3QA 5I8ZA 3PPIA 5DNAA 4YJGB 1MLDA 2B35A 4N5NA 4UVHA 4FFOA 1G0OA 2PFGA 3W6UA 1W0CA 3PGJA 4WLUA 3H5NA 5TJ9A 1V8BA 1FDWA 4IQGA 3D5QA 4XJSA 4HY3A 3H9QA 4PG6A 3I4FA 4BKPA 3INGA 1LLQA 3QV1A 1B15A 1CETA 1PJBA 2G1UA 1P0CA 3AU8A 3DO5A 4R4JA 3ZCXA 3AM5A 3CPSA 2XOXA 3EK2A 1CRWG 4R54A 5L4LA 1HF3A 3PDJA 1ZJYA 2GN4A 2Z1MA 4Q39A 1SZJG 5CPBA 4XDZA 1CF2O 1OC4A 4WEQA 2P5YA 1ENPA 4GMFA 4NQZA 2FZWA 2JD0A 1ZK4A 2NSDA 4Y98A 2P2SA 4CR7A 1K2WA 3F5QA 4YAGA 2A9FA 1Z73A 2OP1A 4EI2A 2X0NA 3DC2A 1BSVA 3RSHA 3AFMA 4OJNA 3UGKA 5ER9A 2BD0A 2X9NA 4BQPA 2YQ5A 4DQVA 2ZKLA 4JLWA 4BO9A 4UULA 1GY8A 1EQ2A 1NFQA 1NASA 4RDHA 4TRJA 4IJUA 2BKAA 4FW8A 4WASA 4I9NA 2DKNA 5L53A 2AEMA 3UHAA 3I9MA 3MCVA 3AI2A 4IJVA 1R37A 3EHEA 3NTQA 3FPCA 3KO8A 2QIOA 3HN2A 4YRAA 2WE8A 3WGTA 4WK6A 2CFCA 1HKUA 1NR1A 3NT2A 3B6ZA 1PL7A 1R66A 3WGQA 4XRRA 4E6PA 1CEQA 1NWHA 3A28A 2EJWA 4ID9A 3Q9NA 3CUKA 4HP8A 4I5DA 4WCFA 3K30A 1YOVA 3O8QB 3ZW9A 1XCBA 3ZWVA 3WLFA 2PGJA 4ALMA 3TOXA 2E48A 1PS0A 1KY5A 4ZQFA 1NP3A 3P2YA 4E5YA 4AJJA 3RD5A 4U0JA 5L3ZA 1KVTA 2EKPA 4LISA 4NDNE 2DFVA 2AQHA 3DBHA 5T64A 5TT1A 5KVSA 2VTDA 5LDGA 4GL4A 2B83A 2OORA 1GQQA 3LYLA 3M6IA 4FSHA 2VT3A 4YJFA 2IZZA 2YDXA 2E49A 3LT1A 1PJSA 3OQ6A 5G4LA 5IZCC 1UH5A 1HSZA 2Q2WA 4BUCA 3FBGA 5JNLA 3QVSA 4NBRA 1M76A 2AE1A 2X4GA 2CZCA 4YAEA 4FGWA 3VVBA 1BTOA 3M2TA 4RGBA 3S2FA 2DTEA 2FR1A 1GCOA 1I32A 2X5OA 3JQ9A 3RU9A 3G79A 4LMPA 4URFA 3O9ZA 4BO5A 1QMGA 2FR0A 4BIIA 5HS6A 1QXSA 4CMEA 1DO8A 3PYLA 3U49A 1Q0HA 1KVQA 2WYUA 5TGDA 1ZVMA 1UXKA 5COAA 1WDLA 4M8SA 3LT2A 5JPIA 1NFFA 4EW6A 1P1IA 4YB8A 1E7MA 4ZQGA 5IXSA 4EGFA 2Q1TA 3QVXA 4W9NA 5C37A 2P4HX 4NU6A 5JCXA 3W8EA 2PTGA 3PGXA 3ANNA 2ILTA 3WIDA 5KWEA 2V6BA 1LQTA 3MTJA 3ZW8A 4ONEA 1ZSYA 1HYEA 3GRPA 5JDCA 4CODB 5JAIA 1P44A 2QW8A 1YDWA 2QRLA 2YHIB 3OA0A 1JKJA 1YONA 4CM8A 3KLMX 2Y0EA 3FCOA 4Q3BA 2E6UX 3EGOA 4GVLA 1P0FA 3NT4A 4CUZA 4DYDA 5JO9A 4N7RA 3GMSA 5EERA 2DLDA 4M89A 3JYPA 3FBTA 2C07A 2AG5A 3FWNA 3RASA 5TS3A 1FJHA 4I8XA 4L4XA 3VZQA 3UAGA 1SBYA 1SO8A 2C59A 4UEJA 2Y05A 2QX7A 2V7PA 2YUTA 3A4VA 5T5QA 3JD4A 1EBUA 1ZH8A 2RIRA 4E2ZA 4PG8A 2VHXA 5AXCA 4AJ1A 1D7OA 2ZYGA 2Q1SA 3DHYA 1DIRA 3JQ7A 1PGNA 3JD1A 4B79A 4ZRNA 3E1KA 3HDJA 4BNFA 3DMTA 1QRRA 4IIVA 3PP8A 3RWBA 1O6ZA 4GBJA 4ZGWA 1WPQA 2B4TO 2I3GA 3AUUA 3JYLA 4FJ0A 1LDEA 2QZZA 2E37A 5I9NA 3LSYA 4U6SA 5K6AC 1WWKA 4FFNA 4XR4A 1T4DA 5A9SA 2DTXA 2DM6A 1U2DA 2O3UA 3BHMA 7MDHA 1D1TA 3JQ6A 1QYVA 1E6UA 1EVJA 1SOWA 1M75A 4BO6A 4YJDA 1K3TA 1DC3A 2BRUA 1MGOA 3FD8A 1V9LA 3JTMA 4J7CA 4QTZA 3WJAA 1X7HA 4FDAA 4HNHA 2DBVO 3E48A 3SJ7A 1NQ5A 4OIMA 4GWKA 1LSOA 2GZ3A 1E3SA 1ORRA 3A14A 2X9VA 4WUVA 4PG5A 2O3RA 2O48X 4GI2A 3UXYA 1Z45A 3QWAA 1M6HA 3TSCA 2G76A 2RCYA 3NGXA 1X0XA 5A3JA 4LGVA 5TJHA 3VZRA 3JQAA 1VI2A 3RBVA 1YQDA 2VUUA 2JL1A 3PJEA 1Y8RA 2EGHA 1U3TA 1PJ3A 3VPHA 1OFGA 3NJ8A 3N7UA 4Q9NA 1ONOA 4CR8A 4J4TA 1JQBA 4LCEA 3I9KA 2H9IA 4WOKA 3VH3A 1X1TA 4HUJA 5KJFA 2D0IA 3S2IA 4PLVA 5IXYA 3GA0A 1HDCA 1ULSA 4RF3A 4CM4A 3PVZA 2YHIA 3H5RA 4KQWA 1E77A 3PEFA 1R6DA 1YB5A 3HFGA 4BNIA 5JW6A 5JXWA 5G4KB 3TQHA 4NH4A 4LSWA 3WGIA 3WLEA 1B14A 2OOSA 3GPIA 2HJRA 1VC2A 3N74A 4GLLA 5GZ6A 1U28A 2VT2A 1P74A 3DMYA 3VDQA 4YDRA 5JO0A 3GPDG 2H1SA 2ZQYA 3GVHA 1FK8A 4XDYA 4PLPA 3BMOA 4M54A 1YBMA 3LF2A 3RU7A 1TT5A 3P19A 1ZEMA 3O03A 3MZ0A 2HMVA 1AGNA 1C1DB 5AYVA 5H82A 4IZIA 1SB9A 4FJ1A 3EVTA 3AI3A 4I5FA 2QZ9A 3F4BA 2VRBA 1R4NA 3GFGA 3HDHA 4DA9A 2AQKA 1UAYA 3Q2KA 3M1AA 4EUHA 3QVWA 4TROA 5G0TA 1KOLA 4M1QA 4OYRA 1H6CA 2GUGA 4CMGA 4BNXA 4UUMA 5B4VA 3ZU2A 2O23A 1OOEA 3TPCA 1KS9A 4YCAA 5IZ4A 3NUGA 1PSDA 4BKQA 3HFSA 3E8XA 3I9OA 1OI7A 1ZMTA 1JAYA 2R00C 5FEUA 2DTDA 4E2WA 3GR6A 3GDGA 5ICSA 2NU7A 4BO2A 3D1LA 1U5AA 4EUFA 4L9RA 3VZSA 2RHCA 1GUZA 2J6IA 4Z6KA 3L77A 2VUTA 4B3HA 1WDMA 2BFPA 1UXIA 3JQEA 3VAZA 4ZHSA 1E3IA 2HSDA 3GZ4A 4NJMB 4OL9A 3GZNB 2YFQA 3WQSB 2W98A 4MVJI 5FFFA 2I66A 3LC1O 4CM1A 2O4CA 4ZN6A 1EE2A 4GGPA 3ZGYA 4TRMA 1PZFA 3P7MA 4FFRA 4A10A 2D5CA 3QSGA 1PGJA 5B4TA 1LLCA 1N92A 4XGIA 2VYVD 4CMAA 3U4IA 2XXBA 2HK9A 5FYDA 1J6UA 4D43A 3I1JA 3C7DB 4J0EA 4Y9DA 4ND1A 2X0RA 1XGKA 4NFSA 4AJNA 5CDYA 3OEYA 4Q3AA 5DN9A 1I3KA 5BSEA 3RIHA 4YT2A 4CR6A 3AUSA 4MP6A 2XPCA 1H94A 1NVMB 1WP4A 1KEUA 1DJQA 3AOGA 3C1AA 3QW2A 2B5WA 1IYZA 1R4NB 1ML3A 2CD9A 2Q2QA 3LQFA 4CQMD 1HDOA 1PJ4A 3GGPA 4DMMA 4Y6PA 3RQSA 2X8LA 4LMRA 1UJMA 4MINA 4NPCA 5KIAA 1Y81A 2J3JA 3L4BA 3OECA 4AJKA 2PD6A 1K6XA 1ZXLA 3BMOB 3VVCA 4TWRA 1KVUA 1A7AA 4BB6A 4E2XA 2C82A 4XEHA 1FDUA 3STHA 5EESA 3KYDB 3OMLA 1A4IA 1LC0A 4DXHA 4F6LA 1PS8A 5A9SB 3VPGA 1P1HA 4ZD6A 4HWKA 4W82A 2O4UX 4DWVA 4YWJA 2JCYA 3ROKA 2X7HA 5I7SA 3KV3O 4YEDA 1NVTA 1LSUA 1YL6A 4WNCA 1NAHA 3KSZO 4EJ0A 3K2EA 1HWYA 1ZBQA 3AWDA 4NK5A 4MPDA 4CMIA 3O8QA 3FI9A 3DOCA 4WEOA 1M6WA 1MXHA 1OMOA 3H9UA 1N8KA 4RPKA 1IHXA 4E21A 3CMMA 4WOJA 1E1KA 4H3VA 1J4AA 3DFUA 3H2ZA 3TN7A 1ZW1A 3TF5A 3ASUA 3OJEA 3VKVA 1R0SA 3O38A 3RC1A 1RYDA 3DHNA 1LEHA 4OSPA 3B1FA 4JN6B 1BRMA 1EDZA 2FPPA 2E4AA 4I08A 4PG4A 4OO3A 3IJPA 1K89A 2R00A 4FFLA 2D1YA 4FFPA 1GYPA 4HBGA 4YQYA 1H93A 3EZLA 3JSAA 5JC1A 4XD2A 3TZ6A 5KJCA 1LI4A 4DGSA 5IN4A 2W2LA 3E03A 2PD4A 1C1DA 2BF7A 5IAAA 2D59A 2X22A 1DC4A 4LVUA 3JQ8B 8LDHA 1N5DA 2FMUA 2HLPA 5A02A 9LDBA 2G82A 3V5NA 5I8WA 4BNLA 1LU9A 1DFGA 1E7WA 3NDIA 4MKRA 5EMHA 5EINA 2B4RO 2Q2VA 4YQZA 1ARZA 4DYVA 3LLVA 2PA3A 3RROA 4NR0A 4QQRA 4XQEA 3OQBA 4BS9A 4CM9D 3TZHA 2Y0DA 3EVNA 2DBQA 2GYYA 4RPGA 3DBRB 1I01A 3H2SA 1EEHA 4TVBA 2PKQP 4K1LA 2X86A 5DOVA 2PLAA 4XKJA 1GYRA 4RQUA 2G0TA 3VH4A 3ZNNA 4OQYA 3I83A 1HE4A 1E0DA 1EQUA 1XU9A 2EKQA 1YO6A 1UP4A 1ZKMA 2BH9A 4Y67A 3KETA 2CMDA 2C5EA 4D3FA 1DC6A 5EQDA 3DQPA 1OC2A 3VPSA 1VJ1A 4ZVVA 3F47A 4HNGA 5ENVA 5KJ6A 1PJ2A 4XYLA 1BXZA 3KHUA 5CEFA 5I9LA 1PZHA 4L4SA 1IHYA 2Q45A 3CZRA 1ZUD1 1JW9B 1IOLA 1P1FA 4AJIA 5DF1A 1NQAO 4PZEA 4O1MA 5G0SA 3QP9A 5TQVA 1HLPA 4YVFA 4R51A 2I99A 4ROSA 4LW8A 2F1KA 3GHHA 1PQWA 3NGLA 1DEHA 4IY1A 1XKQA 3H9GA 2B36A 1ADGA 3UKOA 2GNAA 5DT9A 2ZB8A 4EJ6A 4DPLA 5I7VA 4XGKA 4EEXA 1CYDA 1F0YA 4BNMA 3AOEA 2ZJ0A 5F1KA 5BNFA 2EG9A 4WCFB 3L6OO 3D4OA 2CNBA 1MB4A 4BNWA 2CSUA 1E3WA 3D7LA 3CXRA 4JXKA 3PWZA 3BTUA 1KIFA 3E9NA 4PRLA 1EMDA 3DAGA 5BNTA 4IPTA 4LK3A 5L40A 3ASVA 1GZ3A 4XYGA 5JMWA 4CV1A 4DREA 9LDTA 1IZ0A 4KTTE 4Z0HO 4IDDA 4AJ2A 4HV4A 4MKXA 4U5QA 1D4FA 3TOZA 2C29D 4BGUA 4K6CA 5JCJA 1PR3A 3FR8A 3WR5A 1FDTA 5EL0A 5JAZA 4P22A 5B12A 3JCZA 1XU7A 5C7LO 3K6JA 1YBAA 4DC1A 4IZHA 5L95A 3CE6A 3DAPA 2POQX 2W2KB 4CLDA 4BO1A 4PLTA 4S1VA 1K0UA 2EF1A 4MVJA 4TKMA 3JQGA 1YS4A 1FF9A 3KYCB 2GF2A 3CTMA 4PCVA 2DPGA 2VUSA 2NLOA 5CDSA 3BA1A 3K31A 4RZIA 3WG9A 1Y5RA 4E31A 4KQXA 3IKVA 4GKVA 3QY9A 4E13A 1ULUA 3EZYA 1GL3A 1MC4A 4JBHA 4JNKA 3L4BC 4QXMA 2A94A 3MJSA 1IL0A 1EE9A 1HETA 2XAAA 1E1MA 3VPFA 4E0BA 4O0LA 1E1NA 4FN4A 4DLAA 3TZQA 5JBIA 4FD3A 3TFOA 4W6ZA 5CFZA 2NQ8A 2DPHA 1CJCA 4GMGA 3V1YA 3G17A 1P1KA 3DONA 3WGZA 5HM8A 1T2DA 3RUFA 4A26A 1I5RA 3D3WB 4NBWA 3COSA 4YTEA 2Z1NA 2OP0A 2HCTA 3V2GA 1LUAA 2X1HA 1SC6A 3OP4A 4KP7A 5CP8A 4JQCA 3KEQA 2IEDA 2VRCD 3HDYA 3RKRA 1A9YA 2I76A 1HDGO 7ADHA 1JLLA 1NBOA 4ZU3A 1V0JA 1P77A 5CG2A 2EIHA 2DBRA 5JYDA 1CDOA 3DXFA 1O89A 3ST7A 1LJ8A 4J1SA 3PHHA 2Y68A 4R3NA 1NPTO 1LA2A 3DZKA 5DZSA 5BR7A 4D0SA 3IS3A 4DPKA 1Z6ZA 2EW2A 2NUAA 1PZGA 1XA0A 2X0IA 4O59O 3INTA 1VSUA 4OKIA 4TQGA 4N5LA 5COBA 1WLYA 3IMFA 3NTOA 2BI7A 3U4DA 4J90A 3ICPA 5IDQA 3H7AA 2VNAA 5F3RA 2RBEA 1SPXA 2GERA 1YRLA 2Z5LA 2IDZA 5KJ1A 3H3JA 2NV6A 1ZK2A 3VC7A 1T2CA 3BTOA 2NU8A 2UYYA 2QQ5A 1Z75A 1D1SA 4B4UA 4YRBA 3ZWMA 3KTDA 2FP4A 4XRGA 2FSSA 2B0JA 1V3UA 4DMLA 1GFSA 2W90A 4ALNA 5EPOA 2GPTA 4RZHA 1DXYA 2NU6A 3OQ1A 1OZAA 3GVPA 3WTBA 4UREA 4B4OA 1VKNA 3Q2IA 1DHTA 1EFLA 3GNSA 4CLRB 1ENZA 5GY7A 1TT7A 2EGGA 4YJFB 3OJ0A 1KY4A 2CVZA 4J43A 1LSSA 3GEDA 3PHGA 2OMEA 3CMCO 3PI7A 3U0BA 2PV7A 2WYWA 5KTKA 3EUWA 2FY8A 1YE3A 4BNNA 3ZI0A 4X54A 4BL5A 5JY1A 3MJEA 3PK0A 4G5HA 4GX1A 1NR7A 1JWAB 4Q3CA 3IOYA 1FXSA 3AFNA 2J5RA 2AG8A 2HMTA 4ILKA 3Q6IA 1MV8A 4LN1A 2QHXA 2GN6A 1EUZA 2NTNA 2Q1WA 4MVJF 1XELA 2VRCA 4IINA 2LDXA 1YGYA 4DLLA 4EBFA 3GAFA 4RVDA 2WYVA 2Q50A 2FSVA 5EQFA 3S55A 2GZ1A 2I5PO 3U3XA 2JKVA 3BZUA 1XIVA 2FOIA 4YAJA 3MJTA 1CWUA 4PVDA 1CQJA 3FPLA 2UDPA 3I52A 2VN8A 4E33A 1IPEA 4A73A 4BGVA 1JKFA 5JCJD 4GKBA 1Y7TA 5IDYA 1ZFNA 2EXXA 4K28A 3MWEB 5A04A 3ZZNA 2WMDA 3DDNA 4UVDA 2A92A 1WVGA 1BMDA 1VJ0A 4RO0A 4OGWA 4R9SA 4J49A 5HBRA 2IODA 1LRJA 5CEEA 4M87A 1E6EA 5T57A 2C54A 2H63A 3CKYA 3WQRA 3FTNA 3RBXA 1J0XO 3HE3A 5U1PA 1XEAA 1Z7BA 1F8GA 2B69A 3CINA 1B26A 4IBOA 1DLIA 4GLOA 1PWXA 3OEWA 1P45A 4KUEA 4MKZA 5T8KC 4S3MA 4D79A 5B4UA 3TJRA 5G4KA 5U4QA 2DAPA 2PD3A 1YKFA 3PJDA 1E92A 1EVYA 3TZCA 1MFPA 3ZV6A 4BVAA 2FN7A 3BMQB 2NADA 5TC4A 1DRWA 2DQ4A 5GZ1A 3ZWNA 1EDOA 1EVZA 2JAPA 3JD0A 4EUEA 2CVQA 4FR5A 1ZNQO 2Q99A 4I5EA 4WPGA 3GOHA 2IRWA 3TL3A 4IDGA 1GPJA 1ZEJA 1D8AA 3JQAB 3QA9A 4EDFA 2BFOA 1VJTA 4RL6A 4HKTA 3HQ4O 4CM6A 5CEJA 3W4JA 1DHRA 2NQTA 3LT0A 2ZTVA 4CUJA 3LF1A 4IS2A 3ZWBA 4OH1A 5A03A 5JSFA 1RJWA 3GZNA 2W4QA 1TEHA 1QYDA 3IL2A 2DFDA 3AK4A 3VHRA 3WMXA 4AG3A 1HE3A 1A71A 4J7XA 4B7UA 3KYDA 1XQ1A 4PGFA 1H6AA 4Q3DA 2ZCVA 3LDHA 4RLHA 3LVFO 5AQ1A 3QIVA 2PZJA 3EYWA 2PK3A 4RVGA 2Q4EA 2Y1OA 2B4QA 3F1KA 4RCVA 4TRNA 1JA9A 3WFIA 1OAAA 2PZKA 3BTSA 3H5AA 5C3MA 6LDHA 2YYYA 3OHSX 4HFMA 4W9NC 1GPDG 3JQ8A 2AQIA 5L51A 3WWYA 5L45A 1SNYA 3DZIA 3NEPX 3ONEA 2OFPA 2ZTUA 3KSDO 3V8BA 3IJRA 4ZRMA 3JQDA 1XSEA 5CAEA 2V6FA 3OJFA 1JVBA 2GSDA 3WSVA 1I33A 1VL8A 4K6FA 1KEVA 3NKLA 3ZDFA 4LRTB 1I3LA 4WNIA 4CMCA 1U3VA 4II3A 1BW9A 1LRLA 1DAOA 3LC7O 2A35A 4QUKA 4Z0PA 3MJVA 1F17A 1HE5A 3IUSA 1ONPA 4PLWA 4D42A 3PYXA 5GZ3A 3OH8A 1Q7CA 5F5NA 4NFHA 4HXYA 1T26A 3C24A 4KWHA 5K6AA 4JJFA 2VHZA 1XDWA 1RWBA 5I7FA 4NZ9A 3F3SA 3K2BA 3D0OA 3K9QO 2GZ2A 1OBFO 3SC6A 1DIHA 1B3BA 3E9MA 5JDIA 1B16A 1A9ZA 4O63O 3KZVA 1QSGA 1RM5A 4J1NA 3F4LA 3UUWA 4DIBA 4NG5A 4G65A 1FDVA 5ENDA 3HG7A 4CM7A 2CF5A 4GQAA 5F1PA 3W1VA 4BKOA 3FTPA 4M55A 1W73A 1V3VA 1F06A 1YB1A 3Q1LA 4CLOB 3BTVA 4CQMA 5MGBA 1HYGA 3IKTA 4WLNA 3RUAA 2EJVA 1VKOA 2V65A 2EERA 1ISIA 3PWKA 5IDXA 4WLVA 2FRDA 3M2PA 1NFRA 1MG0A 4NBUA 1UP6A 3GFBA 3K96A 4WCFC 4G2NA 4YRDA 2FWMX 1LTHR 5ITVA 3TDKA 4BO4A 1PJQA 4G81A 3I6QA 1HT0A 1Y8QA 2I9PA 5JYEA 1BXGB 4NU5A 4FC6A 1AUPA 4WCDA 3G49A 4Y6RA 2J3HA 5KOIA 4H16A 4E30A 3SC4A 1V6AA 4B7XA 5TLSA 3FRJA 4QEDA 1LX6A 2BI8A 1XG5A 4CL3A 3K92A 2PGDA 5LC1A 2O50A 2X9GA 1GUYA 2J5KA 3JQ9C 1NXQA 5G2OA 1NQOA 1T25A 2Y99A 4GH5A 3FNGA 4PVCA 4A27A 3A9WA 1NNUA 1LSJA 5DP1A 2PH3A 2YV3A 4BO8A 1RPNA 1PGOA 3WX0A 2B5VA 5JC8A 4P8RA 4B3IA 1C0IA 1B0AA 3GG2A 3JD2A 3GLQA 3ICCA 3DBHB 2NVUA 4YT5A 4GGOA 3OF2A 4B3JA 3C85A 4GAEA 3WYBA 1NHWA 1ZMOA 1JTVA 1E6WA 1ISHA 1HDYA 3ANMA 5ADHA 2D4AA 3BHIA 1R0KA 4W99A 3UOGA 1UDBA 1T2EA 4J7UA 2Y1EA 3HZZA 1R0LA 2DVMA 4FCCA 4IDAA 4D44A 4NHEA 3L6DA 2OO5A 4JBIA 3RJ5A 3VZPA 3AJRA 5DULA 1ZO8A 3HADA 5I9MA 5TSDA 3RJ9A 4A2CA 5F21A 3VDRA 4J9UE 1YB4A 1K6JA 3M1LA 2E82A 4IUYA 1LBEA 4MVJE 1I3NA 1VL0A 5C7IO 3BMQA 4MJLA 2FZEA 1A27A 2VZ8A 5A9TA 1R4MB 1PR9A 3F6YA 4R1TA 3ZU4A 4CQLB 3UFXA 3ZNOA 2F00A 1WNTA 2J5QA 4UVEA 5AXDA 4YBZA 4CV3A 5DBGA 4ND4A 4PRKA 3PXXA 1JWBB 4AFNA 4BO7A 1X7DA 5C5IA 4R1UA 4W7HA 5JS6A 5F1OA 3ORFA 4M86A 4F45A 2O7SA 3JQFC 3UVEA 4KTVE 5AXAA 3E9QA 3GVXA 1NX6A 2FPIA 1N1GA 3RC2A 3HN7A 5T8KA 1PQUA 1LXCA 5JE8A 2IYPA 3ITKA 3ZWCA 3ZNPA 4CL8A 1GADO 2OHXA 1BGVA 1QP8A 1UDCA 3W8FA 3ZWYA 1C0KA 2OGUA 2OXIA 1UXGA 3WJ7A 3HHPA 1FMCA 4NMHA 4PLZA 2WE7A 2AA3A 2WDZA 1Q7BA 3ZWXA 1U9JA 1I10A 3B1JA 3PIIA 1M67A 1UP7A 3TZKA 4IS3A 1PQPA 4J6FA 4CLHA 5BSHA 5B37A 4GSLA 1O9BA 4J2OA 3VKUA 1N9GA 4EEZA 5L4NA 3AY7A 3GDOA 4BMSA 4E5KA 4Y6SA 3KVOA 1VE9A 3U62A 2NACA 4ZICA 1TB4A 2J3KA 1RM4A 4A03A 1GUFA 1MX3A 1QKIA 1W4ZA 3ROPA 1AHHA 3OIDA 4K9DA 3GGGA 5A5FA 3I9LA 1J5PA 3I4CA 3OJOA 2DC1A 4DIOA 5A3VA 4RF5A 3L6EA 3I3OA 4FS3A 3GDFA 4C4OA 5J23A 2EP7A 2BFMA 4YT4A 4XR9A 4FQ8A 4D46A 2TMDA 2X5KO 2ZB3A 1DFHA 4GX5A 4DUPA 1N2SA 1MXFA 4PLYA 2FR8A 4EITA 3GG9A 2P5UA 2W2LD 3T7CA 3TRIA 3DMTC 4D3DA 3LK7A 1B8VA 2P91A 4XB2A 5DBFA 2WD8A 3E5MA 3PRJA 1QV6A 3RBZA 3RFTA 2OUIA 2VQ3A 2WD7B 4IDEA 1HDZA 3PJGA 3LT4A 4TKLA 3F9IA 1NM5A 3BYZA 1UDAA 4ZQBA 1U2GA 1M66A 3ZU5A 3SXPA 2GD1O 4U8GA 3IDSA 3LLSA 3QLJA 5THQA 2NVUB 1ADFA 3L4SO 5BQFA 5F5LA 2VHVA 3GVCA 1UR5A 2EEZA 1HLDA 5K9ZA 3NDRA 1IULA 3D5TA 3ZV4A 4IGEA 2Q49A 4IXWA 4JJIA 4KUHA 1K5HA 4KDFA 5CPFA 1BVUA 3IIEA 1XQ6A 3W8DA 4CUKA 2Y1FA 4P4NA 4R68A 4BV9A 4J3FA 1H0KA 1SOVA 1QORA 4NK4A 4XYMA 4TZKA 3RUHA 3ENNA 3BMCB 5CHEA 3GUCA 4NI5A 5L4SA 1DIBA 4CMBA 3ZN2A 2IZ0A 4JBGA 4O5OA 1KVSA 4MP8A 3PJFA 4BNYA 1M2WA 3BXXA 4DBVO 1L7EA 2JCVA 4QFDA 4CQLA 2YW9A 5IZCA 1VM6A 5U9CA 2BGKA 2VYVA 4IDFA 2VZ9A 1UZLA 4TRRA 5AVOA 2FPGA 4CLEA 4WLEA 4DTIA 2P9EA 2HKIA 1DB3A 1L7DA 3RCBA 2PKQO 1E3WB 4BB5A 2Z95A 4DQXA 4CLXA 2RAFA 5CDUA 1H9BA 1GAEO 1YVEI 4AICA 3ZV3A 1X15A 1DAPA 4AJPA 2NTJA 1N9GB 5G0UA 2JAHA 1SMKA 3L07A 3PLNA 2GRAA 1HZZA 3SLKA 4CMEC 1CERA 3ZH2A 1YOVB 3FNHA 1F14A 3GQVA 3NAQA 4DLBA 2PWZA 3DHEA 3PIDA 5K0ZA 1JDJA 1TLTA 1ENOA 4BV8A 4RORA 3C7AA 4XIJA 1LDYA 4CMIB 3A1NA 3C7CB 4FC7A 1YH3A 4BMVA 4UVIA 3T4XA 1Y9EA 3IAHA 3QWBA 5A05A 1X0VA 1XWFA 5DOZA 3VTZA 2VTEA 3DBRA 1K6IA 4RVUA 5LDHA 3KEOA 1R15A 3C8MA 1EK6A 1H5QA 1HE2A 4U7WA 3VH1A 1T2AA 3TNLA 4L8VA 3JYOA 3D64A 2HU2A 3DTTA 2NWQA 1HEUA 1P3DA 1E7YA 3PHJA 4HFJA 1EVIA 2D2IA 3WFJA 5KCZA 5G0WA 1GU7A 3Q11A 1AE1A 3CSDA 3SLGA 4ZJUA 1ZXBA 5C7OO 2O3TA 3OJLA 4PFJA 1UXJA 2OBNA 4AL4A 4KOAA 5LCXA 4Z3KA 1A72A 1HYHA 3GHYA 4ALIA 3SBOA 3QHAA 3ZWOA 4PLHA 1IPFA 2EWMA 3E18A 1S6YA 3NV9A 5B1YA 1NAIA 2PNFA 1E7SA 2LDBA 1CQIA 3CEAA 4IQ8A 4AJEA 2R6JA 1DPGA 4CM4B 4C7JA 2A4KA 2UV8A 1YQGA 3UCXA 4BNUA 3F1LA 1AXGA 5L7WA 1LDGA 3HSKA 4RPJA 5JDIC 1P9LA 3WNVA 3OBBA 2H6EA 4LRSB 2YDYA 3RUDA 3K73O 3GNQA 1EZ4A 1YWGO 3RI3A 1G1AA 1J49A 2VOJA 3WIEA 5JY6A 2Y1DA 5BNIA 1KC3A 2ZCUA 4QECA 1I30A 1Z82A 2YZ7A 1D3AA 1CIVA 1P31A 5ES3A 4XQCA 2NVWA 4WLOA 4RJTA 3KLPX 4OQZA 2C7GA 1H6BA 4MP3A 2VZ0A 4P4LA 4INAA 3CH6A 4KDEA 4WKGA 3U4HA 2J8ZA 1HTBA 5GMOA 2SCUA 4UUPA 1EK5A 3H8VA 4UUOA 4W7IA 1IY8A 2UVDA 4IMRA 4ZQEA 1WZEA 4OXNA 5IG2A 1PZEA 3DZGA 4N54A 1MG5A 4HFNA 1HDXA 1QLHA 4CMJA 2D8AA 5A4DA 1HXHA 4GWGA 2IXBA 3X2FA 1Q2XA 1LC3A 3G0OA 2I67A 1GD1O 1KERA 2VYND 4J0FA 3OM9A 5JAMA 1C1XA 5TIIA 3BAZA 1A5ZA 1PJLA 5JLAA 3QWHA 4XWYA 1BXGA 4E3ZA 4WE3A 2YV2A 3DTYA 1QV7A 2X6TA 1F8FA 3WBBA 3GC6A 4YYZA 2GGSA 3BMNB 3WGHA 2P68A 4JJGA 5THKA 2XF8A 2VHWA 3H6KA 4R69A 2AW5A 3E5RA 3PZRA 5TX7A 5HWSA 3QVTA 4YT8A 4Z3DA 4L74A 4CQMB 4CLOA 3MEQA 3AW9A 1O95A 3R3JA 3W6ZA 5ITWA 1L1FA 1W6UA 1B2LA 5JFOA 3AI1A 3ZWPA 1HZJA 3IP3A 2X0JA 3PFFA 4H15A 1JN0A 1Y5MA 1XR3A 4JP3A 4QSMA 3U09A 2DUWA 4JP2A 2ZTMA 4RPHA 1DJNA 3WGGA 2GDZA 3ZHZA 4BMNA 5BSFA 4DVJA 1B8PA 1ISJA 2OZPA 3D4PA 5A9RA 1Q0QA 3AY6A 2AE2A 2IEBA 1SAYA 4RLSA 1PU2A 3UICA 3KRTA 2WEKA 4BQRA 4OOEA 1G0NA 4KWIA 3IUPA 1PWZA 5EN4A 5HS4A 3BHJA 2HAEA 5TT0A 3W4IA 1C0PA 4XA8A 2EV9A 1ADCA 2WD7A 5TNXA 3FSRA 1PX0A 2YHUA 3GK3A 3GRKA 4AJOA 1DRUA 2GN8A 3DBLA 3P2OA 4DQUA 1E7RA 4TMFA 4MVJG 1ADBA 1ONNA 1Y8RB 3NX4A 3AY3A 4ESOA 3I6IA 1DRVA 4XCVA 4QO8A 1NQTA 4IMPA 1KEWA 1U8FO 1ZK1A 1I8TA 1UXHA 5JDCC 1RM0A 4A7PA 3DBLB 3ADPA 1MA0A 1EUDA 1B3RA 1NYTA 4XQGA 1BVRA 1TA4A 3TFQA 5A06A 4J2HA 1XYGA 2EKLA 4R9RA 3SX2A 4DL9A 5I7EA 5EIOA 4CPDA 1P1RA 1WW8A 3FNEA 3KB6A 5KVCA 3QWFA 3B20A 4RV9A 5KKAA 4YAIA 1MC5A 2IZ1A 4B7CA 4ND3A 4RVSA 1B7GO 2GN9A 3KYCA 4JIGA 2VWHA 1JVSA 1FDSA 4D7AA 1BDBA 5T6BA 2O7QA 4IJKA 5CDGA 2ET6A 2GR9A 3PQEA 3UF0A 4QFCA 3FR7A 4E32A 2HO5A 3N58A 3O4RA 4KUGA 3NDJA 3R0IA 2TMGA 1WXDA 3JQ7B 1PIWA 1O94A 2EP5A 2UUOA 3H3FA 4AJHA 2O2YA 2ZTLA 3F46A 3ONDA 1KEPA 1Q7GA 5DCUA 4WECA 1LDBA 1HSOA 5CDTA 1H2BA 1AHIA 4EYEA 1GEEA 2YFHA 2JFFA 4FIZA 2VWGA 2ZYDA 4GVXA 3MJ4A 5FF9A 3GEGA 1LRKA 2ZATA 2CVOA 3PWSA 5ER6A 2HMUA 3EMKA 1N7GA 4UAGA 4YJGA 4E4YA 2JJYA 3WNQA 2X58A 3D3EA 1TXGA 3VTFA 2G17A 5DCWA 1NTOA 4XGNA 4E5MA 4LSMA 3I9NA 3Q3CA 4J4HA 1XHLA 3EDMA 3DEYX 3GT0A 2PZLA 2NNLD 1E7QA 1MFZA 1SEPA 1ID1A 2JD2A 3ETGA 3H9EO 4R3WA 1QYCA 2HUNA 4BNKA 1LLDA 1I36A 3V2HA 5ICMA 2AMFA 1T2FA 2JFHA 1R16A 3SJUA 2JCXA 4BOYA 2I65A 1VL6A 3OSUA 5DP2A 4LVCA 2PY6A 2WJPA 5HTOA 4E5PA 3ON5A 1H6DA 4BO3A 4MVJD 3QQPA 3JQBA 5AXBA 3E6AA 2ZB7A 4CM3A 4BO0A 5FWNA 1EBFA 1LDNA 4PZCA 2C5AA 2DU8A 1T1RA 3DOJA 1GEGA 3HNPA 1GV0A 3GMDA 3PZBA 3KOUA 1GR0A 4L4RA 4R1NA 3C3XA 3R6DA 5G0VA 3GEMA 4IDCA 2C20A 3RAJA 1VSVA 1N1EA 4NNJA 3K5PA 1NPDA 4IM7A 4MVJH 2IYOA 3UH1A 1QLJA 1RYEA 1MP0A 3IQDB 1Q0LA 2D5AA 3HB4X 4ND2A 1U1IA 1N7HA 3AM4A 4FOOA 4B4WA 3G1UA 5DDIP 4CM5A 2C2YA 1GQYA 3MOGA 1P33A 4DPMA 1U4SA 4JX8A 3AOEC 2GO1A 1W8DA 1ZSVA 1NVGA 4E5NA 3DZJA 1X13A 2C0CA 2WM3A 3HWRA 4BNHA 3BIOA 3NJ4A 3WOHA 2UAGA 2RHRA 4ZA2A 2Y1GA 3SVTA 4RDIA 4YXFA 4O6VA 3EY4A 3OA2A 2ZYAA 4BNTA 4R1SA 4PZDA 3JQBC 1GZ4A 5IFLA 3QVOA 2PKRA 2HMWA 1R4MA 3H65A 1TI7A 2VCYA 2Y67A 4BKUA 4ALLA 2HK8A 4B8ZA 3RVDA 2C2XA 4L75A 3AU9A 4MOWA 3WDSA 1ISMA 1U7TA 2JHFA 3LU1A 2NVBA 1AXEA 1Y9AA 4YACA 3WS7A 3GAZA 1LQUA 4TZTA 2P4QA 4I1IA 3GY0A 3MOIA 1BXKA 2DT5A 3CZMA 4Z0TA 4AJLA 2HRBA 4YPOA 3DBVO 5IJZA 3DZHA 3ZV5A 1PL6A 3QWIA 4XYBA 4BGIA 1DSSG 3OICA 1VLLA 1DIAA 2O3SA 1DBVO 4HADA 1YL5A 4IXTA 4QO7A 4R5MA 2CUKA 3ETDA 3ZWAA 4CV0A 2X5JO 4PIVA 3PLRA 4OXKA 4DBZA 5H83A 2AEFA 4CM8B 1SEVA 4BNVA 1BG6A 4QT0A 1ISGA 1O5IA 1WZIA 1MUUA 1S7CA 2Y93A 3D4NA 4N5MA 3U9LA 3MTGA 2WWRA 1T24A 3PTZA 4PG7A 1PGQA 2WTBA 1P1JA 4YR9A 3KBOA 3EAGA 2HK7A 4Z9YA 3TL2A 4H7PA 4J1TA 3LZ6A 1BW9B 1E3EA 5COQA 3QE3A 3FN4A 3I9JA 3PDUA 1KYQA 4U0KA 1O0SA 1JAXA 5AOVA 4XJTA 3ZHYA 1EFKA 1DFIA 4L76A 1XLTA 3DWFA 3KSUA 4FGSA 4D3SA 1PS9A 3IP1A 4AVYA 3EC7A 3Q9UA 3CIFA 2C7VA 4PLGA 2IXAA 4CM9A 4M49A 2D3TA 3WXBA 1U5CA 3JQAD 4NBVA 1T4BA 4GSKA 5KNLA 1IB6A 2W8ZA 2VYNA 1DDOA 5TRTA 4B4VA 5MDHA 2DBZA 3FF4A 4WLFA 2ZB4A 4BNZA 4OKNA 2ZIZA 2AEJA 1YJQA 4R01A 3GNTA 3MWDB 2CDAA 2HDHA 3C1TA 3NT5A 5EJ2A 1UZNA 4J1QA 4MVJM 4ND5A 3L0DA 2H5LA 3MJCA 4Z9XA 4A5OA 1UUFA 4OOFA 1GYQA 1U4OA 2QG4A 4E12A 2BFAA 4OSOA 4UEOA 3ITDA 2GASA 3RUCA 3I23A 1E5QA 3WTCA 4EZBA 1F12A 1X1EA 1YL7A 1U3UA 3DFZA 1DC5A 4J9VA 2CDBA 3JQFA 4GX2A 3DZFA 3WGOA 3UW3A 4IIUA 3JQCA 1E1LA 4FBGA 1R12A 3ZNQA 2AQ8A 3JQGB 5ILOA 1ZJZA 4YAKA 3KYBA 2BHLA 4D0RA 3GUYA 3IC5A 3D3WA 3DL2A 4NFYA 1GV1A 2W2KA 3U4CA 3INRA 3S8MA 1B8UA 2QRKA 4Q3NA 4FOSA 2VHYA 3LC2O 3P5SA 3JV7A 3B1KA 3ANLA 2GLXA 1I2ZA 3AUTA 3H9JA 3JD3A 3PQDA 3ZHBA 1YJ8A 4CLRA 4BKRA 3ABIA 5DCYA 4DIFA 3OETA 2FHSA 3ZWWA 3HDQA 1IE3A 3OFSA 2YV1A 2O2SA 2RH4A 4RVFA 1ENYA 4WJZA 2J3IA 3DOOA 3KUXA 4YJHA 8ADHA 3WWZA 1KBZA 4UEKA 2B37A 3GN2A 1O8CA 2VOEA 2YJZA 4OXYA 2JFGA 1DOHA 5HA5A 3WGYA 5DBIA 3E82A 2YY7A 2YQ4A 4L73A 2R2GA 1X14A 2BGMA 4HX5A 4RPLA 5ILGA 3S2EA 1U7HA 3PQFA 5KVQA 2VWPA 1GZ6A 1WMAA 4GX0A 4F3YA 1IUKA 3VOSA 3ONFA 1X7GA 1E5LA 5TF4A 3K8ZA 5A5EA 2RH8A 5CG1A 4NBTA 1Y8QB 4JCOA 1E3LA 2PH5A 4TSKA 2QYSA 3ADOA 4B8WA 2AXQA 3ZHXA 4JK3A 2Q4BA 1KVRA 1BWSA 4YA6A 4DC0A 4E2YA 3R3SA 3S2GA 3OIGA 1NHGA 3SEFA 4PLCA 4CV2A 4D41A 5BSGA 1U3WA 4W4TA 2HJSA 3RUIA 1ZCJA 1PTJA 4AJ4A 1SCUA 4MIEA 1HRDA 3WBFA 1ZIDA 3ENKA 3RC7A 4C7KA 1C1XB 1VRWA 1G6KA 2Y66A 1I2CA 2ZK7A 3KM0A 3PHIA 4ZQHA 1I3MA 3HUDA 4I9HA 2Q46A 1TT5B 3B70A 3ROMA 3TWOA 4F46A 2CF6A 4FFMA 2Q3EA 1TVEA 3V1UA 4PLFA 4MDHA 3GVIA 4IJWA 3DZBA 4OHUA 3RC9A 3RKUA 5A1TA 4P4GA 1ZZEA 1WDKA 3S1LA 3QJ5A 2V6GA 4BNJA 4UVGA 2Q1UA 4NJMA 1C3VA 1T1SA 2NU9A 3UN1A 4D45A 1UAGA 1H9AA 4QX6A 3X2EA 1A7KA 1VPDA 3BMCA 2QRJA 3C1OA 4XX0A 4P38A 2CY0A 1YBVA 5JMPA 4KMSA 2DUUA 1ZK3A 4A0SA 4FB5A 3V2UA 5KVVA 5L7TA 1QR6A 2GCGA 4BHTA 3FWZA 4R16A 4R5HA 5HRUA 4J16A 5KKCA 3HB5X 3WQQA 3EW7A 4CMHA 2AHRA 1ISFA 4K26A 5H81A 1PEDA 3U5TA 3DB2A 4RQTA 2VNSA 4YJHB 1Z7EA 1DLJA 4CJXA 3ETEA 3ZU3A 1Y1PA 1YXMA 5IF3A 3RFXA 4IDBA 1LDMA 2PR2A 4MIYA 2JHGA 4PN3A 1C0LA 2HQ1A 5T67A 3G1TA 2P9GA 4OM8A
chains in the Genus database with same CATH superfamily
4QZVA 2OV3A 3AUKA 4FPXA 3TSAA 5LP6B 4BQFA 3MWGA 5DB4A 2Y1CA 1J33A 5DYTA 1FLDA 1GQ2A 1PJTA 1VBNA 2Y1WA 1SB8A 2YFYA 4LOJA 3RVQA 5ICCA 4G0NA 3LUDA 3PYMA 1QYRA 3BD7A 4RK0A 1KJJA 2C9YA 3AUAA 2E1RA 4TVOA 4QU9A 4IQ0A 1NWCA 1RE0A 2CDCA 3BXPA 1IG3A 2FWAA 1E4EA 1JSZA 4PEVA 5DM60 3GLFA 1AH2A 1LNQA 1TM7E 4J91A 1YKGA 3HJAA 1OH8A 1O94D 1O77A 1YQXA 4X3CA 5C7YA 2EW8A 1V8PA 2EWVA 2BGLA 2XYQA 2FLVA 4R1OA 1IHOA 4P9NA 4XIYA 5IAGA 1BQ4A 1SCBA 1IRXA 2PRSA 4BNGA 1XEXB 2CB0A 4MQLA 4GLBA 2VJYA 1A4UA 1U3DA 4U9HS 1JFSA 1U8CB 3O26A 3QPDA 4II2A 5IDWA 3NHWA 5EJ4A 2VATA 3AM3A 4R41A 4D9BA 1PJCA 1QK4A 4Q82A 1EUCA 5IFKA 4ON9A 3ZZ1A 2ODAA 2R4TA 3BGIA 1LLUA 1GDHA 4MR7B 4MAMA 3CJTA 2CUNA 5IEBA 1PKXA 5F51A 5IEJA 3SD7A 1IPHA 3T15A 1AN9A 1JIJA 4C0BA 2XA1A 3ES9A 2QQGA 2Y0CA 5LU9A 4MQUA 4IRXA 5JATA 1E4VA 1I0ZA 1JU3A 2HOQA 1YSCA 4XYEA 4J4BA 1NJ1A 1U8XX 1QB7A 2F7SA 2X23A 3JRWA 1VGRA 3F5SA 4OBXA 4DXDA 1S9HA 4K2HA 3DTVA 4KIUA 3LBHA 4CTJA 1XRSB 2D2VA 4MUAA 3V4PB 1XWIA 4QODA 2IE0A 1Y6JA 3PNSA 3VI4B 2PEZA 4MVJP 3SBEA 1N57A 2D7DA 3FWYA 3Q1KA 1RBZA 2AWNA 4JQZA 4O2BA 2IYTA 4CKWB 2BMEA 5AW6A 1KBOA 1BGXT 3KAQA 4XB1A 3U7QA 2YRXA 4Q3EA 1NSFA 2I6TA 2GBCA 1QIDA 2H9YA 4N18A 3C8UA 4OXRA 5U4XA 3UAYA 3WDLA 4Z1MD 2XXJA 5FL7A 4KZPA 1ACLA 4DJDC 4ETNA 3BWDD 3CLTC 5E9WA 2H4JA 1OWMA 1TFRA 3WYCA 1M5RA 1KI4A 1YDEA 2XEXA 1ABBA 4PHCA 1RRMA 2IYEA 2YWRA 1Q3KA 5AJWA 1WXEA 4FJ2A 4YRTA 1N2CA 3QRWA 4I9UA 5JWHA 3M5WA 4LY3A 3NIGB 3RUEA 3WMWA 3GGJA 3TQOA 5CA1F 1A76A 4I4TB 3GXBA 5AI6A 3AEQA 3WZMA 4BNDB 5JZBA 4K81B 4M7RA 2E18A 1DXHA 4FYMA 4C0SA 3IR5A 1ZK0A 3T4EA 2ODEA 3FHJA 3LLMA 3PHLA 4OUKX 4WESB 2OL4A 3C3YA 3NB0A 3RSLA 4ZHQF 4RENA 1C5KA 1EGAA 4WGGA 3I34X 5L9AA 1BHSA 4LRYA 5KYUB 4JLOA 3A06A 3PGA1 4HX9A 5KJEA 4HWTA 4QYWA 1KK0A 4XZ3A 3V8NA 4YPFA 2AS0A 1E5DA 4WXMA 3PPIA 2NT4A 2XNHA 1SUPA 3EZFA 1R9MA 1MLDA 3UV7A 1DKOA 3L0PA 5GV8A 4FFOA 3I01A 2WTXA 2J0QA 1JQDA 2AI2A 2PA0A 3W6UA 1BWQA 2PSEA 3EGVA 5TJ9A 4OEHA 1L3BA 2EP8A 3DL4A 4IQGA 4DZTA 1JG1A 3H9QA 1UBFA 4L22A 1FLNA 1B15A 3Q3VA 3K0FA 3N76A 4KR2A 5BN4B 5CA0A 4KFTA 4R4JA 4TXHA 3IUEA 3ZCXA 3O5AA 1Q1QA 3C6YA 4UBJA 3NHZA 1XQXA 2C2GA 3AM5A 3HBMA 5D3ZA 3TZEA 3CPSA 4QWWA 3EK2A 1II8A 4DILA 3UMYA 1X92A 4ND6A 1VDZA 2WUGA 5L4LA 1HG1A 1HF3A 1NQXA 5JSUA 3PDJA 1Y33E 2GN4A 1A9TA 1O6CA 4M6WA 3DOEA 1TU3A 2ACWA 3N9IA 5BSKA 1K5GA 4UOZA 1WZ2A 5DM1A 1K3FA 1U2QA 4GMFA 2A9PA 4Y98A 1IXKA 1MVNA 2PXAA 2C31A 3VU1A 1K2WA 2ZGVA 4Z1MA 3UO8B 4YUZA 4YAGA 1RSZA 1QM5A 1Z12A 2XDQB 1XAHA 1Z4JA 3PG5A 2IBMA 3MFQA 2X0NA 1OJ7A 1BSVA 3DC2A 5D3MA 4Z99A 1NVEA 5ER9A 3UGKA 4UXIA 2V9PA 1YGPA 5AM3A 3FVRA 1PFKA 4E7PA 1H8HA 2X77A 4DQVA 5CCEA 3ESZA 3VTAA 4K9RA 1V2GA 1LBIA 4JLWA 1UKYA 5AK3A 4HAWA 3PF8A 1NFQA 1PDVA 2AFIB 2BISA 2BJHA 2C1XA 2J5BA 4F5YA 5FV4A 4JXXA 1UZUA 2DKNA 5CFQA 3THWA 3KSRA 4NYIR 1DV1A 3L5OA 3MCVA 4KAAA 4NEGA 1NN0A 1JQLB 1R0YA 1R37A 1XVUA 3EHEA 5EOVA 4CXMA 4KYUA 3HXQA 2EOAA 3FPCA 3FUCA 3KQUA 4URHA 2VA8A 3HN2A 3NEJA 2B82A 4HNRA 4JR0A 1O3YA 2PX2A 1IDOA 1SXJE 3HY6A 5EWMB 1ACJA 4B6RA 4HGQA 5AHXA 3NT2A 3B6ZA 3IJEB 5DKFA 1PL7A 1AG9A 3H5IA 3OE5A 4XRRA 4GICA 1CEQA 1NWHA 3SX0A 3RVJA 4HP8A 3CUKA 4FNAA 4I5DA 3IEIA 3QXJA 3KJFA 1YOVA 2Q3DA 1GSHA 2R751 3AEYA 1XCBA 3O8QB 4UQPA 3DH0A 3AO0B 1SN7A 1UFQA 2QZSA 5LMNB 1R0WA 1G4HA 3TD6A 4IQFA 2P7HA 1LPNA 3IDZA 1E1QD 1I1NA 1KY5A 3AF1A 4OQNA 3WOVA 3UTCA 1N78A 1NP3A 2F62A 4MB2A 4UPDA 3H99A 4CIXA 3P2YA 1G5HA 5L3ZA 4RIIA 2UZ1B 4FK8A 8GPBA 2EKPA 4IHAA 4NOMA 5ALVA 1T91A 4GL4A 3AH8A 2B83A 5HUJA 2QWXA 2OORA 1NMYA 3TXAA 1Z5NA 4QQKA 2XF2A 2X8WA 3M6IA 1UM9B 2C58A 2IZZA 2YDXA 2BEVB 3EXIA 3HP7A 4FKBA 4GZ6A 3WHKA 2G63A 3LT1A 3UJPA 4C3VA 3FHCB 4BPBA 4QOGA 4GLFA 4MWGA 1KO5A 2OQ2A 1RNLA 1HEIA 1V6CA 4JJ6A 2E0IA 4D92A 3TX6A 1EJ2A 2X4GA 2CZCA 2GXSA 2PL3A 3R0VA 1GTG1 1CZNA 4U7JA 2L18A 3CGWA 3OPNA 2FCAA 1BTOA 1NMEA 4IGIA 2DTEA 5KWIA 1WXHA 1GCOA 4UTRA 3BKXA 1UT8A 4KVZA 5JALA 2X5OA 5C8YB 2QPOA 1L4YA 2MSNA 4FE7A 3IQWA 3PDIB 2ZJYA 2ZYHA 3G79A 2DWCA 1DQYA 1U5BA 3M4JA 4LMPA 4UC0A 4URFA 1Z2CA 3AV3A 1NULA 1QXSA 3HRIA 4BLTA 3OPVA 4PZUA 1DO8A 2C4WA 2I80A 2MMGA 4KYTA 4UBIA 4K7JA 4QSHA 2O2GA 5IJ0A 4PC2A 3FRHA 1RMYA 3CURA 2V5UA 1W34A 3M8KA 4FW9A 5JPIA 4DANA 5KQPA 1P1IA 3G8AA 4WESA 3ESBA 4ZRDA 3MQ2A 4YB8A 2PUHA 3QVKA 3HKDB 1QZTA 5K0NA 4ZOLA 1TMKA 2XGMA 3UT0A 4L3OA 1LQ2A 4YAOA 4W9NA 4ZCPA 2ILVA 5C37A 2VL7A 3PGXA 2EJTA 5KU7A 3EG9A 2J85A 3BD9A 5CM9C 5KWEA 3PR3A 4Q3KA 1C7FA 2XRYA 5EIAA 2V6BA 1LQTA 2CKDA 4ZTBA 3TEFA 3KVVA 4N0EA 2O59A 1P5FA 3GRPA 1ZN2A 3HKEB 4CM8A 2FQXA 5AR1A 1JQAA 1R3UA 5BR1A 2EYQA 3FUWA 4REOA 3PEWA 5HQ3A 1QQ7A 1L1EA 2JFNA 3NT4A 1L5ZA 1GGKA 1H1LB 4QU5A 3AVVA 4CUZA 3FE2A 4EX7A 4DYDA 3ZC3A 3VNVA 5EERA 2DLDA 1SXJC 3RVKA 3JYPA 3S6JA 2UUCB 2YZGA 3FWNA 5FFMA 5ENZA 1M2OA 3RASA 1DQZA 3AGQA 4OUDB 3ZBPA 3L0SA 4GR5A 1ML4A 2B1JA 2C59A 1RFLA 3U9TA 1AKRA 5I7WA 7MHTA 2MIIA 4Z7NB 4U7GA 3BWBA 4MJ7A 2V54A 1ILEA 1K8RA 2IF2A 1EBUA 2OZEA 1ZH8A 1KNXA 3PD1A 2EFJA 4HTFA 4PICA 3V32A 4LBZA 2CUZA 2Q2NA 5D7NA 1D7OA 3MGKA 2Q1SA 3DHYA 1DIRA 3LTEA 1AQLA 4M7OA 3CEMA 3JD1A 4XPIB 2Q21A 1A98A 3C98A 3BREA 4P3KA 3JZDA 2FSFA 2PU5A 1QRRA 1IVSA 4JA0A 1MDFA 1QHNA 5HGJA 1OXBB 1L5LA 5KYTA 1O6ZA 4ZGWA 2HZBA 1WPQA 3LX6A 1L5HA 5BW8A 4FHFA 1DWPA 5I9NA 4IVPA 1NBHA 3LSYA 4L4ZA 5K6AC 4XOUA 1RZ3A 2C8LA 4UZSA 4EG0A 1ZD3A 3N7TA 5EE5B 1RI3A 1T4DA 5A9SA 2DM6A 4PS1A 1U2DA 2OBFA 4B81A 1CZOA 2HDWA 4UOQA 4AY6A 5FPKA 1KYZA 4C0AC 1M75A 1ZITA 5FPQA 2J07A 3PRYA 4TN5A 4J7CA 4P3NA 3FD8A 3HKBB 4QTZA 1YFJA 1X7HA 1LZKA 2FK7A 2A58A 2FU5C 1MHPA 2ZSDA 3W2TA 1NQ5A 1XT6A 3QE9Y 3PNLA 4AMZA 4GWKA 1LSOA 3KOWA 1NJ6A 2UZ4A 2ZZKA 2ZYSA 2PMWB 2RHTA 3R5KA 1YDHA 3Q3GE 2P6RA 2HSWA 1NJ2A 1E9CA 3A14A 2XSZA 2JI7A 1YB6A 1VLJA 1FP2A 1SCIA 1VXOA 1Z45A 2RGAA 2VCHA 2Z2KA 3QFCA 1PLJA 2QSYA 2ZUVA 4JJKA 4NAUA 4KRGA 3TSCA 3UMGA 4HDOB 4D4IA 1DZIA 5LIRA 2NO7A 3U56A 1S2NA 3AZQA 2OB2A 1FPMA 1SIOA 2VAWA 2WWXA 3DQZA 4LGVA 4GUAA 4M53A 3RBVA 3PJEA 3R4CA 3RS8A 3T12A 3U6BA 1XCPA 2EGHA 2RGCA 1PJ3A 3VPHA 1OFGA 4AMYA 3PNMA 5IP5A 4EMTA 1YHZA 1RRKA 3H4MA 4J4TA 1UKEA 4LCEA 4FOPA 3VR3A 3B2EA 2H9IA 4LQ4A 2XXAA 2I2XB 1QHYA 3VH3A 3LHDA 5EJ9A 1E2DA 1P6UA 2CKMA 4YCLA 1Z4OA 1QHFA 2CXPA 4N6NA 3VR2D 1NI4B 2CL5A 2Z6VA 3DT6A 4K1XA 3GA0A 3GT7A 1HDCA 5AP9A 3FNBA 5SZKB 4XWKA 4RF3A 4TL7A 2IS1A 1TK9A 4UFPA 2WJ3A 3VZDA 2X40A 2YHIA 4KQWA 1VOTA 4GMHA 1R6DA 1V16A 1FU4A 1YB5A 2P5TB 2PO7A 2Y1LA 3H8WA 4BNIA 4HVCA 5G4KB 1UMCA 1XF1A 1ESNA 1G5QA 4LSWA 3FIJA 3KKKA 3TSOA 4GM1A 2PVCA 3WLEA 1FRVA 2I6QA 4NPHA 3EX7C 1J0EA 1IHDA 2HJRA 4C0LA 1AO0A 1U28A 2VT2A 4J16C 3HL4A 4C5CA 2GZSA 2CZQA 4X8HA 5HF8A 5B3KA 3DMYA 3A3YA 2A88A 3PPXA 5JO0A 3V4FA 2YL2A 3GPDG 4PPFA 3HCCA 2VF4X 2ZQYA 4N9QA 4RZ3A 5K1ZA 1C4KA 1H66A 4Y1FA 4EY6A 1FK8A 2VA9A 3IOBA 1NLUA 4PLPA 4CTKA 4JI4B 2VDUE 1BJKA 3BJIC 3ZK7A 3RW9A 1XLTC 3GW8A 4V0ME 1ZGCA 2BV3A 2WWYA 3ESYA 1X2EA 1IVNA 3QOYA 1J09A 2ORYA 5BP7A 1Z5OA 5H82A 1UFKA 1VG1A 3BFKA 4FJ1A 3T1QA 1UPCA 4C7XA 4G37A 1ESCA 3KE9A 4HTFB 1Q1BA 4QM7A 3D0RA 4X6UA 4ZI7F 2O06A 4O3MA 4X93A 1A9RA 1PUJA 5DSXA 3T7SA 4MWTA 1RD4A 1Y34E 1J24A 1P19A 1LZLA 1YUMA 5EIWA 2Z08A 4BVEA 4BLQA 2C9DA 3KXLA 4URVR 2FQQA 4HNAA 2NMVA 3EPHA 2XB9A 1VJRA 3GFTA 1KS9A 1C81A 3OM1A 4WNYA 2ZSAA 1QO0A 3WMFA 1L3CA 1U7UA 3VYTB 3E7WA 4H4CA 3FCEA 2XH8A 2ZI4A 2I3ZA 4NMWA 2ZEJA 5EHGA 3PHBE 1TO1E 3VXKA 4RWZA 5LQUA 2XB2A 4HZUA 5D7BA 2ZFUA 3HL0A 1YS1X 3R23A 4ZI2A 4KBFA 2F3TA 1U5AA 2JBAA 3D1LA 1E58A 4P93A 4L9RA 1QS0A 3ZWKA 2VDRB 3E7PA 4I1RA 1LFAA 1GUZA 1OLSB 2PU7A 2RGWA 2VPIA 5F2OA 4B5LA 3TI9A 4TTTS 4Z6KA 2VP4A 1B00A 1WDMA 3FTQA 1UXIA 4JDPA 3OOWA 5HZMA 3G0HA 2GA9A 3P5BA 2VLBA 3GZNB 3MUEA 3BK2A 3WQSB 2W98A 1ZNZA 5BW4A 2ERXA 2I66A 5CT9A 3V4VB 3LM8A 2OQRA 5BN4A 5JCPA 3LH5A 1BRTA 1EE2A 2MSWA 4GGPA 4RUKA 4WSOA 4C01A 1GPMA 5AVQA 1IBCA 1JEQB 3S68A 2ZWMA 1QIMA 3DT9A 5HJEA 4YV0A 3PL1A 1ZA2A 5IWCA 2CW5A 2XXBA 1CJSA 2HQRA 1TJNA 3LQ1A 4C5AA 4EHJA 4ICIA 4D43A 2VDLB 1IUOA 2ES4A 4J0EA 4Y9DA 4PYRA 5AJXA 3IAM6 2X0RA 1XGKA 2QQEA 2N1BA 2GWHA 2C5FA 3AHEA 3HBFA 3URKA 1TGVA 2FETA 3VTKA 4B6SA 1OYYA 3TBHA 4XX1A 1IJBA 1XE3A 2GEUA 4YT2A 4CKWA 3GBVA 3SOZA 5P8WA 4I9FA 4B9AA 1JILA 1H94A 1NVMB 2ENWA 3AOGA 3OOEA 4G8BA 1IJEA 1D07A 3CLRC 3QOXA 3QW2A 5C5DA 1WULS 1R4NB 1ML3A 3LQFA 1T4CA 3HN6A 3THRA 1HDOA 3FWKA 4TV8F 1RZRA 3GGPA 4LGYA 3ZJYA 2QMEA 4HG2A 2RKOA 4EIWA 3MD9A 4D9FA 4IW3B 4LMRA 4DSOA 4BV3A 5BOSB 1VJ5A 3BSSA 1Z6QA 3D8RA 4AX8A 5A4IS 1M2FA 1ULZA 3L4BA 5ALQA 2I6XA 2IEIA 3OECA 2DQKA 2COUA 4TWRA 1KVUA 5CX1B 5KTYA 4I50F 2ICAA 3EWSA 3STHA 4PTLA 3B85A 3DEIA 1CS0B 2C4NA 1DAKA 1O9GA 5LZ2A 1QV9A 3T3NA 1K66A 4W82A 4C2UA 3CB4A 4IP0A 2CJPA 4YWJA 3GRZA 5JNRA 1P2VA 4DB2A 5HRCA 2WQ6A 5FUQA 1OYWA 2R4QA 2IEZA 3NCTA 1VPTA 5DM0A 3HVJA 3JATA 4LXHA 2O8EB 3IMGA 1NAHA 4MTCA 4EJ0A 1GG2A 3D2BA 4M0LA 5JH7F 3OZIA 5FHQA 3P97A 4LZAA 3HZOA 4I2NA 4O8ZA 1GGHA 3TR0A 2JGLA 1ZOPA 1IHXA 1ZVJA 4RPKA 1USUA 3W06A 1CHNA 1VCHA 2W5UA 3AFGA 4WOJA 1GPKA 4H3VA 1RADA 3RHSA 3ISVA 3GYBA 2JG3A 1ZW1A 4BAZA 1DEXA 2LCIA 3O38A 2CJWA 3RC1A 4CKEB 3DHNA 4EQ6A 4NXNB 2YIVX 1LEHA 3KVNA 3ESDA 4RQAA 1XNQB 3CHYA 1BRMA 5ITZB 1Y6ZA 2FPPA 2Q9AA 4I08A 4EL0A 5BWOA 2YYSA 4OO3A 4A8TA 3VJRA 4G2TA 3RTEA 1SHKA 3WKDA 4DWOA 2IDKA 5DTIA 4FFLA 3TLYA 2D1YA 2BKUA 4WK4B 2Q7OE 1SKMA 3GJ5A 3GJYA 2BEWA 1H93A 4IYJA 1GNQA 3AJAA 2RHBA 3DDZX 1U3FA 2PGNA 3CWQA 4P98A 5CVTA 5A7GA 1E4YA 5KJCA 3ILSA 1VJCA 3VNAA 2OSVA 1LI4A 1M5TA 2VQ6A 5HG0A 2C4KA 3STWA 2W2LA 4ARVA 4DGSA 4ENQA 5IN4A 3C45A 4K9MA 1BN7A 4G5YA 1DC4A 3LPAA 5CFPA 3N70A 1QAQA 4MWCA 1XWWA 2GEDA 2ZUTA 1OH5A 5A02A 4TWZA 9LDBA 2G82A 3E9CA 4BNLA 3CVJA 3TGWA 4UTXA 2V7QD 4E51A 5ALJA 3T34A 3A6FA 2B4RO 2Q3HA 2Y8EA 1NONA 4TKZA 4FDMA 3UJ8A 2XQIA 3FSEA 1WQ1R 3AR3A 3RROA 3QFTA 3IDOA 1Z2AA 1WOYA 3LLCA 5B3JC 1Q77A 4A6DA 4BS9A 5BQ3A 3GBSA 4EUSA 2Y0DA 3EW9A 3MRTA 2DBQA 1OGIA 2GYYA 2H17A 3DBRB 4OFXA 1DAIA 2FRXA 3HKDA 4U3JB 3ZJ5A 5DOVA 521PA 3HWX1 2IEGA 3B51X 4D96A 2XLCA 2XRZA 3DOFA 4WIAA 1GYRA 1W93A 2G0TA 5C46F 4G4IA 1KOJA 2I1VB 3T3MB 4LMAA 1E0DA 1EQUA 1N2OA 3AVWA 3CV3A 2XIJA 4QA9A 5ALHA 3TM4A 2ID4A 3G9UA 1ZKMA 3GLHE 3ND8A 4KBYA 3KETA 1UCFA 2L82A 4D3FA 3DQPA 1KDZA 4B47A 4DM3A 2DHQA 4ZVVA 1PSZA 4IDHA 2ID9A 5JIBA 1XDBA 1QDEA 4HNGA 2ASEA 1FFWA 5ENVA 2OV8A 1F8UA 4XYLA 4DR5B 4US0R 1SXJA 4ZJYA 5CEFA 2R6ZA 4OG2A 5DX0A 1X3SA 3R6LA 1PZHA 4PHTA 3UK1A 5AUOB 1IHYA 5I9LA 2Q45A 2R8OA 1ZUD1 3CZRA 1DC7A 3NH9A 2R65A 3Q0IA 4H18A 4O08A 5EIXA 2BCEA 2H3EA 2OO3A 4EY5A 3ND9A 4AJIA 3NXSA 3HDVA 4G3XA 5DF1A 4EHDA 4O1MA 3SWWA 4PC3A 2P9YA 1KI7A 5EG5A 2IPLA 4O8CA 4HO1X 2PIDA 3R0ZA 1ZKDA 3QPBA 4YP1A 3FUUA 3VO8A 3LVQE 3IDFA 3BWXA 1C80A 2QF7A 5SYNA 4LOHA 2AOUB 1ORDA 4NSNA 3WIVA 3TD2A 1DRJA 1VPLA 4DPLA 3CPEA 1OBOA 4IIHA 4PYLA 4FYPA 4H1WA 4Q4JB 4EEXA 3DO6A 2LVBA 3ZQUA 5F1KA 3QEKA 3S28A 4BP3A 2GAFA 3T9EA 1TMOA 2EL9A 1ZI6A 3D4OA 3M34A 2GHTA 2CHQA 2CMKA 1PLLA 1KYWA 2YY6A 4F3RA 1MB4A 3ZGNA 1VKZA 2WWGA 3D7LA 4JXKA 3CXRA 4LMBA 3QBJA 2VAVA 3PWZA 3IQXA 1EMDA 1ECCA 4LK3A 3ZXSA 1MQ8B 2RHMA 3DCYA 3DUFA 3ASVA 2QAGA 5D3QA 4F6RA 5KNBA 4TS4A 3THXA 1MH9A 2XODA 3GARA 1ETHA 2HYDA 4R2WA 4W5RA 1SXPA 2P3SA 4J1TC 3MTIA 5CB0A 4Z0HO 4ZZ3A 3NHLA 3Q7TA 4HV4A 3CFYA 4MKXA 1D4FA 5C3UA 1YK1A 2GF9A 3TOZA 2ZLBA 2OUKA 2C29D 1NBMD 3ZU6A 1VHWA 4K6CA 1DTSA 5JCJA 3TW0A 1T5HX 4HLUA 4Y7DA 5JAZA 4PZPA 5B12A 1KYTA 4B46A 1HV8A 4UTPA 3OM0A 1B6SA 2P40A 5C7LO 5F2NA 3CKKA 4OX9B 4IH1A 4IZHA 4N8EA 5FWXA 5DVZA 1XRNA 3CE6A 3DAPA 5DBOA 2O0HA 3G89A 4YMWA 5FP0A 4CLDA 2B4YA 4PLTA 5AKEA 4PPNA 2EF1A 1C29B 1D7AA 2Z58A 4HGYA 3JQGA 3VU9B 2C96A 4KI0A 5I5GA 1RXUA 2BP7B 3KYCB 3KVRA 2J9FB 1PEKE 3U60B 4F9TA 1U8ZA 2VUSA 2NLOA 4G8JA 1YTUA 3T9AA 3BA1A 1SVKA 2PYZA 4WADA 1DP4A 1MV5A 1Y5RA 3KKQA 2ZAOA 4KQXA 3WQHA 5AVUA 1GU1A 1OH7A 2ZWPA 1VCMA 4X24A 2JLYA 2VDQB 3UW1A 2NUTA 4C21A 4B76A 3CVXA 5K5EA 1ZH6A 5DASA 4EA7A 3GJSA 1EE9A 3PV0A 1X2BA 4FONA 3PHCA 2FPPB 3HM9A 1E8DA 1RYBA 3LA6A 1M1NA 4FD3A 4LJKA 3SZUA 4L5YA 2BGJA 2HHLA 3ND6A 5H7XA 5CFZA 1RLUA 3P9YA 3G17A 1P1KA 4IJQA 3RUFA 4DHEA 4YTEA 1U94A 5BMVB 4IDQA 2HCTA 2ZBUA 5F23A 2X1HA 3JSXA 3OP4A 3N5CA 1JA0A 1EPUA 4IWNA 3A1FA 1L5RA 1XUOA 1E61A 4QL3A 3HGQA 4R1PA 5T3UA 3RKRA 2B7LA 1BNCA 1CQXA 3CW8X 1ID8A 3PUXA 2ZBGA 3COWA 2Z9CA 2Q6VA 3L18A 4IMJB 1NMSA 2ABWA 3D31A 2DBRA 1OJLA 3IAS6 4FCWA 3O0TA 4Y1RB 1PLKA 4P5DA 5KSZA 3CLRD 2H52A 2ZAMA 1OFTA 1MX1A 5FTKA 2WAOA 2BGUA 4MPTA 1OPXA 4YRPA 5DGXA 2OORC 2WKWA 2IU4A 2VS1A 3IS3A 3B8HA 1Z6ZA 2EW2A 3BIXA 3LRTA 2ODWA 1XA0A 2X0IA 4LWQA 4NF2A 4O59O 1GUDA 3AG5A 4RXMA 3BGSA 5C8DA 1JIVA 2O7VA 5FAXA 4IILA 2XNSA 4AF7A 2PKWA 2VH2A 4HB3A 1SUIA 2GRJA 5K0SA 3U4DA 5JASA 5IDQA 2INGX 2SCUB 3UGTA 2WILA 5EEHA 3O21A 5K0EA 2PSFA 2WA2A 4GXQA 1C50A 3SHFA 4DJFC 1ZK2A 2G9QA 1DXQA 1T2CA 1C9KA 3STYA 2JGKA 5EZ5A 3U4QB 1M9NA 1JT9A 5IXJA 4ERXA 1UPXA 2IHVA 1M8FA 3ZWMA 4C4YA 3KTDA 1TM2A 3NM4A 2R8YA 3ZCVA 2FSSA 3A9RA 2HB6A 1GFSA 2W90A 4AZ3B 1UQTA 3K70B 2PRKA 4O2BF 1IUPA 2AC7A 1IBRA 1KMQA 2GPTA 2WVGA 3A25A 4GPTA 4M4SA 4KVFA 4RZHA 3HRKA 2J87A 1YBHA 3OQ1A 3F2VA 4FXPA 1QPBA 3WAKA 4C4SA 2GAOA 5AHWA 4HNTA 5DW3A 5KDOA 3ETLA 2JRLA 4DR2B 1KMNA 4ITVA 4MDEA 1S8OA 1UM9A 5J59A 1KY4A 2VO1A 2GZRA 2VF2A 3CX6A 3NI2A 4B43A 1YMQA 1SZDA 3MWJA 3OFJA 2JFQA 3G88A 2FPRA 3CMCO 3D54D 1F2UA 4R7TA 3KQWA 3QEMA 1OKKD 1MD9A 2DFTA 2A78A 1U7XA 2QUBA 2WYWA 2QKYA 4L8WB 4DG9A 3FPGA 4E2FA 2AOTB 5BWLA 3FDIA 4GIBA 4GPZA 4P86A 1S96A 5GOZA 1SKAA 3ZI0A 3DE6X 4D5EA 1E32A 4LOAA 3OPXA 4RY2A 3PK0A 4G5HA 2GUWA 5AVXA 4DA7A 3OU2A 1K6MA 1S8AA 4Q3CA 1SQSA 3IOYA 4JZKA 1C3LA 1G6HA 1RAAA 4RPCA 4ETWA 4CF7A 3DTVD 4DV1B 1H2XA 4ILKA 2Q1YA 1YR8A 5DLPA 1MV8A 1TO2E 3ZD6A 2IL1A 2C2HA 3LFTA 2GJKA 4DEXA 5JU6A 1EUZA 2HH9A 2NTNA 4MVJF 1G66A 4YI5A 1SVIA 1Z4KA 1YGYA 2LDXA 4O1IA 4EW2A 4MW6A 4YMHA 2X2EA 2WFLA 2DBYA 2FSVA 5EQFA 2BR4A 4MW7A 3TW8A 1YZQA 3R3VA 4LPKA 2IQIA 3T1YB 4BQNA 1L7NA 4GEGA 4DKXA 4NYMR 5KTMA 5DXAA 2HPVA 3WK4A 2FOIA 2WKPA 3RRNA 3AVYA 4PVDA 2C0PA 3DB1A 5CVCA 4B0OA 5HIKA 5YASA 2VN8A 4ZI7A 4P83A 2BRUC 4RTLA 1GITA 1Z2PX 2I7DA 4BGVA 3W5HA 3OEHD 1JKFA 1WHTA 5JCJD 1DX6A 2QE7A 3D3QA 4GKBA 3OQVA 4ENTA 5IDYA 1CRZA 1ZFNA 4K28A 4LI3X 2X19A 2BHRA 4DNQA 4AZSA 2I91A 2XYGA 1F6WA 1ONSA 3N8KA 3DDNA 1Z2EA 3F74A 3L3BA 4YALA 5IVIA 1RYZA 5B3AA 4CHGA 3AXTA 1VL5A 4J49A 3HI4A 1TFUA 2IODA 1G21B 1Z28A 2Q5CA 1JG2A 4EZIA 3WQRA 3PUWA 3T1NA 3FTNA 1UMDB 3DM9B 4TUYF 5CFRA 2CNWA 5CU7A 3BH6A 3CINA 3QLUA 4IBOA 3MYYA 3JVEA 4XUDA 2GTHA 3D81A 1M33A 1PWXA 3OEWA 4GLOA 1AKMA 4V2IA 3MM4A 3COZA 1S2IA 3TJRA 5G4KA 2DAPA 4UFOA 1O96A 4Q18A 1TNDA 1YKFA 4X6LA 1NN1A 3W77A 2QTNA 2ZJ6A 4MKGA 4MVWA 4YIKA 4ZVSA 4AXBA 2XLBA 1WRBA 4U7TB 3F78A 5AVJA 3KHKA 4NEQA 4PO9A 4ZALA 3LKDA 5TC4A 2DQ4A 3HYSA 3TZLA 3LLUA 1QONA 5GZ1A 3AJDA 3IPXA 3FKSD 4BPRA 4ZDWA 4Q0MA 2O2ZA 1UMBB 4K8RB 1ZNQO 5FKJA 2J3LA 4I5EA 3GOHA 2GCPA 3UM9A 4HS4A 1OV6A 4IDGA 5G3YA 2OXTA 2LRHA 3KUDA 5L6MB 4MH0R 4O0MA 3QA9A 2P67A 3BL8A 2GPWA 3TRHA 4F4DA 2GARA 2ZI7A 1M2JA 4PQFA 1K5PA 2W0SA 1X38A 1WMSA 4O4IF 2G8LA 3ZVNA 1II9A 3IP8A 3DOHA 4QBFA 3WB0A 1O4WA 3TYXA 3LPMA 2ZTVA 2BMJA 3TE6A 5JY1A 1R50A 5K0GA 3ZGLA 1CU1A 2JB9A 1RJWA 3EGIA 5JSFA 4AKGA 1SHUX 4RM3A 1XTQA 1TEHA 4KQ2A 4ZYVA 2E4YA 4MS1A 3IL2A 1WXGA 3LTNC 4ZYZA 1NG1A 4JT8A 4ETMA 1W44A 3C3JA 1ZAYA 4NONA 1HE3A 4LKRA 3K1ZA 1SKBA 4J7XA 1DEOA 3A1UA 2R8PA 1KU6A 3CH5A 3UYKA 4C6HA 2XWPA 1Q92A 2ZCVA 3ZXIA 3P1JA 4S0XA 5AQ1A 1KYYA 3TMKA 2D00A 2QL5A 3ZWDA 1AKNA 1ADYA 2ZR9A 3E0XA 5CNKA 2FWBA 2IJGX 4J0GA 2ZUWA 4BX9A 4TRNA 5LZ9A 3RWOA 2PKXA 1BX1A 1DV2A 3KUUA 5ITSA 1T8RA 1TKBA 3BTSA 3ZQ4A 4BMPB 1U80A 3GA5A 4BMYA 1KNQA 4Q47A 4S1WA 2OVBA 2QTGA 3CWCA 4O4LF 1GPDG 4JMLA 4CKCB 1K8ZB 2QRQA 4DCJA 1CVRA 5IABA 3LP8A 5BV2P 5L51A 5L45A 5CIYA 2ZJ3A 2OFPA 3HGTA 1U9IA 4W8GA 5CT4A 1QQ6A 3F98A 1LVUA 3IJRA 3OFNA 3TW6A 4TS3A 3ONWA 4DLKA 2SNIE 5JH7A 4ZRMA 2RGGA 4ZI7B 1Z2DA 2C2BA 1PDWA 3TVYA 1DKPA 2EF0A 2PVSA 1VL8A 2HDOA 3E3MA 3TCXB 1KEVA 3C8ZA 3NKLA 1MF7A 1I3LA 2H1LA 2JIBA 4H4DA 1ST3A 1NJ8A 3LC7O 2A35A 3WNZA 1X9IA 4HEQA 3EFOA 3SYMA 4GP9A 2WHPB 1XPJA 1FXUA 1RC8A 3JASB 4FLEA 1BE8A 2IY9A 4UUBA 4KLRA 5FBVB 3PVSA 4U2GA 2M6KA 4PLWA 1CUXA 4UAVA 1GTL1 5BPHA 4WXHA 3W3AH 1SBTA 1Q7CA 2AN4A 3LO5A 1ZZGA 5F5NA 3SK0A 3C24A 3TUJC 1HK7A 1JTFA 2WSSD 4AN0A 2Z6QA 1C30B 1UPTA 2VHZA 4WKOA 3AB8A 1FU8A 4YCBA 2GBPA 4NZ9A 4CU5A 5KOHB 4OFWA 4P81A 1W0KA 3AIOA 1B43A 4AN1A 1OBFO 5FV7A 2IUUA 3E9MA 1EFHA 1JLKA 1U31A 4MUBA 4W1SA 1ZI8A 2QAGB 3KZVA 4A8HA 5AVKA 1MAHA 3T4UA 2Q5JA 1E3QA 4EJSC 4G65A 3ZW7A 3RU3A 2ORIA 2XEDA 3EF1A 3O73A 3O82A 1X74A 3QY0A 3V4SA 1FDOA 1H2EA 3BCSA 2ZYVX 4GQAA 2ODNA 5F1PA 3FTPA 3UV6A 3R7WA 1GAJA 4CGZA 1J2TA 1W73A 5EIBD 1TW2A 5ELMA 1UMBA 1DTWB 3Q1LA 4CLOB 2AD5A 3KQOA 4WINA 5EKUA 2BMVA 2QTAA 2VFAA 1FW8A 3JY6A 4HNAB 5ALFA 1JAIA 1T36A 4F1JA 2JBHA 3IKTA 1M2NA 4M8IA 4B3CA 1PR1A 1ISIA 5JVDB 1ZM4A 1SBZA 2FRDA 3DA8A 3O2SB 4LYAA 4ZAFA 3TAXA 2GZMA 4MRPA 2OT3B 3K96A 5B1DA 4TM8A 2Z9DA 4G2NA 4YRDA 5AK4A 1K86A 2WM9B 4QUAA 4V0SA 4QQFA 1TYCA 5IMBA 1Y8QA 2QM8A 3F6CA 1T8UA 1RQXA 1VMIA 3RSFA 4WCDA 1J06A 5KOIA 4X1IA 3SC4A 5JISA 4BRUA 1K2VN 1SU7A 4F71A 1L3IA 2FEWB 3IUQA 1NBMA 4JGIA 3H0KA 3FRJA 3ITEA 1P3JA 5AOBA 5CLIA 4N6GA 4B7XA 2H2FA 4CL3A 3K92A 1GJRA 2ZRHA 3UKJA 2ZUFA 2JAWA 1YCFA 2PGDA 2YMPA 1GUYA 1L5GB 2H5EA 3R7NA 5CDFE 2QJFA 4C9BA 4MHOA 1RXYA 3MFYA 4GH5A 1XVLA 2XDAA 2XI4A 2CE7A 3BCUA 1NNUA 2XZTA 1WV0A 2PT9A 1K7SN 2PH3A 4Z8XA 1MC1A 2FVXA 3GGSA 5DP1A 4XX0B 4B2PA 1Z16A 2FFHA 4TM7A 3SHVA 4M98A 1PGOA 2ZITA 4U9UA 5JC8A 4P8RA 4B3IA 1FUEA 1C0IA 1FSFA 2RBGA 3KKZA 2P0AA 5TB5A 1I1OA 2XNKA 2GKGA 4ZYUA 3GG2A 3JD2A 3TEJA 4D3YA 2VBCA 2WSYB 4GGOA 1CK4A 2IVFA 2HNBA 4LOIA 5EGSA 3LOPA 5DW0A 1KR2A 4TTVA 1JTVA 2V9ZA 3ED1A 4QATA 1VZ2A 2RI0A 3SFVA 2VP2A 1MEOA 4W99A 2Y1EA 4FCCA 4IDAA 2JLWA 4S2UA 3CT6A 1WKBA 3RS0A 3GMIA 1J0AA 2GCOB 5DM70 1SC3A 4I0WB 5T4HA 1KZ6A 1ZCFA 3C6BA 4MMZB 4P7FA 4TQ9A 4I50B 4LG1A 2L17A 4A2CA 4W63A 3G5UA 4J9UE 4B6JA 2WF8A 1GLGA 2XA2A 3TNYA 5T4BA 3C6ZA 5C7IO 2OBXA 1P7YA 4D9KA 3E5NA 3PXGA 3T7AA 4KGVA 1E79A 1PHPA 1U5BB 4HQKA 3UMCA 2P4UA 3EUEA 4WFKA 3SHOA 3UFXA 3CGGA 2PS0A 3ONVA 1VLQA 2G5GX 4Q1VA 4D56A 4XWGA 2CMFA 4CEJA 1J8FA 2A0UA 5ISMA 4QPNA 4MQEB 1Y7HA 3RRJA 3GJ8A 4PRKA 2RK3A 3CX7A 3IILA 4M9RA 1RWPA 4F46A 1V71A 1X1RA 2COEA 4W7HA 5F1OA 4JBLA 4E11A 3V1MA 3LS2A 1ONBA 4H9GA 2VNJA 2XZDA 5GONA 3DEHA 5F33A 1U1EA 3D4IA 4BQOA 2UU9B 5SY4A 2H1FA 1Z47A 2FPIA 3C5VA 3IPYA 1MIHA 4OQLA 1N1GA 1P7CA 2ZRPA 1IHUA 3HN7A 2P4SA 4ZCRA 2HA3A 5KVAA 3A05A 3AINA 4FWBA 2EQ5A 1GADO 2WQZA 1QTRA 3Q98A 2UZ3A 1DKRA 3MIIA 2G5PA 3W8FA 1UDCA 1AXRA 1BFKA 3QU9A 4NMHA 4X94A 4EYGA 4XARA 4ZO6A 5LA6B 2AA3A 3U7JA 1TECE 2MR5A 1JJVA 1OIXA 3A2LA 5H68A 1QFSA 4EG1A 3ZWXA 3FCUB 1KSGA 1QGAA 1SQ6A 1UP7A 3B1WA 3WRVA 1P7ZA 1NXVA 4EI9A 2E5FA 4YN3A 1C7ZA 1PN3A 1DARA 2B1RA 3I1YA 4J6FA 4KLNA 1M0TA 1E66A 1XZFA 4M8KA 3O4HA 2AR7A 2ZRBA 3NXKA 1ZYUA 2NTEA 2D7CA 4X41A 2ANCA 2NGRA 5DISB 3VHLB 1D2GA 1U2GC 3OT5A 2IOHA 4LRWA 4OUDA 1SIBE 5L4NA 3HUTA 1L4FA 2H7XA 4K6OA 3A8TA 2I29A 5H4HA 3KVOA 1VE9A 4DMRA 4ZYYA 4QM6A 4Z7QB 4BE4A 4ZICA 3GP3A 3SZOA 1U0TA 1TUEA 1SD2A 1Q0RA 1G9XA 1GUFA 1QKIA 1SVUA 2M32A 3GEEA 3KXIA 1GAQA 4YS6A 3OIDA 4CG0A 3RYHA 2XUKA 4TZ6A 1ODIA 5IM5A 4WL0A 3TIFA 3UANA 3I4CA 5CYGA 5AQEA 4AKTA 3OCUA 3DDSA 3G2HA 3DPUA 5A3VA 5KAMA 3VR5D 4FS3A 2B92A 4JOQA 1NDHA 3UMVA 2EP7A 1DQPA 4ZAWA 3WWDA 1YVUA 1VPWA 5KNCA 1IEWA 5A4AA 1D03A 1N3YA 2W42A 1UIMA 2ID8A 3BXZA 4BAGA 3UBTA 2G83A