2I3AA

Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (rv1652) from mycobacterium tuberculosis
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
344
structure length
344
Chain Sequence
ATKVAVAGASGYAGGEILRLLLGHPAYADGRLRIGALTAATSAGSTLGEHHPHLTPLAHRVVEPTEAAVLGGHDAVFLALPHGHSAVLAQQLSPETLIIDCGADFRLTDAAVWERFYGSSHAGSWPYGLPELPGARDQLRGTRRIAVPGCYPTAALLALFPALAADLIEPAVTVVAVSGTSGAGRAATTDLLGAEVIGSARAYNIAGVHRHTPEIAQGLRAVTDRDVSVSFTPVLIPASRGILATCTARTRSPLSQLRAAYEKAYHAEPFIYLMPEGQLPRTGAVIGSNAAHIAVAVDEDAQTFVAIAAIDNLVKGTAGAAVQSMNLALGWPETDGLSVVGVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetyl-gamma-glutamyl-phosphate reductase
publication title Crystal Structure of N-acetyl-gamma-glutamyl-phosphate Reductase from Mycobacterium tuberculosis in Complex with NADP(+).
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 104
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.38: N-acetyl-gamma-glutamyl-phosphate reductase.
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2i3aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2i3aA01
3KM0A 1CEQA 1P1RA 2V7PA 4R1UA 3VKVA 3NT5A 3JQAB 3TNLA 5L51A 1PQWA 5JPIA 3IL2A 5L7TA 3DZHA 5DN9A 3DTTA 4CMJA 3JQEA 1GUYA 2WMDA 3NJ4A 3BMNB 4F45A 1QMGA 3GK3A 2O3TA 4OQYA 4M54A 4RQUA 5ADHA 3L9WA 3COSA 2YV1A 5BNTA 5G2OA 3EYWA 5BSEA 3WGZA 2OL4A 4Q3AA 4LCJA 1E1KA 1HTBA 1KY5A 4ND1A 5JAIA 2Y1CA 4CUKA 5TIIA 3ZV5A 3QVWA 5JSFA 4YDRA 5DP2A 3GY0A 2UAGA 5JS6A 4G65A 1RYEA 1M75A 4JGBA 2Q22A 2CMDA 4RCVA 4XDZA 4GGPA 3WGIA 4BNIA 1QYDA 2I3GA 3TSCA 3W4KA 1WXDA 4FFOA 1R16A 3IUPA 4XKJA 2FP4A 2CDAA 4XDYA 3WICA 4JCOA 4GSLA 4WECA 3RKRA 5EN4A 2QZZA 5KJEA 3TRIA 3LT4A 4GQAA 1SC6A 4D3FA 4TMFA 1IPEA 2JAPA 1O95A 4YRBA 4UUOA 3AU9A 2SCUA 4BB6A 4K6CA 3OJEA 1KEWA 4DMMA 3DAPA 3AOEA 1X7GA 3GGOA 4XQCA 4XZ3A 3WIEA 4AJ4A 1XU9A 3QE3A 3ZH2A 4YJFB 1MA0A 2W8ZA 3ZHXA 2OBNA 2YDXA 2P5YA 2X0JA 3ZV3A 5IDYA 3BTVA 5TF4A 1M6WA 1EUZA 2FSSA 2DFVA 1DRWA 1PJTA 3ZWVA 5G4LA 3WLEA 3WXBA 3IC5A 3O03A 5JE8A 3HFSA 4YAEA 3TF5A 3KYDB 1ZH8A 1ADBA 1O94A 2D1YA 3A06A 2DVMA 1T2FA 1ISIA 2AQIA 2Y1EA 3PZRA 1UDCA 3EY4A 4NI5A 5I9MA 3RFVA 3U4HA 1LU9A 1UZMA 2YHIA 3OQ1A 3RSHA 4WCDA 1S6YA 2JD1A 4UVGA 4JJFA 4WLVA 5F1PA 2PGJA 1OMOA 1GAEO 4PGFA 2IYPA 4CL8A 5JCJD 1NM5A 3ABIA 2BLLA 3BMCB 2PKQO 4B7CA 4K1LA 4YAKA 1PS9A 4Z0TA 3OETA 2VOEA 4D0RA 1YBVA 4U0KA 1FDWA 1C0PA 5BSHA 3VHRA 3I23A 2OFPA 2WYUA 3DOJA 3AU8A 5U4QA 1LXCA 3RJ5A 3UAGA 4P8RA 4D0SA 1ORRA 1VLLA 4NJMA 4XD2A 2E49A 4J7XA 1DJNA 1WVGA 3H3JA 2BFOA 4NBTA 4J1QA 3X2FA 3PLNA 2X5JO 4JIGA 1NVMB 1ZCJA 4L4SA 1GCOA 1MC5A 1LLCA 2I99A 3A4VA 3F6YA 5K6AC 3ANLA 2Z1NA 1DBVO 2WJPA 1JQBA 2WEKA 3E82A 1DIHA 2IEDA 1EUCA 3KEQA 1PZHA 4M86A 1GYQA 3FPLA 1OZAA 1X14A 1BWSA 1H94A 1BXGB 2OORA 5B4VA 4IMPA 4NH4A 3IDSA 3PHGA 4GLOA 2AEJA 5JYDA 4J4BA 5KKAA 4FSHA 4PLWA 5G0VA 2JCVA 4J2OA 3I9OA 3H9QA 4NBVA 2EWMA 4OYRA 3QHAA 1SZJG 2B4TO 4JJGA 4YJHA 1ZK3A 5DZSA 4W82A 5AXAA 1Z7BA 3OJLA 1YL6A 4HWKA 2OMEA 3AWDA 5BNFA 3JQ8A 2DQ4A 1N5DA 4XB2A 1DFIA 2BFMA 4CQLA 5L40A 4CM5A 1D1TA 1BXKA 3JQBC 4KDEA 4NJOA 4AJLA 1SB9A 4CM4B 2CVZA 2Y66A 4F6LA 4HKTA 4YB8A 4R3NA 2IRWA 4E12A 3JQAD 4CV3A 4ONEA 3LC7O 3ZWXA 1NBOA 4BKPA 3W8DA 1MLDA 2X9VA 2ZTVA 5FI3A 2WE7A 4ALNA 3BMQB 5BQFA 4WLFA 3O4RA 2QG4A 2Y0DA 2P68A 1Y8RB 1ZK2A 4KWHA 4DBVO 1EFKA 5CAEA 3ANMA 3NKLA 4IY1A 5JXWA 2EJVA 2VWGA 4NK4A 5ICMA 4BNWA 2Y05A 2ZKLA 1AHHA 3NX4A 5CEEA 3VZPA 2PH5A 3KV3O 3Q1LA 3PIIA 1LRLA 1X7DA 3QWHA 5TC4A 4BNVA 1HXHA 3GC6A 1P1HA 5ER9A 2ZYGA 5IN4A 5JAQA 4GMGA 3RBZA 1E7QA 3RUHA 2AEMA 1MFZA 3ONDA 2G5CA 2B0JA 3U5TA 4DPKA 3JD4A 1JLLA 2C07A 3UFXA 2V65A 3WJAA 4YEDA 1HDZA 3JQDA 4X54A 1T4DA 1B8VA 1ZEMA 1KC1A 2X0NA 4CM9D 5EMHA 3K92A 3S1LA 2P5UA 4YRDA 1Y9AA 3F5SA 1X0VA 1EFLA 4GMFA 2Y1OA 3K5PA 1QLHA 4R54A 4PCVA 3TZHA 1VC2A 4GBJA 2JKVA 4TSKA 3MTGA 4MVJH 2B35A 3VZRA 3UGKA 2GPTA 1YBAA 1VPDA 2D2IA 3DZIA 1GYPA 4NBWA 1ADCA 2FPPA 1NVGA 4A7PA 2GD1O 4DUPA 4HV4A 3Q2IA 1LQTA 2VZ8A 5DCYA 5FI5A 1TLTA 1TT7A 2WSBA 4IJWA 4HX5A 4MP8A 2ZIZA 1DLJA 3PGXA 2J5QA 4R68A 4AJ2A 1NQ5A 3RJ9A 3WMWA 3GG2A 5TLSA 5LDHA 3PGJA 2BKAA 3C8MA 5T8KA 1GL3A 2HMSA 3HZZA 1FMCA 3PVZA 3IJRA 3ZWYA 2FY8A 3QP9A 1I32A 2GERA 3BMOA 3OIGA 3Q6IA 4C7KA 2VWQA 5HA5A 6ADHA 3INGA 1D4FA 5JFOA 4II2A 4BMVA 2J3IA 6LDHA 3SJUA 3N74A 4BKRA 1KVTA 1NFRA 4CODB 3I9KA 3KEOA 3OJOA 2A35A 4YQYA 1OI7A 1PIWA 5A9TA 3ZWCA 1H2BA 1JTVA 4KTTE 1J6UA 4RVDA 3TZCA 1HDYA 3IS3A 3ZU5A 5DNAA 3KVOA 5JW6A 1UDAA 2EW8A 1VKNA 3ZW9A 1C1XA 3FTNA 5B1YA 3WBBA 4U6SA 4YJHB 2C82A 4KTVE 3ZDFA 3ZNQA 1NHWA 1PR9A 3ASVA 2CZCA 1Z82A 3BXXA 3KLMX 3M2PA 1FF9A 2O7SA 3AY7A 4JBIA 1UP4A 1Z45A 3PLRA 5GZ6A 3AOGA 4A73A 1D8AA 1DIGA 3RC1A 1NYTA 1DSSG 1QKIA 1BVRA 4B3HA 1RM0A 4R3WA 4RF5A 4FR5A 1T26A 1ZUD1 3H9JA 1JDJA 1VJ0A 2X9GA 2PFGA 3AW9A 5EPOA 1ENZA 1LTHR 1NWHA 1TT5B 1PJSA 1IOLA 4I5FA 2CF6A 2PZMA 3UCEA 2HDHA 3E5RA 1LDYA 2IODA 3MWDB 3VH3A 4YRAA 3IAHA 5CPBA 2PNFA 4XYGA 3DMTC 1NNUA 1MUUA 1CRWG 1XU7A 2YZ7A 3NAQA 3FTPA 1D3AA 3QIVA 3U4CA 3D7LA 2NSDA 3SC4A 1PEDA 1I3NA 4Y6SA 4RPKA 4XWYA 4M8SA 4EJ0A 5IDWA 1E6UA 1A4IA 1U1IA 2YFQA 2EW2A 3F4BA 1Y6JA 1M67A 1CYDA 4NPCA 4ZVVA 4DA9A 3WS7A 1XGKA 1N7GA 4S1VA 3V1UA 4CMEA 4XRRA 3GVCA 4B3IA 3TPCA 3B6ZA 1U3TA 1H9AA 2FRDA 5EQDA 4CM9A 3KYDA 1BW9A 1KETA 2R00C 3D3EA 2H1SA 3JTMA 3T7CA 2Z5LA 3TL3A 4M87A 2DBVO 4KUGA 3C7DB 4ALLA 4AFNA 1ENOA 3A1NA 2NTVA 4IINA 5EIOA 4BUCA 2I66A 5AYVA 4NU6A 4IXWA 4YT5A 3GR6A 2Q2QA 3R3SA 3PFFA 3GUCA 3WFIA 3G1TA 5CDSA 4XYBA 2J3JA 4L8VA 5JY6A 4YJFA 3QV1A 2ZCVA 2O7QA 1YQDA 3V2UA 5DBGA 4PG5A 4JROA 1WDKA 4PLGA 3CH6A 1XEAA 3PWKA 3NTQA 3X2EA 4B79A 3I5MA 1ONPA 2NU9A 4ZRMA 4CLXA 3EUWA 3E5MA 4TKLA 4Z9YA 4IZHA 4OJNA 5KKCA 4J9UE 5G0SA 4BO8A 4ROSA 3Q11A 3H2ZA 3PFWO 4N5LA 3S55A 3WTCA 1Y81A 3BHMA 2BGKA 3MCVA 1I0ZA 3RQSA 3JQ6A 3DZGA 3CSDA 4C7JA 3P2YA 4YT8A 1B8PA 1YO6A 4E5KA 3VOSA 1U28A 3I9LA 1YQXA 1PR3A 4CV1A 1NXQA 4IGEA 1R0SA 3C1TA 4XYMA 4E32A 1JKJA 2X0IA 3ZNPA 4B4OA 3VPXA 2VUUA 3QLJA 3SC6A 3NT2A 1HE2A 3LT0A 3V2HA 3ZV6A 5JAMA 4ZA2A 4JK3A 1ZEJA 3WLFA 1C1XB 2HK8A 1GV0A 3R1IA 1E3JA 2UDPA 3HB4X 4NFHA 3RFXA 1EBUA 3TFQA 4ALJA 1AHIA 4YAGA 1SNYA 5HTOA 1GEGA 3G3EA 1IULA 3OH8A 1DOHA 4FJ0A 3VDQA 1B3RA 2PTGA 3DOOA 1G6KA 1N9GB 2PZLA 1VI2A 5ILOA 2RBEA 4WLOA 4FPXA 3MJSA 4OH1A 1YXMA 4YACA 2ZTLA 5A06A 3S2FA 1WMBA 1WP4A 4UULA 5G0UA 1CWUA 1P9LA 3WTBA 4RLHA 3ETEA 3ST7A 2DFDA 3IKVA 4BKUA 3SEFA 4IDGA 1U5AA 4BO2A 3GFBA 1C1DA 1LUAA 1ZW1A 4PVDA 2PKRA 2Q1WA 5F5LA 2QZ9A 1ZFNA 1GFSA 2JL1A 2X5KO 2ET6A 3V5NA 1PZGA 5IAAA 2CY0A 3H6KA 3ZGYA 1VL8A 3JYPA 3GVIA 3K2BA 2OZPA 4L73A 3UH1A 2VNSA 4QSMA 2C5EA 3L4BA 1LDGA 3HHPA 5TJHA 3CPSA 3DHYA 3FNFA 4CPDA 4RGBA 3SLGA 4DLAA 3MWEB 3BTSA 1WDMA 1GPJA 3GQVA 4KQXA 3PHJA 4Z0PA 1QRRA 3M6IA 4MVJF 4WNCA 4PLTA 4BGUA 4TRRA 5L9AA 4KP7A 3OM9A 4CM3A 2X5OA 2C2XA 4Z6KA 2W2KA 1O6ZA 4F46A 4TZKA 4UVDA 5IJZA 1HSZA 1Y7TA 3PDUA 3OF2A 5JYEA 5EERA 2DBZA 3PIDA 3U9LA 3A28A 4R01A 5GY7A 1O89A 3ZWAA 4YBZA 2YYYA 4ZHSA 2RH4A 2VHVA 1Y8QB 3ZWPA 4CMIB 1GUZA 3OEYA 4BNFA 2AMFA 3PWSA 2FSVA 4OSOA 1P45A 2WM3A 4WUVA 4D43A 3DBLA 1NR1A 1NAIA 2JJYA 2H9IA 2YDYA 2DTDA 3KYBA 3KBOA 4OKNA 5MGBA 1T2CA 3C7AA 4R9RA 1XHLA 4YR9A 3DZKA 1JVBA 2AQ8A 4D46A 5EINA 4DLBA 2GRAA 1HZZA 5HM8A 3PRJA 1EDZA 1XSEA 4XGIA 4DQXA 3ZHZA 2D5CA 3F5QA 4IDFA 2F1KA 4G2NA 2GN9A 4DYDA 3SVTA 1KBZA 3ENKA 3VPGA 1DEHA 4DQVA 3CEAA 3LT1A 1DC6A 2ZYAA 1MB4A 3K31A 5HRUA 2GR9A 4B4WA 3DBHA 5IN5A 2HAEA 3ZNOA 2BHLA 1ZMTA 2QHXA 1E77A 4FIZA 4UEKA 1PSDA 3VC7A 4BO7A 1KS9A 1F17A 2F00A 2OO5A 4RVSA 2PGDA 1O5IA 3ULKA 5KIAA 1PU2A 3HDYA 4CQLB 1KVUA 1U3VA 2EHDA 4O6VA 1R4NB 3JQ8B 4WPGA 2HMUA 4N7RA 4BNXA 1SB8A 4K28A 4BNYA 4D45A 3JCZA 5K0ZA 4YVFA 4J2HA 4K26A 1FDTA 3H9GA 4PFJA 1KEUA 3Q9UA 3DZJA 5TSDA 3JQFC 1E7SA 2O3SA 5IZ4A 2B4RO 2UYYA 2NVBA 1ONOA 1FDSA 4H16A 3GMSA 4QO8A 2OHXA 3CZMA 2AQKA 2Q45A 2X86A 1ZSNA 4KUHA 5EESA 2C20A 3QWAA 2Y0CA 3VH2A 3U4DA 1P3DA 4XR9A 3E8XA 1R4MB 2GSDA 3PJFA 4J43A 1DO8A 3KLPX 3DFZA 4MKRA 4FW8A 2G17A 1N92A 3VPHA 4Y6RA 2G82A 4ZRNA 3TN7A 2DC1A 3HNPA 4IMRA 1ZSYA 4B7XA 1H93A 3EAGA 2I3AA 1XKQA 1BW9B 5CDTA 1H5QA 4W9NA 5H81A 4AJIA 4W99A 4O0LA 1IUKA 1PL7A 1EMDA 5LDGA 5I7FA 1VRWA 3I9JA 3MJTA 5F1OA 1DFGA 3S2EA 2HRZA 1UAGA 3TZKA 2ZB8A 1DXYA 4CLOA 4MP6A 4A0SA 5C3MA 1OBFO 3CTMA 1M2WA 5T64A 3DBLB 3LLSA 5T6BA 2IYOA 5AQ1A 2CVQA 4QFCA 1F8GA 1RM3A 5L95A 5JYFA 2EXXA 3VKUA 4CMIA 1UH5A 5ENDA 4BO9A 1E0DA 4DL9A 2HK7A 4R5MA 1P1IA 3H65A 1VSVA 1PZEA 4BV8A 3S2GA 2XPCA 2PLAA 4L0QA 1B16A 4LGVA 1X0XA 4YT2A 1ISJA 3DBRB 1T24A 1VL6A 5KVCA 3GHYA 1ZXLA 5THKA 1GYRA 1JN0A 3C3XA 4GVXA 2BI8A 1YGYA 3RUAA 1H9BA 1P1FA 1GADO 2V6MA 4ND3A 4WEOA 3F46A 4QT0A 2FWMX 1LI4A 1AN9A 4OIMA 1WLYA 2VRCA 4UREA 1PWXA 4MO2A 1DB3A 2HUNA 3GEMA 4CUZA 1GV1A 2UVDA 1VL0A 4AJJA 2BELA 4E5NA 3F3SA 4E31A 1HKUA 3NUGA 1NQOA 3VH1A 3ZU4A 2GDZA 1AXEA 2VZ0A 2G76A 4D41A 4PG8A 5A4DA 3AI2A 4JJIA 1NPTO 1XWFA 4TZTA 3NEPX 3B1KA 4J16A 3P5SA 3KO8A 2EJWA 3G17A 1A7AA 3EHEA 4ND2A 3G1UA 2RHCA 2WWRA 3MJCA 3MEQA 1I2CA 2NU8A 2PK3A 1KERA 4NU5A 3TZQA 3VVCA 2VHXA 1ZXBA 4HBGA 2NU6A 4LW8A 1YOVA 3WSVA 1NX6A 2D3TA 1QP8A 4H7PA 1D1SA 1CJCA 1PJQA 1VE9A 2GO1A 4MIOA 3JYLA 3PQEA 4PRKA 1PGJA 4PZEA 5A3VA 1E7WA 2AQHA 3L6EA 4F3YA 3ZV4A 1L7EA 1I33A 2EV9A 4E13A 4FC7A 3DZBA 1SEVA 3ASUA 4I5DA 4XJTA 1UAYA 4OGWA 4QUKA 4HNGA 1DRUA 3RD5A 3UHAA 3FSRA 1JAXA 1HEUA 1I5RA 4E4YA 2VRBA 1EBFA 1HDCA 3W8EA 3G49A 3RFTA 2CD9A 4U0JA 4FD3A 3DBHB 3PTZA 5HS4A 2I67A 3QWFA 1I24A 3ZHBA 3P19A 4OAQA 5M6DA 1V0JA 4ZQEA 1C0IA 2Y1FA 4Q9NA 4LMRA 1GD1O 4K9DA 2FZEA 1WMAA 1KVSA 1WDLA 3I52A 3RIHA 1PQPA 1PJCA 4QO7A 1YOVB 5B4UA 2DLDA 3JV7A 5KVVA 1NP3A 3WQSB 5I7EA 2A4KA 5EJ2A 5K9ZA 1W0CA 5TQVA 3GPDG 2YQ5A 3RC9A 2NLOA 4MVJA 4O59O 2E48A 2P9GA 1J49A 1MGOA 4BKOA 4IXTA 1EVJA 1HWYA 4J4TA 1W73A 1R0LA 1KYQA 4EJMA 2NTNA 1PJ4A 1KVQA 1C0KA 3OJFA 5DBIA 3ICPA 3RU7A 4YT4A 1KEVA 3EW7A 2R6JA 3CKYA 3MJVA 1HE3A 4NZ9A 1MXHA 2HJSA 2TMDA 5T57A 3ZI0A 3U09A 4AG3A 2JFHA 1LRJA 3AOEC 3NTOA 2EKQA 4XGKA 1TXGA 5L7YA 1E3IA 5MDHA 1F06A 2POQX 4IDDA 1NQTA 4UUPA 4W4TA 2OBYA 3GNQA 4J0FA 4IJVA 3PK0A 4XRGA 2NU7A 5JC8A 1V3TA 1NR7A 1NHGA 1YDEA 1YL7A 2IZZA 4MJLA 4GPD1 3MOGA 1QSGA 3NRCA 4E6PA 2ZTUA 1Z7EA 2IE0A 4CMAA 1OC2A 3V2GA 5L4LA 1YDWA 1EZ4A 4NQZA 4TKMA 2E82A 1K2WA 4I1IA 3ZNNA 4MKZA 1Z73A 5JC1A 2AG5A 1KOLA 4FN4A 5JDIA 4B8ZA 1C3VA 2JCYA 3WG9A 3RKUA 4J7CA 1I01A 1DLIA 4IM7A 4FFNA 2A94A 2YHUA 2PA3A 1JVSA 3AUAA 2W4QA 3C85A 3JYQA 4UEJA 2W98A 3WGOA 3NJ8A 2C7VA 2P91A 2R2GA 1LLQA 2QIOA 4II3A 2GN6A 3ZCXA 1N8KA 3MJ4A 5IG2A 4Z3DA 4OMUA 3JYOA 1GQQA 1E3WB 4JP2A 1JKFA 2OP0A 1TEHA 1Y5MA 1W8DA 5I8WA 2BF7A 3FHLA 3PHLA 1PQUA 5H83A 2Q4BA 2HLPA 4RVFA 5ITVA 4CR7A 4UVEA 3RUCA 4NG5A 4FB5A 1M6HA 4IQGA 2O23A 2AHRA 4NNJA 3UKOA 4PLCA 1P1JA 4CMCA 4FBGA 3V1TC 3STHA 2Y1DA 5FFFA 2X8LA 1CDOA 4DRYA 1E6WA 2CUKA 3JQGA 4TRNA 4Y9DA 5K6AA 4RQTA 2QYTA 4G81A 1IE3A 3E48A 4BQPA 3WGTA 1HZJA 4PZCA 2VTEA 3O8QA 1IZ9A 5H82A 2HRBA 3BA1A 1PJLA 3ZWBA 4MKXA 3ETDA 1DJQA 1LNQA 3WQRA 2AEFA 5BSGA 2HK9A 4OSPA 5B12A 3I3OA 5CG1A 4BNUA 2X22A 1DAOA 3IJPA 3NDJA 4Y67A 5A9RA 1R0KA 2RAFA 5KJ6A 1TVEA 2PWZA 3E1KA 2B4QA 3ITDA 4BV9A 3AY3A 4ZQFA 3NYWA 1MFPA 3HSKA 1PJ3A 1LBEA 1BDMA 3R3JA 3SLKA 1VKOA 4RF3A 3FR7A 3EMKA 4IPTA 4UUNA 2AW5A 3KETA 4D7AA 5DDIP 1JAYA 1LSJA 4R1SA 2AE2A 4FCCA 4RF4A 4FGWA 1E1MA 4HY3A 4MVJD 1E3WA 1F0YA 1ZK0A 2VRCD 3CMMA 4ND5A 1F14A 1SO8A 4R16A 3W4JA 5A5EA 4GVLA 5F21A 1ISFA 2EP7A 4JN6B 1PZFA 4YXFA 1DIBA 3IMFA 5F5NA 3ONFA 4AJ1A 3BIOA 3FCOA 3QVTA 1QR6A 4IUYA 4Q39A 2C5AA 3BMOB 4Q3CA 1YKFA 1H0KA 3QRWA 3I9MA 3HUDA 4IJUA 4WK6A 2YV3A 5AXCA 3S2IA 5U9CA 5JMPA 1V3VA 3E9QA 4BIIA 5TS3A 1I8TA 5J9GA 5I9LA 4C4OA 4DIFA 4IS2A 1A72A 1ARZA 1T1RA 4EI2A 1NTOA 3GDOA 3QW2A 1EE9A 3B1JA 4P22A 8ADHA 1ONNA 3I4CA 5JDCC 4WCFC 3D3WA 1CF2O 1LDMA 4DYVA 2XAAA 3ZW8A 1I2ZA 2OGUA 3H5RA 1YS4A 3OHSX 4A2CA 4IDCA 2V6FA 5G4KB 4W7HA 4PLVA 1LDNA 1YB4A 3KYCB 3W6UA 2YQ4A 3DL2A 3OIFA 5BNIA 3PYMA 4YWJA 2W2LD 4EW6A 1XDWA 2Q50A 3O26A 1I3LA 4CM6A 3JD0A 3ZN2A 2W2KB 5TGDA 3UXYA 1HE5A 1ZZEA 4GWKA 3WYEA 3WBFA 3FWNA 1YH3A 4RPLA 1VM6A 4GX5A 4XJSA 4DIBA 1PGOA 2H6EA 3JD1A 4GSKA 2HKIA 4QQRA 3OQBA 4XIYA 2C7GA 5B37A 5A3JA 2Y0EA 1RM5A 4PLFA 5L7WA 1GTMA 5GMOA 3MJEA 4P4NA 5ER6A 1ISMA 1BHSA 1T25A 1XLTA 2G1UA 2I9PA 1W4ZA 4FFLA 1IHYA 3OA2A 3W4IA 1GPDG 3UCFA 2VT3A 1BG6A 3AJRA 4YTEA 5IDQA 4BNNA 2VWPA 2VYVA 4J0EA 1UJMA 4NIMA 3D4OA 2O48X 3BTUA 1QYCA 3DTYA 2XXBA 1YJQA 4P38A 1DIAA 5T8KC 2YJZA 3LQFA 3K2EA 1ML3A 3Q9NA 3KOUA 4GH5A 1Q0LA 2CF5A 2B36A 3ROQA 4DVJA 3ICCA 4I8XA 2XOXA 1UZLA 1ENPA 3RUFA 1HDOA 5F3RA 3BMQA 5CEFA 3BMNA 1TI7A 1B14A 2I65A 2ZQYA 4JX8A 1R12A 5ENVA 2PGLA 1UXHA 3RVDA 2WYWA 3PQFA 3JQ7B 4DBZA 4J3FA 1ISHA 3UOGA 4L4RA 4GLLA 3CE6A 2PV7A 4R1NA 3TL2A 3DR3A 2VWHA 3RBVA 3OMLA 4N18A 1XQ6A 4CM4A 4FOSA 5T73A 3KZVA 3O9ZA 4PN3A 5KWEA 3ADPA 3KHUA 3HADA 4IIUA 1E3EA 1TB4A 1K3TA 1JKIA 1UXIA 3HQ4O 4BHTA 3DAFA 2B5VA 5DP1A 4CQMB 4BNKA 1NFQA 4L9RA 4LSWA 2ZYDA 4MPDA 4B4UA 3AM4A 4XEHA 1QYVA 3ZWOA 1UXGA 4AJHA 3D5QA 4NHEA 3C1AA 3GRPA 1PS0A 4ITUA 4LMPA 1GY8A 1V35A 4TWRA 4IDAA 4L76A 3UW3A 2EGGA 4L4XA 1B8UA 2BH9A 3I83A 4QEDA 3WDSA 4F6CA 4BO0A 5JCJA 3ANNA 3CUKA 3PZBA 5JAZA 3EVTA 5TX7A 5JBIA 3DQPA 1KEPA 3QWIA 3SX2A 4GX2A 2EKLA 4PZDA 4BB5A 2Q4EA 5COQA 1E7MA 1K6XA 1YVEI 3KYCA 3OBBA 1P74A 3QJ5A 1HETA 1R37A 5A1TA 5G4KA 3GAFA 3BMCA 3WX0A 4AJEA 4CMBA 3ROPA 3K96A 1PTJA 4ZN6A 2XF8A 1RJWA 4KQWA 2HSDA 2Z95A 3K30A 4E2YA 5AOVA 1GQ2A 4A03A 1UR5A 1LSUA 4RJTA 2YHIB 8LDHA 3PQDA 2DU8A 4IJKA 5JY1A 1LA2A 2G0TA 4Q3DA 3JQ9C 3U49A 3ZWNA 3H2SA 4M55A 7ADHA 5KNLA 4ESOA 1ZVMA 3PHHA 4XX0A 2JHFA 1GZ3A 1LDEA 4IZIA 4BNMA 4E5MA 1QLJA 4FJ2A 4CMEC 2P9CA 4NBRA 3HN2A 4KDFA 4WJZA 2JD0A 4DQUA 3BZUA 3K6JA 1YBMA 1E5LA 1PJ2A 3D0OA 3DOCA 1QORA 3LDHA 2WTBA 3DXFA 1J5PA 5AVOA 1BDBA 2Q2VA 3H4VA 3H9UA 1KIFA 4GKBA 1P0FA 3U3XA 4E5PA 5CEJA 1B0AA 4XA8A 3BHIA 1O8CA 1J0XO 4J7UA 3E6AA 4R69A 2ZK7A 1GZ4A 1RKXA 3OSUA 1B26A 3TQHA 3GRKA 4Y8VA 5IZCC 1PS8A 3ZU2A 3HG7A 5F1KA 1B7GO 5DCUA 1S7CA 4DMLA 5BR7A 4U5QA 2Q99A 4IBOA 5I8ZA 3RC7A 5ILGA 1UP6A 1U7TA 4FOOA 3AUTA 4JP3A 4TQGA 4R41A 3WYBA 5C7LO 4RVHA 1A7KA 4O1MA 3D4NA 4IS3A 3JD3A 3OP4A 4I5EA 4UEOA 1JWAB 3RUDA 4EZBA 2HCTA 1LC0A 2P4HX 1R4NA 2NVUB 1DC5A 2QYSA 3UUWA 1SCUA 4FFMA 1Q7GA 4K6FA 1TA4A 2A92A 3E03A 4NBUA 3HDQA 4CV2A 3FN4A 1LC3A 5C37A 2AE1A 2VT2A 4M1QA 2C59A 4CLRA 2ILTA 1E7YA 2CVOA 1X7HA 4RPJA 1PWZA 1PL8A 5EL0A 3CZRA 3RAJA 3KRTA 2NV6A 1GZ6A 3JQAA 2PD4A 1H6DA 4XIJA 4CMKA 1X1TA 4RDIA 2LDBA 1AXGA 1ULSA 3LC1O 1NWCA 2ZTMA 4E0BA 3AM5A 3PXXA 4WLEA 2EIHA 5CHEA 2VYND 3B20A 3NDRA 4HUJA 4FQ8A 3TWOA 2NVUA 4BKQA 1EK6A 3PYXA 1I30A 1ZK4A 1KC3A 3C24A 4GI2A 2DUWA 4I9UA 4KZPA 3TOXA 3TZ6A 1EDOA 1Z6ZA 1KY4A 3M1LA 2VTDA 4BO5A 1BVUA 2UV8A 5C7IO 4Y6PA 5COBA 1GEEA 5IF3A 2FZWA 1HLPA 5JMWA 1VSUA 3H3FA 3FNEA 4HFRA 3V8BA 1Y8QA 1LEHA 1R15A 3AY6A 1PX0A 3H5AA 2B83A 2IXBA 3FRJA 3BTOA 3PP8A 1EEHA 3DMYA 2YW9A 1ENYA 3FD8A 3IKTA 3PI7A 1ID1A 2AXQA 3ZWMA 4W7IA 2VNAA 3HWRA 3L77A 1DAPA 5A04A 3B70A 2QRLA 4H3VA 1P0CA 5C7OO 4NK5A 1PGQA 1ZO8A 4CLEA 4N54A 4D42A 4BNHA 2J3KA 4I9NA 5A5FA 1T2EA 3DONA 1Q0HA 5A02A 4R9SA 4H15A 5TRTA 4AICA 1OC4A 3OIDA 3KB6A 5TT1A 3RUEA 4ND4A 4Z0HO 5JYAA 1XR3A 2CFCA 2Y68A 3TDKA 3C1OA 4R1TA 3R0IA 5FYDA 3PDJA 4R5HA 4NFYA 2VYNA 4OQZA 2OP1A 1N1GA 3INTA 4DPLA 3KSDO 2X6TA 3T4EA 4YQZA 2VHZA 4RDHA 3RWBA 2B69A 1K5HA 4ALIA 5CFZA 1HLDA 1P1KA 3LF1A 4Z9XA 3MZ0A 3PHIA 2FR0A 5HS6A 3LT2A 3O38A 4OOFA 4E3ZA 1SOVA 4BO4A 2NNLD 4B4VA 9LDBA 4TVOA 3GGPA 1E3LA 1HYGA 3F47A 3MOIA 2QQ5A 4D79A 3WWZA 2DBRA 2NADA 2D5AA 1BSVA 3FBGA 3EZYA 3ORFA 1X13A 4CMHA 4LRTB 4MVJG 4E5YA 4TRMA 1Y8RA 4FFRA 4JBHA 1P33A 3M1AA 1W6UA 4MINA 2Y1GA 2ZATA 3GEDA 3NV9A 1N1EA 2FR1A 3FI9A 4QXMA 5I7VA 1DPGA 3AUUA 4GAEA 3WJ7A 5KJ1A 4DXHA 4CLHA 1O9BA 5A05A 2A9FA 4U7WA 4PLHA 3VPFA 4XQEA 3Q0EA 1GUFA 5I7SA 1I3MA 1MG0A 5A9SB 5IFLA 4OKIA 2ZJ1A 5LC1A 1ZK1A 1RM4A 3EC7A 4CLDA 3ENNA 2QRKA 3INRA 4UVHA 4MIEA 4E33A 1V6AA 3ZZNA 2J8ZA 1R4MA 3WYCA 3RBXA 5FWNA 3NT4A 5KOIA 1ULUA 4PLPA 2X4GA 4Q3EA 4CJXA 4Z3KA 1IY8A 1IZ0A 3VZQA 2BD0A 2GN8A 3ON5A 1JU9A 4EEXA 3OQ6A 2HMVA 5L53A 3LVFO 2DKNA 1C14A 1I36A 3JQBA 5KCZA 3UCXA 1UZNA 2X7HA 4PG6A 4ZQGA 3GF4A 4DLLA 2JCXA 1HE4A 4AJKA 3PJEA 4RPHA 2BGMA 1WZEA 3IP3A 3QY9A 3LSYA 4RPGA 2GASA 4Y98A 1HRDA 3JQ7A 1CERA 4BGEA 3DAGA 1G0NA 1A71A 4BNTA 1HT0A 3NTRA 2W2LA 2NTJA 1T2AA 1U9JA 1E92A 4EJ6A 5I9NA 4DWVA 4KMSA 4YCAA 4ZQHA 1SAYA 1QV7A 3E18A 1U3WA 3FBTA 4S3MA 2P9EA 3TFOA 2I76A 2EEZA 3QVSA 4W9NC 3VDRA 4BNZA 1GQYA 3NGLA 1R66A 2HMTA 1AGNA 4I5GA 2JFGA 3H7AA 1BRMA 4RV9A 4CL3A 1GDHA 4MVJI 1NPYA 3D1LA 4JXKA 5CP8A 1YL5A 3U62A 1F12A 4WASA 2NQ8A 4I9HA 1OFGA 5L45A 2ZCUA 4GX0A 2PZKA 4L74A 4CQMD 4M89A 4DC1A 3DO5A 2GF2A 3GVHA 3JQCA 4HFNA 2J3HA 2DPHA 1DFHA 3H9EO 3HE3A 3IP1A 3VVBA 3OJ0A 1UUFA 1XA0A 2WD8A 5G0WA 4AJPA 2EP5A 1SEPA 1LRKA 4RO0A 3GHHA 1FJHA 2BRUA 4ID9A 5KJFA 3PYLA 1KVRA 3KTDA 1LSSA 2RH8A 3PJGA 1SBYA 1UXKA 4JLWA 3WR5A 3UN1A 4EITA 3DHEA 3GZ4A 1BMDA 4FS3A 1F8FA 3WNVA 3WMXA 3ROMA 3WOHA 4JQCA 2Y93A 3VPSA 1EVZA 4BOYA 5GZ3A 1VJ1A 2FR8A 1A9YA 1ZMOA 4I08A 1MP0A 3FNGA 2NUAA 4TRJA 1R6DA 3N58A 2GN4A 2X23A 1NASA 4OL9A 2GZ3A 2JHGA 3HDHA 3F1LA 3EDMA 2B37A 4CM7A 3WQQA 4L75A 1DC4A 3DZFA 2ZB7A 4HP8A 3RROA 3QVXA 5KTKA 2H5LA 1DIRA 4DIOA 4FJ1A 4ILKA 4KWIA 3F1KA 1U4SA 4NDNE 3OICA 1RPNA 4IGFA 2VUSA 5CG2A 2LDXA 2X58A 3GNSA 5JO9A 3L9XA 2HMWA 1P77A 2EGHA 3M2TA 5KVQA 3QWBA 4R51A 1Z75A 2D0IA 4PVCA 4YPOA 4XYLA 4PLYA 1DDOA 3D64A 2RIRA 1Q7BA 3SJ7A 3GZNB 1E1LA 1HSOA 4LCEA 1DC3A 2VCYA 3L4SO 3CIFA 1U8FO 1V8BA 3SBOA 4CLRB 4WOKA 2IXAA 5EQFA 5A03A 2DPGA 4YYZA 4O63O 1GCUA 2OUIA 3GA0A 4XCVA 1UDBA 3RUIA 3LU1A 5COAA 5AXBA 2IZ0A 3BHJA 3T4XA 3VTZA 4W6ZA 5CDGA 1A27A 3RASA 1B15A 4EUHA 2Y67A 3I9NA 4J1TA 5DCWA 1HDRA 2GNAA 1XELA 4MDHA 1OOEA 1E5QA 1WZIA 1L1FA 4BVAA 4MIYA 1ZBQA 4GX1A 4BGIA 2V6BA 4BMSA 2FPIA 3AUSA 1PL6A 2ZQZA 3CINA 3WIDA 2VN8A 3WFJA 3L07A 3HFGA 1XG5A 4E2ZA 4MVJE 3FF4A 4BO6A 1RWBA 2E4AA 5KJCA 2HQ1A 1K0UA 4WGGA 4RZHA 2YFHA 2Y99A 1XQ1A 3F4LA 5TNXA 3WGGA 3N7UA 4D3DA 3RI3A 3GNTA 3CXRA 3UVEA 3DMTA 1K6JA 3LK7A 3BAZA 2WDZA 1EE2A 5IXSA 2BMAA 1K6IA 2VHWA 2PZJA 2VOJA 2J5RA 2VHYA 3AFNA 3KUXA 1YE3A 4EGFA 2Q3EA 1BTOA 1SOWA 3GN1A 3I1JA 4ZICA 3VTFA 3VH4A 2W90A 4WOJA 1ZSVA 1IPFA 3QQPA 2EERA 3UICA 4A27A 1X15A 3ZWWA 4PG7A 3DDNA 5ES3A 2C0CA 2Q1UA 2FMUA 2XXJA 3QA9A 3R6DA 4P4GA 4WCFB 2GZ1A 2BFPA 3QSGA 2HU2A 4N5MA 2AA3A 4INAA 1IL0A 1HYHA 2WYVA 1CETA 1EVYA 3LZ6A 3OEWA 3H8VA 4M49A 4J6FA 4D3SA 1IYZA 1YQGA 4ZU3A 1YONA 5T67A 4D44A 1C1DB 1YRLA 5DOZA 2RCYA 1WNTA 3GH3A 4JNKA 1E6EA 2J6IA 3VAZA 5IDXA 2R00A 1IB6A 5HBRA 5JDIC 5J23A 3LLVA 2C29D 2E37A 2QX7A 3RC2A 4URFA 1HL3A 2EKPA 2J5KA 4HXYA 4BMNA 2WD7A 1QYWA 4RVGA 1EVIA 3GLQA 2NWQA 4J90A 5JLAA 1J4AA 2FPGA 2IZ1A 1N9GA 3HJAA 4PIVA 4HNHA 1FXSA 3I6QA 1Y9EA 4IQ8A 3I4FA 4A10A 5DULA 2GLXA 3P7MA 1ADFA 3VZSA 1IHXA 3W1VA 1U8XX 1ADGA 4GL4A 3H5NA 4GKVA 2O3JA 1Y1PA 3EVNA 4RORA 3GPIA 1T1SA 5B4TA 4BS9A 1RYDA 4J49A 3GDFA 4EYEA 2ZB4A 2HO5A 4ZD6A 2ZJ0A 2BGLA 5DBFA 1M66A 3JQGB 1NQAO 1P31A 2C54A 5A9SA 4E2WA 4AJOA 2Q46A 4EBFA 3OA0A 3JD2A 4EUFA 3GT0A 3NGXA 4HADA 1FDUA 4BGVA 5CPFA 1DHTA 4B7UA 4DC0A 1DHRA 4OXYA 1B3BA 1H6BA 1K89A 1WWKA 5G0TA 4BNLA 4WLUA 1GU7A 1I2BA 3HN7A 4NFSA 1B2LA 2NVWA 4AJNA 4Q3BA 1LJ8A 3U4IA 4WEQA 4LSMA 3AI1A 2OOSA 4UAGA 4E21A 4QECA 3TOZA 2EF1A 3DB2A 4MVJP 4NJMB 1AUPA 1CIVA 4J91A 1QYXA 5DOVA 3ROKA 3IQDB 2JAHA 2PY6A 3GUYA 1MV8A 2RHRA 2O3UA 1LLDA 2O4UX 4XR4A 4IDEA 3PWZA 1GR0A 4HFJA 5DF1A 2CSUA 4Z9FA 2NACA 1EK5A 1SPXA 4TROA 3ZHYA 4XQGA 4OOEA 4E2XA 2VZ9A 1X1EA 2PD6A 4P4LA 4UUMA 2ZB3A 5L4SA 1JWBB 2EG9A 3ETGA 3L4BC 4LVUA 3AFMA 1ZJYA 1AE1A 4KOAA 1VJTA 3GVXA 5JO0A 5CDUA 3KXDA 4R4JA 1U5CA 2CDBA 1U2DA 1MX3A 5ITWA 4DTIA 2Q2WA 3FNHA 2P4QA 3K73O 2PH3A 2QW8A 1ZJZA 1I10A 3UF0A 1MXFA 3D4PA 2X1HA 4XYEA 2DTEA 3HDJA 4O5OA 5JDCA 1I3KA 3IIEA 4WCFA 3WB9A 5IXYA 3V1YA 4NMHA 1EUDA 1HDXA 1UXJA 2CDCA 3PJDA 2JFFA 4MOWA 1LSOA 1G1AA 1LQUA 4BNJA 1NPDA 2GGSA 1TT5A 2QRJA 2O3RA 3B1FA 1HF3A 3DBRA 4CV0A 1T2DA 9LDTA 4MP3A 2Q1TA 3FWZA 2NQTA 1Q1NA 2B5WA 2DTXA 3E9MA 1QV6A 4ZGWA 2I6TA 4WNIA 1FK8A 1E3SA 1QG6A 1U4OA 2FHSA 4U6QA 5JCXA 3BYZA 1NVTA 4QTZA 4WE3A 4ALKA 5GZ1A 5BT9A 2O2YA 1Z74A 3W8FA 3KSUA 4RZIA 1XCBA 3F9IA 3EZLA 2TMGA 4YAIA 3E9NA 4RF2A 1U3UA 4OO3A 4CR6A 3D3WB 2OXIA 4NR0A 1L7DA 3WNQA 4OHUA 3AK4A 3WWYA 3Q2KA 4LN1A 4OM8A 3Q3CA 1CQJA 1ZKMA 1V3UA 1Q2XA 3GZNA 1U2GA 4N5NA 1OAAA 4YA6A 2D4AA 2DAPA 3DBVO 4UVIA 4E30A 1DRVA 5C5IA 4GGOA 2DUUA 4CR8A 4FFPA 4CMGA 3AI3A 4XQ9A 4AVYA 1EQ2A 3LF2A 4EEZA 3ONEA 3RU9A 2Z1MA 4ZQBA 3GN2A 4CUJA 2PKQP 5THQA 5HWSA 2VYVD 1A9ZA 4Q3NA 4G5HA 3EK2A 1D7OA 4J1NA 2BI7A 4LRSB 1HDGO 4OXNA 1HYEA 2P2SA 1H2HA 2BFAA 2UUPA 1EQUA 3JQFA 4YJGB 2PD3A 4B8WA 4ALMA 4A26A 4ZJUA 3IUSA 2NM0A 2UUOA 3FR8A 2V6GA 1LLUA 2GUGA 3IOYA 3D5TA 3G79A 4IQ0A 3LYLA 3P2OA 1V9LA 3WGQA 2C2YA 3WSWA 4LK3A 3W6ZA 4MVJM 1WAMA 3CMCO 2GYYA 2VUTA 4XGNA 4CM8B 4EDFA 1PJBA 2YV2A 4RL6A 2Q1SA 4JBGA 3T7EA 4RVUA 3WGHA 3JYNA 4U8GA 2X0RA 3LC2O 2DM6A 1XIVA 3ITKA 4BNGA 4IDBA 4OXKA 4YAJA 3GDGA 3OFSA 4WKGA 3A9WA 2D59A 3PEFA 3TJRA 5L4NA 4RLSA 2AG8A 2Q49A 3GOHA 1CQIA 1H6CA 1YJ8A 3K9QO 4DPMA 2D8AA 3OECA 1M76A 2O3QA 3O8QB 2JD2A 4J9VA 4LVCA 4FDAA 4TVBA 4PG4A 4FGSA 4CM1A 4DREA 3L0DA 4J1SA 4GWGA 2FOIA 3ZU3A 3RCBA 3PPIA 5TJ9A 5U1PA 1U7HA 1PGPA 3GFGA 2WE8A 3GVPA 2O50A 3SXPA 3GEGA 2H63A 1LX6A 3AM3A 5FEUA 4BL5A 1SMKA 1Q7CA 4BQRA 3G0OA 3EGOA 2PR2A 1WPQA 2YUTA 1N2SA 1LDBA 4BO3A 1ZNQO 2GCGA 2DBQA 2WD7B 4CLOB 5LCXA 1P44A 3HB5X 3WGYA 5ICSA 3JQ9A 3K8ZA 2GZ2A 1MG5A 5JNLA 1N7HA 5AXDA 3U0BA 3DFUA 4WLNA 4DGSA 1JA9A 1YWGO 1UP7A 4YJDA 1YB1A 4LISA 5KVSA 4QX6A 3DHNA 3C7CB 5FF9A 5TT0A 1NFFA 4XB1A 1Y5RA 1ZIDA 1E1NA 3GMDA 2X9NA 4KUEA 4IIVA 3ADOA 3NDIA 1O0SA 1T4BA 1H6AA 2IEBA 3L6DA 1MC4A 4QFDA 2CNBA 2VQ3A 5T5QA 4A5OA 3MTJA 3QVOA 3GG9A 3FPCA 3KSZO 3DEYX 4PLZA 5DT9A 5L3ZA 4FC6A 1C0LA 7MDHA 1ISGA 4CM8A 2YY7A 4BO1A 2O4CA 5IZCA 3L6OO 3JSAA 4B3JA 1NAHA 1G0OA 4J4HA 3GGGA 4PRLA 1JW9B 4CQMA 1E7RA 2DT5A 1YB5A 1BGVA 1XYGA 1A4UA 2FN7A 1A5ZA 1BXZA 2O2SA 4HFMA 4AL4A 5BSFA 1QXSA 1Q0QA 3A14A 2IDZA 3GAZA 3I6IA 2E6UX 2HJRA 3DWFA 1FDVA 4YJGA 2I5PO 4EUEA 5CDYA 3DC2A 1BXGA 1WW8A 1PGNA 3S8MA
chains in the Genus database with same CATH superfamily
1CEQA 2V7PA 3QXSA 4OQLA 4B2LA 5JVDA 5F7OA 1PQWA 1UBLS 5JPIA 3B9PA 3PXUA 1QBKC 3DZHA 3DV2A 4EPXA 3IL2A 3RYIA 4CMJA 1JA1A 3HJUA 1YKGA 2EX0A 3PWTA 1D4ZA 1GUYA 1QGUA 2WMDA 4EJFA 4RZ2A 5FWYB 2XZTA 1W1IA 5J2TA 5SY9A 4OQYA 3QXJA 1LS1A 3L5KA 3ZH9B 4U3JA 1S4MA 5ADHA 2OZVA 2NXJA 1BKDR 1E6KA 1R0WA 3EYWA 5J2TB 3RRZA 1NRXA 4Q3AA 1E1KA 1HTBA 5IMBA 1KY5A 1JJFA 3OURA 5HKKD 2A0WA 2GHIA 2JBAA 2Q07A 2PZFA 3EVEA 4H6PA 3ZV5A 3QOYA 5LOVF 2DPXA 2FSFA 2UAGA 3GY0A 5J59A 3U7EB 1SWVA 4JLUA 3WHKA 1Q3HA 1C7EA 4B2PA 4H27A 4JGBA 4ARIA 1PAUA 3EGXB 2Q22A 4ZDIA 3ML1A 2AOTB 2CMDA 4X95A 2IXFA 1DTWB 3QEOA 4OK6A 3USZA 2ZJ2A 2GCOB 1IXSB 1E5DA 3QK7A 2A5YB 3S5JA 1UDRA 3NC4A 2FG5A 2HF9A 2BUBA 1T8YA 1P19A 2FP4A 1OA1A 2CDAA 3IAFA 4JBYA 4LVOA 1NBWB 4XKJA 1TTHA 3KSAC 3D4BA 4RK6A 4Q3OA 2QZZA 5KJEA 3TRIA 1U2PA 2GTIA 4BWVA 2CJWB 4D3FA 5LQJA 3FETA 2W2OA 2WPDA 1IXYA 1CDDA 3T3PB 5B64A 4IKPA 5JS7A 1RZRA 4QUDA 1KYXA 3G02A 4HGOA 1KEWA 3U40A 1A5SB 4BB6A 3DAPA 3AOEA 3GGOA 4XQCA 3WIEA 4K7JA 1ZH4A 4AJ4A 3TECE 4H17A 4QDKA 3QE3A 4AF7A 1FFSA 1WW2A 1IM5A 3IBSA 2ZLBA 1CW2B 4M1TA 4MK4A 4XCQA 3T9EA 4RS3A 3ZHXA 4UJ3A 3RS4A 2YDXA 2ZJBA 4FX5A 1LLFA 5LA6B 1KZYC 2C4NA 1D5CA 3PE3A 2HPZA 4LZAA 3MVEA 1PD0A 3W7AA 2VDMB 3BL8A 3MMSA 1NVBA 1WCIA 1ZUIA 1PTKA 2Q8QA 4UUBA 1CB0A 1P3Y1 2VG8A 4OM7A 1EUZA 2FSSA 3LQ1A 5LQAA 1KXZA 3Q10A 4GC5A 3NTLA 3AGQA 4N5DA 4PQEA 5FL7D 5G4LA 4UMFA 1KEEB 2PPVA 2AG6A 3EB9A 4GF5A 5AJZA 5JE8A 3HFSA 4YAEA 3UHJA 3WXBA 3ZOKA 4WX2B 4ENVA 2XE7A 3QU2A 2O2ZA 1O94A 4CRWB 3A06A 1ISIA 2Y1EA 3PZRA 5FQOA 1CJMA 5I9MA 5BYBA 2OZLB 3U4HA 2XBUA 1NVAA 4CKEA 1SUBA 1H4QA 5TQ2A 3D4LA 5JCZA 1DBSA 4JJFA 2GN2A 5JQGF 4D9IA 3IAEA 4Q4AA 1IMJA 3WADA 5DV9A 5EZYB 2IYPA 1XTBA 4UQPA 5F4ZA 3ABIA 2O2DA 2W6JD 3KR2A 7YASA 1L4EA 2IPLA 2X2OA 5AW8A 1AKEA 1F2TB 4B7CA 1YNSA 1OTHA 3OETA 5J4KA 4FILA 4OJKA 3KB1A 5BW5A 4U0KA 3EP6B 4AN4A 4DWOA 4BEWA 3I23A 2WYUA 4HEA6 3UAGA 3NH9A 3DBIA 4REQB 4X5OA 3TUZC 4B83A 1TKCA 1Y7PA 1M3SA 2NO1A 3R3HA 4NJMA 4D8UA 5A4FS 1DJNA 3OJCA 1FP4B 3TXXA 3EZ9A 3K8OE 2BKUA 5I45A 1ZCJA 3A4VA 5AHRA 4MW2A 3AC0A 1ESZA 1NBMD 2HEIA 3C8UA 5AW3A 2IEDA 2I6GA 2WTNA 1EUCA 1OYYA 2B82A 2OHHA 3KWMA 4M86A 3IE1A 1Q50A 3KTOA 4NKRA 3KR9A 3LBNA 1OZAA 4PPNA 1BWSA 4ME6A 2CB0A 1H94A 2KX7A 6Q21A 4A8HA 4RFSA 1R9JA 3SM9A 3TGPA 3R0QA 1NBHA 3OLXA 1OFIA 2XE8A 4RZ3A 5AK0A 1VZ2A 1VBNA 4O4IA 2GPWA 3I1FA 1TKBA 4D3XA 4DE5A 4HEHA 4GLOA 2ZJ6A 2I8LA 2R6CA 1PEKE 1C9YA 3EY9A 3JVIA 2HNKA 2RH5A 4PLWA 1CSEE 1EZZA 4J2OA 5LMCA 4JJ4A 4CTMA 3G6KA 5CYGA 3QHAA 4JJGA 4KK4A 5DZSA 1TEVA 4HWKA 3K1AB 1J0AA 4NATA 4R0NA 2P78A 1NXSA 2BDTA 2Z56A 3AWDA 3MIIA 3QVUA 1QH1A 3RAPR 1JMVA 3UIEA 2GPNA 3VSCA 2DQ4A 2ECQA 2MINB 4QLBA 4ZARA 2H1VA 2ZRLA 1EGQA 1IOZA 1PT8A 2WF5A 3WA7A 4F6RA 4KDEA 4AJLA 1DDIA 4YAUA 1VKHA 4F6LA 3T6KA 3I0NA 4R3NA 4LZPA 4YB8A 4E12A 5IJ0B 1V47A 3HYSA 3JQAD 2P8SA 2Q5JA 3ITNA 4CV3A 3K3PA 4MKGA 5AM3A 5JMOA 4DWJA 3N9IA 2QM7A 2LW7A 3PDHA 3BVPA 1R18A 4ZVTA 1I2MA 1R88A 1MHMB 1II9A 2HOQA 2JLBA 4QBTA 2D06A 3IKMB 3O74A 3W8DA 3IWCB 1MLDA 4LYFA 1S2LA 5FI3A 1QJ4A 4KLAA 4ALNA 5BQFA 4WLFA 3TM4A 4QGGA 3AIKA 3TVDA 3AF5A 1Z2DA 2R7LA 1GUDA 1PNQA 4C4XA 1HUQA 1ZK2A 4KWHA 4F3CA 1J2EA 1ZUHA 4DHWA 1F4PA 4HLUA 3HKDA 3DEIA 1TFRA 2Z58A 4TKZA 5CAEA 4RPCA 5J5AA 5JXWA 3F8SA 3O4JA 1XNGA 4GOMD 3SWWA 1RAFA 1AZLA 3LP8A 2C7OA 1Z6QA 3F7NA 3P9NA 3EP5B 1DG3A 4NULA 3NRJA 2WILA 3VZPA 4US2R 3KJZA 1SVWA 4DSZA 3Q1LA 1XTVA 4ZAYA 5AW7A 4IRXA 1HKHA 2EHJA 3LDUA 1HXHA 5B1HA 3LQYA 1P60A 1S89A 4G37A 2ZYGA 4ZYTA 4MAFA 3T5MA 5IN4A 4NS4A 4P33A 4GMGA 3RBZA 4EYKA 1SCAA 4M0EA 1J7KA 1V7PC 3DLCA 2G5CA 4M1SA 5J43A 3LY7A 1K7CA 2B4KA 3D7KA 4TLBA 5A5DA 4TLCA 1D09A 2QMEA 3B7GA 1E5TA 4NYIQ 3WJAA 4YEDA 5KI6A 1G8GA 1BWPA 2YFYA 3A05A 3A9UA 1KC1A 2FZLA 2X0NA 3P32A 3FFXA 4FKZA 4X92A 5EMHA 5JSZA 3FWYA 4R8KA 2P5UA 1RFGE 2OCYC 2WYOA 3F5SA 1X0VA 3HNRA 2Y1OA 4BFZA 4KR0A 2P9FA 1E2GA 2J07A 6PFKA 4XW2A 1H05A 4RMJA 4TMKA 1A9TA 3MTGA 4TSKA 3ZJYA 4DJFC 4IJ6A 3HRKA 3VZRA 1KMHA 5EP4A 2GPTA 3M6MD 4ZO7A 4LYEA 3U7GA 3BDAA 3OJXA 4GI3A 1D6MA 3E2IA 2RC6A 2O57A 1ORVA 1ADCA 4NBWA 5D5HA 2G0AA 5AKJA 4U9IS 3W1WA 3UH0A 5TMDA 3Q2IA 4LJSA 4OPMA 2EBHX 3O8NA 4FYWA 5E4TA 3WDLA 5CFPA 1DWUA 1FU7A 2FR8C 4IJWA 4HX5A 4MP8A 1F9AA 2ZIZA 4DJDC 3DZ3B 1DLJA 4F8JA 2J5QA 4R68A 3EXFB 1G38A 3BC1A 2XQFA 4AJ2A 2A0YA 1H8ED 2WAOA 4DV6B 3RJ9A 4R2LA 5TLSA 4QBHA 3ZLBA 1IBCA 4GVPA 5LDHA 5T8KA 3NBXX 3HZZA 2KPOA 1U0SY 4PE5B 2K2WA 3N8HA 2XMRA 1TZJA 1DUSA 3QP9A 4EPYA 3OIGA 2Y4OA 6ADHA 1KTVA 3ONVA 1B00A 4BX3A 5C1BA 2WDPA 1TAUA 1K06A 2G70A 4BMXA 5BP7A 5ECDA 3ICEA 4QXAA 3JVEA 3CLUD 2JGAA 3OJOA 4LPKA 1T1IA 2QPAA 1RZVA 1PIWA 2JLRA 1H2BA 2H4HA 1R6TA 4L02A 2MTBA 4RVDA 2IV2X 3H2JA 4U7DA 4EHKA 3KVOA 2JA1A 5D1HA 4O3FA 1AMOA 4MI3A 3LS2A 4C21A 2EW8A 3AHDA 3QF4B 1W2WB 3ZW9A 1C1XA 3EW9A 3G5LA 1IDOA 1TC1A 2IKSA 4BWYA 2YKGA 1LW6E 3H97A 3NM4A 2WW8A 4FR0A 3LDGA 2ACVA 2C82A 3ZDFA 3ORYA 2XECA 4K9QA 4AT1A 1UEIA 2Z4SA 3E9DA 4IHJA 4Q3KA 4HWTA 3S2ZA 3PF8A 1PR9A 4P93A 4XVRA 5F73A 3BXXA 4JQOA 5MN6A 1EINA 4IJMA 3PLRA 4CEIA 4XSVA 5GZ6A 3ZY3A 5BN1A 3AOGA 1KMHB 4NDZA 3MA0A 1Y37A 3VDNB 4EFMA 4U7GA 3U3OA 4LY3A 1DIGA 3T7KA 3V3TA 4E03A 3S44A 5IJ9B 2JGLA 1NYTA 2IZ7A 1BVRA 4G0XA 2VTVA 4S24A 1L7BA 5DIFA 1OTXA 1R2QA 1T26A 2DETA 1ZUD1 1RWVA 1KU0A 3FXAA 1T5TA 1OX4A 2R1UA 2O8DA 2NXCA 3KQWA 4U7JA 4BB0A 4F86A 3PXCX 5A2GA 3TSZA 5C4IA 2W2QA 2Y3IA 1KOGA 1PJSA 2ZYWX 3DXZA 4JBXA 3MHPA 2GK6A 5JYBA 2PZMA 1JHPA 3SZRA 1WNFA 2C9DA 3EC2A 4JOBA 2HDHA 2JHPA 2IODA 2JW5A 1K9VF 3ETLA 4RUKA 3UJ9A 3VH3A 3RSCA 5JS8A 3URMA 3LRXA 4HYYA 4YASA 1XJWA 2PNFA 3RTGA 4V24A 3VA7A 2HNBA 1A96A 1SY7A 1CRWG 2QZPA 4QYWA 1HORA 4J3JA 3BEDA 3FLAA 1BD3A 1XDDA 4I5IA 3B89A 2OESA 2PUFA 5LP1A 1PEDA 2W6OA 4C4RA 2UYOA 3BE5A 5LYJF 4IEFB 4M8SA 5B2ZA 3H0KA 5IWAB 1A4IA 4PX3A 1G5RA 1U8ZA 3EYAA 3ZV7A 4UZEA 2ZWVA 3GP3A 2EW2A 5DM4A 1Y6JA 2H52A 3FOZA 4RVNA 1M67A 3PHBE 2DFTA 1VG9B 3GELA 4NPCA 3BWVA 3KE8A 3WS7A 3CN7A 4QRIA 1F4VA 2X8AA 2YIDA 2MSDB 1N7GA 4S1VA 2FEMA 3H5WA 4M6WA 5FADA 3V1UA 4CIAA 3CEMA 2QPLA 2DR2A 3EBLA 1G8HA 1O54A 3HY6A 3Q7TA 1DT5A 4B3IA 3TPCA 2O8FB 2WUGA 3CFYA 1F7UA 1NE2A 2XIJA 3HU2A 4Z4EA 3H3XA 1RWPA 4CM9A 5EEHA 3A6GA 2R00C 1UEXC 4NHOA 4A2PA 2ZRQA 4M0LA 2J7PA 1BJKA 2R6R1 3K1JA 1P5JA 1MU0A 4M87A 4E2FA 3L8CA 3CU5A 2YWHA 3ILYA 2Z8YA 4QPCA 5I3ZA 1RT9A 4PGAA 4V0NA 4I6GA 3A1DA 4OMFG 4EB3A 5BRNA 4N39A 3LECA 4BUCA 3IQGX 2I66A 4QJBA 3VU9A 1XAGA 1GTL1 5TEWA 3A32A 1BMFD 3NHWA 4WUTA 3KZXA 4HYEA 4MLCA 4GPTA 4XYBA 1RXCA 4URWR 1RLOA 2PYDA 5JY6A 3TGLA 3QV1A 2R751 2ZCVA 1NGSA 3W7BA 3B60A 1N0UA 1XEAA 3ABSB 3PNVA 2QMOA 3D6TB 2WABA 3EFOB 4DIKA 4IMJB 1PK7A 5I7FA 4LGYA 1L8LA 4Z9YA 4L1KA 4OJNA 1YZ3A 4J9UE 2RHTA 3AILA 5G0SA 4ROSA 4HTFA 1FDIA 1TJ5A 1THMA 4YP0A 4HEQA 4AWBA 4UJ5A 3LQ2A 1O77A 3BHMA 4GO1A 3QENA 4MWZA 3IEMA 1XCMA 3MRVA 3ISVA 2P9ZA 1G5HA 2ZEJA 4O4JA 4HVTA 1LK0A 4DV3B 5ESWA 1RBZA 4IAOA 1DJLA 1FBNA 3HKCA 2EKDA 4LYHA 5K3FA 4E5KA 3EARA 3H4IA 2REBA 2OY0A 3D3NA 1R0SA 1T5IA 4XYMA 5CTAA 4E32A 3H5LA 5JT1A 4PRYA 5LXTB 1W29A 4KO1S 1NONA 3LT0A 4IF6A 5TY0A 5EMJA 3SN6A 4BFVA 3Q98A 3IOCA 3SQNA 5EIAA 3R1IA 1O87A 1SG6A 1SC4A 2UDPA 2XWBF 1X80B 4YAGA 1AHIA 3ZGZA 1CE8A 1SNYA 1ORHA 2YS6A 4LMAA 1BX0A 4XXHA 2DSTA 4OBWA 1SXJE 1FVXA 2I1LA 3QOXA 4HMPA 4HRAA 4D9FA 2BJWA 5CM9C 1DCKA 3DOOA 1M2FA 4TV8F 2DUMA 2QTBA 4OJMX 2WF6A 1KNXA 2LNDA 4DAEA 1VI2A 4CKZA 2NT3A 1SXJC 2FPGB 2TYSB 3KQTA 1QRDA 4WLOA 5T4HA 4ENQA 4Q4DA 3MJSA 4OH1A 5EJ5A 1LCIA 2WWFA 2W11A 3F98A 1ULZA 4YACA 4DV0B 3PKJA 4Q4HB 2ZRHA 3B8EA 3DP9A 4UULA 3WVNA 1P9LA 3WTBA 2BGWA 4RLHA 2B98A 5IMSA 1CTQA 1FLVA 4P1ZA 1G8AA 3E27A 1QH8A 3HRIA 3NEJA 1KY3A 2W37A 3GFBA 1LUAA 1Y6GA 1ZW1A 3ZHTA 3KYIB 3K0FA 2Q1WA 4L8LA 5F5LA 3CO5A 1L7OA 2C00A 4I50F 2ET6A 3R4VA 4AZ3A 4AQYB 3VJKA 3P5BA 3UGTA 2CLCX 2CY0A 1UWVA 3CRVA 1PWYE 3R74A 3FCUB 3ZQUA 3RW9A 1T9HA 4A8PA 2EIXA 3CVOA 1F8YA 2KLHA 2IZ5A 2VH2A 5EKXA 5KTOA 1GTZA 2KWIA 3AHCA 1XO1A 4L73A 4M0MA 4XFJA 3SF8A 3UH1A 4E1VA 3IB3A 3HHPA 2C58A 1X1AA 2RBKA 1RZUA 3CPSA 3H5OA 4K9MA 5TJHA 5I4BA 4LAFA 4ITVA 4DLAA 5DTEA 1P9WA 1NN0A 2F9MA 5HIKA 3BTSA 1WDMA 2CXUA 2GB4A 3GQVA 2IEGA 3HR4A 3QU9A 4IZOA 4RMGA 3TTVA 2YXEA 2XMDA 3PHJA 4Q1EA 3L0CA 4PLTA 4TRRA 1ZBDA 1XZEA 4Z6KA 4K88A 3P0JA 2GA8A 4UFNA 2CBZA 2RONA 3G7SA 3QHQA 5JYEA 1RD4A 2RGBA 2DBZA 2VFAA 4QPNA 3W9SA 4O4IF 2CNOA 4POAA 2YXBA 3ZZ0A 5BSWA 2FP3A 1O89A 3C3WA 1GPLA 1TDJA 2DYKA 5DTRA 2ZWMA 1KFBB 2V3VA 3FTEA 3I2HA 2AMFA 2FSVA 4GG1A 4OSOA 1Q77A 1SXIA 1MV5A 1XRNA 4MPRA 3TX2A 1K2VN 4X1OA 3WYDA 1NR1A 4CQJA 2UUBB 2P77A 1G291 3R2JA 3AYXB 4MR9A 1UEJA 1C4XA 5LQDA 3UB3A 2PUJA 1Y8CA 3HZRA 4YHBA 1LD3A 5BN3A 4Q6WA 2RJ3A 3HEMA 1G42A 3MWGA 1N78A 1WXHA 1PW5A 5KPDA 4R71A 1X39A 3EDQA 5FUMA 2AJ8A 2XDQA 5KDOA 3BL6A 3GCZA 1W5AA 3JWEA 1HZZA 1IVYA 1FFWA 4MITA 5HM8A 1XSEA 2D5CA 1CIJA 3L0YA 1DJPA 3LUCA 4IDFA 4MW7A 4BP3A 3THYA 3SM3A 1KBZA 1RACA 2XY4A 2VVTA 3PSAA 4X8LA 3CEAA 3LT1A 5DTMA 4DQVA 5IUJC 4YJ2A 4D4LA 2ZYTX 1QGUB 1WO8A 4HEA1 3TRDA 3ZCPA 3K31A 2XB2A 1AO0A 3DBHA 5BWNA 2ZU6A 4Z7JA 1K5PA 4M1EA 3AB8A 3IP8A 3PC7A 3ZKWA 3NANA 2BHLA 4FIZA 2OWDA 3ZIAD 1F17A 3U7RA 2VEDA 1IVNA 1O5IA 2HJWA 1PU2A 5DNWA 2P5TB 4JLBA 2V59A 4BU1A 1WIWA 2EAUA 1NLFA 5IPFA 3UXMA 4CQLB 3EPKA 4BP8A 3ETHA 1U3VA 3CNQS 1R4NB 3B5JA 1G7TA 1CF4A 4AYTA 2QKYA 2PJUA 4N7RA 5H9WA 1WY7A 1CYEA 1Z7WA 4QBIA 1FX0A 5AHWA 3JCZA 3DT9A 5K0ZA 3J81k 1F7VA 3DVAB 1V7QA 4K26A 4M3NA 4QNRA 4LVNA 5JH7B 1OLSA 3DVQX 2JCSA 2OV3A 1MDBA 3DZJA 3K16A 2O1WA 5MFPA 1P6QA 4JC4A 3UGJA 2NVBA 4O2RA 1ONOA 1FDSA 2BCEA 3UANA 4ANFA 1KYVA 2WSLA 2YIMA 2GXUA 1AUXA 1NDQA 3EFOA 3FYCA 4KQ6A 4G01B 4RAOA 3UGQA 3VNAA 3CZMA 4CXMA 5I3CA 1QFSA 2X86A 1SURA 1QIIA 3KHTA 5ALWA 1YTLA 1ZSNA 4KUHA 5IWCA 4LDZA 4MQUA 2AZDA 4D9KA 1PQYA 1MF7A 1AM4D 2HDWA 2Y0CA 3K0BA 3IP9A 3KJIA 2PX0A 1PWEA 3V4SA 1H5NA 2EF0A 2C04A 3GH1A 1QVWA 1L5MA 3SR0A 3U5ZB 4XR9A 1TGVA 4OJQA 3UJ8A 1YJXA 1XPUA 1R4MB 3SZOA 1Y89A 3QUCA 5M34A 1B0ZA 4J43A 4L27A 3KLPX 1PR6A 1CUXA 1MTZA 2E6KA 4KDRA 2G17A 4MKRA 5FRDA 5LD2B 3VPHA 2HHLA 2A1TR 4EH1A 1NW4A 3VYSB 2DC1A 4AROA 4G0ZA 4K2AA 4P86A 4O2AB 3THYB 1U1FA 3EAGA 4MR8A 1C1HA 3R6LA 1SCIA 5CDTA 1HFJA 1SA0A 1H5QA 1W87A 2ZWIA 1WM1A 1Z2PX 2ONZA 1IUKA 3IDAA 4H35A 3S2EA 5FNZA 1UWCA 1KIAA 3NHFA 3CEJA 4EOGA 1S1CA 2A30A 3Q15C 4MQ5A 1OBFO 2AMJA 2EQ5A 3CTMA 1J2YA 2NZXA 3RABA 3JARB 3NUQA 421PA 2CJPA 2J48A 3LLSA 5DNYB 1BYIA 3ID6C 1Y48E 1P6XA 2VYQA 4QFCA 3DE5X 3R6GA 4KXMA 4KJZA 4Q1CA 4OB8A 5EIHA 2QX8A 1W49A 1P0QA 3KEFA 3VKUA 1VFPA 2HY7A 1XD2A 2FXIA 2H4YA 3VU0A 3II6X 4PAGA 1P1IA 3H65A 3AI7A 3QTTA 2XR1A 4ARSA 4AS2A 3THXA 2BGTA 3K2QA 3DOEA 2YXPX 3E3MA 3GJ6A 3DBRB 3HO6A 3SQOA 5DM60 2NXNA 4ZYZA 5THKA 1L7NA 1U8AA 1JN0A 4M0DA 4NCIA 4KNYA 2BKXA 4AUEA 1YGYA 4GBGA 1UKVY 4DUZB 1WZ2A 1MPTA 3GPBA 1BD4A 5EJAA 4X9XA 3U1BA 4RTNA 3PJRA 2V6MA 3RVRA 1GZVA 2LUOA 3S6JA 1C8LA 2V58A 4WEOA 4BJ6A 1U7UA 5BN4B 1AN9A 2G9QA 1XNHA 4OIMA 1XC7A 4UREA 1PWXA 4LRWA 1DB3A 3K0HA 1XHEA 2HUNA 5EMKA 2Q0QA 2WA1A 3BCUA 2NG1A 4TTIA 3H9BA 2PYZA 5DYNA 1OX4B 2Z2XA 3TNJA 3U39A 3K15A 4WBNF 2BELA 3FVVA 5HKKA 4KBYA 5AVZA 2B1QA 3N2GB 4AX4A 2O06A 4RK5A 1DBRA 3K0FB 4UTXA 1SCQA 3VH1A 5CH5A 3ZU4A 1OWNA 4D8XA 2ZG6A 3HB1A 4BV2A 3HI4A 4QYIB 5H59A 4PG8A 4GUAA 4B4DA 4JJ6A 5ENZA 1KK1A 1XWFA 1S5PA 4QXRA 2BFCA 1BMQA 1T3SA 2H2HA 2JFZA 1AN0A 3P5SA 4J16A 4C7OA 2EJWA 3DZ2B 1A7AA 3OBIA 4UBMA 2ICAA 3G1UA 1KXJA 2RHCA 5D01A 5DSTA 4DLVA 4TKUA 3H17A 2Q5LA 1I2CA 1P62B 2PK3A 4Y1EA 2NU8A 3VJMA 2JG3A 3OUZA 4NU5A 5THXA 5IW8A 3UMSA 2XVZA 3VVCA 1LBSA 1DAEA 1GZUA 4MB2A 3WSVA 5FR2A 2XQKA 2F8SA 1CP3A 4DY6A 1B0PA 1M74A 1OXXK 1MOQA 4A5SA 4MZXA 3WLQA 3AHHA 3AR9A 4GFDA 1ODKA 1VE9A 2YV5A 3CUYA 2IUSA 4PZEA 4PRKA 3TW4A 1N2GA 3JZDA 5LQUA 1HGXA 3X43A 4U4AA 3HO8A 3IPCA 3SVLA 1EFPA 3G0BA 5C46F 4GSYA 4XUEA 3N0VA 4RULA 1JXAA 3TMKA 4Y2GA 2ALJA 2GEBA 4E13A 3DL4A 3RJTA 3OPMA 1FUKA 4RM3A 1B6GA 3S28A 4XJTA 4FFBB 2CBXA 2VK8A 3E2PA 1HX7A 5CM8B 4OGWA 3QU5A 5TPWA 4HNGA 1GOTA 3DA8A 4RXMA 4Q4LA 3FSRA 4RD4A 3NEYA 2BMJA 2QTWB 3ACCA 3UHAA 5GWXA 3ZCQA 5J3JA 1I5RA 2GZDA 3RRBA 1EBFA 1GG2A 3UMRA 5JI2E 3HI6A 3HYNA 1JBQA 2G1JA 1SVMA 3TUIC 1N5RA 2CD9A 4FD3A 3DUFA 2WWXA 5FA5A 4LF6B 3QWFA 1KJ8A 3BN3A 1I6MA 2C94A 4EG6A 4BTEA 3RIGA 5M6DA 1GPAA 2P75A 5B6JA 4IIJA 4ZQEA 4Q9NA 3GCWA 5EZSA 4LMRA 4H0CA 4U63A 3EVAA 1WMAA 4H0FA 4M8IA 1FQKA 3G2KA 2XT0A 3GFSA 3M5CA 1YOVB 4QO7A 2DLDA 3G8YA 5KVVA 3LLCA 5DH9A 2CHVA 2D5IA 1RTTA 2EDAA 3KQKA 5I7EA 2ZSKA 3QEMA 1UK9A 3I6ZA 5TQVA 5K9ZA 3GPDG 3RC9A 4MVJA 4KG7A 3X0DA 3ZQKA 2P9GA 1TQDA 4BKOA 4IXTA 2BIFA 4GRIA 1HWYA 2O8EA 1T3GA 3EH1A 4J4TA 4AO8A 1NF8A 1R0LA 3G2JA 5CK5A 4KWCA 3M70A 1KVQA 1VBKA 1C0KA 4TV9F 5DBIA 3WLJA 2ZR8A 4JYMA 2WU4A 3LPCA 5CB4F 3RYCB 1UWLA 2ORIA 4NZ9A 2HRDA 2KS6A 2TMDA 3U09A 4JLKA 5F7XA 1NI4B 2JFHA 1LRJA 3KWLA 4MWCA 3QBEA 2QB5A 4DM3A 3P2KA 2CGEA 2EKQA 4IR7A 4XGKA 1IOVA 1E20A 1F06A 4JJAA 3E58A 2WYIA 4IDDA 2IWHA 3AF2A 4MQ6A 2IFTA 3KKKA 5ERGB 3GNQA 2GF9A 1Z0IA 3IUBA 4FSDA 4H3SA 2O7RA 3DD1A 4WTOA 3FUUA 2HHJA 2C0QA 4XWAA 5BXQC 4IF4A 3VSBA 4ACAA 4JMLA 2FPWA 1YQTA 5LUAA 1XN1A 3V55A 3WWPA 3EGCA 3DPIA 2ZTUA 3K0KA 3DAHA 4QU8A 5ILQA 1YDWA 2VAMA 4NQZA 2OCBA 5ALKA 5L4LA 3AYZB 1K2WA 1E9SA 1U0JA 4GQIA 3BWMA 4MRAA 3UK0A 2YJ6A 4RJKA 2IITA 3HGQA 1S4QA 5REQA 1II0A 3MCAA 4DCJA 5JWRA 1YR1A 3M8KA 4CF5A 5IU6A 4G5SA 2QRPA 2LKDA 3RKUA 4ZI2A 4J7CA 4PYKA 4KQMA 1SXHA 1X70A 3KOXA 3P4UA 1Q12A 4IM7A 1RJGA 2DUJA 1KKMA 1IIRA 1LNZA 2PMCA 3Q40A 3COWA 4FFNA 4KXWA 4B75A 4CWAA 4JB2A 3G23A 3DQZA 1JVSA 3AUAA 4UEJA 3JYQA 4PCUA 1X74A 3AUFA 1FFHA 2YIJA 1DMRA 3NHAA 2YYSA 3NJ8A 5J2UF 3WYFA 1TUBA 4OXXA 2P91A 2XUZA 3ES9A 4JI5B 3R75A 3W3ZB 2HIAA 1JG7A 2HUPA 2SKEA 3MJ4A 2I03A 5HMLA 3T9DA 1OPXA 3UV7A 3RAEC 3O21A 3LRTA 1M2KA 2OO7A 1JKFA 3K9LA 5HCNA 1TEHA 2OP0A 5I8WA 3K94A 5FWYA 2IEIA 3R5KA 4NLLA 1UCFA 1IZ8A 1BYUA 1AB5A 2Q4BA 2DLNA 2HLPA 4RVFA 4TT3A 2C3MA 5GJWC 5TR9A 5ITVA 4K9LA 4WDQA 4F21A 2FW9A 4MIKA 3QU4A 2HI0A 2IPOA 3UT5A 4NG5A 3VR6A 2O23A 2AHRA 4RESA 1CY6A 1RSZA 2VYFA 4CMCA 1ZU5A 1PF7E 3EDCA 3L4KA 3BZBA 1CDOA 2ZS9A 2XB9A 3JQGA 1T9ZA 5DB4A 4PONA 1CEYA 4G81A 3EPRA 1RZ3A 1NVKA 3TX6A 1M33A 4O3MA 1IZ9A 3HSSA 3O3CA 5C4GB 2D2XA 2H7CA 5SYNA 3HKBB 1QHNA 3T7JA 3ZWBA 4MKXA 3NTXA 1LNQA 2H9YA 3SAJA 2XWQA 3GFVA 4KODA 1XZBA 2ZS7A 1JKJB 5BSGA 2HK9A 4X66B 2DFNA 2YJ3A 1HH4A 1GFIA 4OSPA 1XRPA 3KZCA 2VPTA 1VL1A 3EX7C 3NDJA 1R0KA 2RAFA 4BBJA 3E1KA 4URUR 3ITDA 1JF8A 3U1VA 5HFNA 2ATCA 2R8EA 3A70A 5MHTA 1KORA 3CY6A 3ESXA 4GW3A 4I4TB 1LBEA 3NPMA 4EABA 3SLKA 2GXAA 4W63A 4X20A 2ABWA 3NOXA 4X8HA 3FR7A 5E6SB 5ELXA 5K3OA 1KGSA 1F4LA 4ER5A 2AW5A 3LX5A 4D7AA 1TJYA 2C92A 2ZOSA 2OLJA 3FPSA 1XZDA 1YS9A 2YRXA 4B35A 3VC1A 4CBVA 2H00A 2DZDA 1NVVQ 3KOYA 2WHPA 4MI1A 1Y8AA 4PHHA 3W2TA 2GJKA 2VRCD 4Z9AA 1B73A 4KIFA 5LYYA 1SO8A 4R16A 3U9SA 4BEBA 1AKRA 3DMFA 3OIYA 5REQB 1C2YA 4GVLA 3S40A 3T8YA 3F6SA 2XCLA 3GLIB 1NW8A 4ETNA 3RYHA 2ZBRA 3EEIA 1A1SA 4HB0A 2CC2A 4U2KA 4UXJA 3GJXC 5F5NA 5JWHA 2QT9A 3LHDA 5CT8A 2VF4X 1QR6A 2PDAA 3HXQA 4Q39A 2F48A 1KAMA 3CW9A 1YDHA 3BMOB 3A25A 2HCJB 1W1UA 4TV8A 4TUYA 4Q3CA 1NJ2A 1YKFA 2HRQA 3L46A 1BFKA 5U9CA 2ARKA 4BFLA 1I8TA 2Y0PA 1KYZA 1LBQA 4DLYA 1UZAA 2QLJA 2FG6C 3H5TA 2FMKA 2W6PA 4K86A 4EHHA 5LWHA 1G3IA 3CUUA 3GDOA 3QW2A 1KZ9A 3ICOA 3UXHA 2PMKA 1G4AE 3B2QA 3L02A 5K7SA 1RZRD 1JQKA 3T3NA 2L18A 4IH4A 5EJGA 3QLVA 4WCFC 5M7EA 3LT5A 3D3WA 1X1CA 4L72A 2JARA 4AKEA 2BONA 2MYTA 2XAAA 2O2HA 3VXKA 3HBFA 5JISA 4RD1A 4GS5A 5IP5A 3UPTA 3BXPA 2YY6A 4OHOA 5HQJA 3R76A 2BEJA 4CDMA 4D9EA 4D0LB 5K4GA 1GRQA 3BULA 3O0TA 1QPBA 3KYCB 2YQ4A 4XWKA 1MABA 4M4SA 2DY0A 3OIFA 4LOLA 5BNIA 5JCOC 3RTCA 1RMQA 3BJEA 5H70A 1XDWA 2FZKA 1I3LA 3DQQA 2PL9A 3SC3A 4DNXA 2EFCB 4CM6A 4Z2AA 1HE5A 1A69A 2OYSA 3NBQA 3DYBA 3NI2A 4GWKA 4JI4B 4LHVA 4OHFA 4XJSA 3S3TA 3N0WA 1K98A 3LY5A 5HJ2A 4DMGA 4HT3B 2AN5A 2HKIA 2BR4A 3OQBA 4J94A 1JHOA 4FGKA 4OQEA 4YUVA 3CJQA 2Q9UA 2VJKA 3IQEA 1RM5A 2N1BA 2A88A 5L7WA 1NQVA 721PA 2LRHA 2JIOA 3VISA 3BH6A 4NONA 2O2CA 4QQFA 3AL0C 4N48A 1T4CB 1M2OB 3KKNA 3NDPA 4MPJA 1IHYA 3G2IA 2VP5A 2Z9CA 3HU5A 4Y7DA 4LJRA 2AOXA 3EZNA 1GILA 3P9QA 5BV0A 5JSQA 3D7RA 1FFAA 3KT8A 2HTEA 2VYVA 1EK0A 3CX7A 4EW2A 4LSZA 4C0WA 4J0EA 5FUYA 1ZHFA 1JB9A 1UJMA 1RQRA 1KAGA 1Z4PX 4P0TA 1DIAA 3ZU6A 1JKXA 2VAPA 2WAMA 4CEIB 2C8KA 3T0FA 2Z5GA 1L7MA 3AEYA 1Q0LA 2CF5A 4PSUA 3SEZA 4NE7A 3GLGE 3JR7A 3A1FA 1UZLA 3G6WA 4D5GA 1JXMA 1U02A 1QRSA 5F3RA 2HNAA 3SQLA 3BMQA 3DLIA 3VR5H 3UJNA 5CEFA 3BRQA 3OOHA 4HZIA 4RJJA 4Y6OA 1KWKA 2ZQYA 1WSAA 1G2OA 1R12A 4JX8A 2PGLA 3KKMA 2RK6A 2WYWA 1OBOA 3FGPA 3PQFA 4QRDA 2PBRA 3QXHA 1O5TA 4J3FA 5KSYA 5MF6A 3QE2A 3UOGA 1AV7A 1JHAA 2PVCA 2WG2A 4GLLA 3G13A 2FYTA 2Z08A 1WUYA 3DR3A 2VWHA 3DUWA 2J32A 3OMLA 5DWVA 5DYGA 3D2CA 4ZTBA 1ZICA 2EWWA 3O9ZA 2R8RA 4S0ZA 3GFPA 5E7QA 1D1PA 4FZJA 3HADA 4IIUA 3LBYA 5K2OA 3LPLA 1RC8A 1UDWA 2C97A 4KQ9A 4W7SA 4MV3A 1E59A 2W2PA 4LSWA 1RIFA 2BHSA 4B4UA 1MQSA 4JC5A 3V4ZA 2WM9B 5C80A 4XEHA 4H1HA 4HMOA 3ZWOA 1UXGA 1DXHA 2ONCA 3N5KA 3WHPA 2WC1A 2JRLA 3DAYA 4DDTA 5JAUA 1YGPA 3ND6A 5CJPA 4D56A 4B5KA 4C04A 4O1IA 1VG1A 4LXGA 1AK2A 4DZRA 4TWRA 1JIKA 3UW3A 1A97A 2FPUA 5GPBA 1SUAA 4PX5A 1EP2B 4JI6B 2BH9A 5A4JA 4A82A 3ANNA 3H7IA 4C5AA 5JAZA 5GJVC 1X7WB 4JJ7A 3QWIA 4D6YA 5BV8A 2TS1A 1O58A 2EKLA 2CXTA 5M29A 1B6TA 4C5BA 2WFLA 5DXFA 1YVEI 1N8NA 1IWOA 3U61B 1F2TA 2L69A 3W2GA 4PNEA 3C4VA 3P0FA 2HHHB 2YY5A 3IPAA 1GJRA 5M04A 1RC0A 3L1UA 2VXOA 4DA6A 4Q4CA 2XF8A 4K40A 3T41A 1S8AA 3HJCA 3K30A 4KH0A 3CT6A 3QMVA 4W1QA 1Y6RA 2CXPA 1KSHA 1R0YA 4RV5A 3FOEC 2FQWA 3DR5A 3LOQA 5CLLA 1EUYA 4C89A 3PQDA 2R1TA 1LA2A 1K8RA 3IPXA 1EWRA 2RGGA 1Y6FA 1DZIA 3BE8A 3CF2A 3TLEA 1FY2A 5DSXA 2G7ZA 4BZQA 4BCDA 5K3CA 4DG8A 5KZMB 1TVKB 4IDQA 3RV3A 2AR7A 1LV7A 2C8JA 2ID4A 3UY4A 3CJRA 4YFYA 4LQLA 4E5MA 4FJ2A 2RHDA 1N3LA 2O1EA 2P9CA 4O4LF 1UBUS 3HN2A 2QJWA 3ZS8A 3A31A 1TO1E 2E89A 4MW0A 5EMLA 1X8JA 3X1JA 3BZUA 4DQUA 1Q1GA 3K6JA 3GLGB 1KDOA 3D0OA 3PNQA 1ZOIA 4P9NA 4Y2JA 2PSDA 3H4VA 2EZ4A 5AVOA 3PGLA 1BDBA 5IM4A 2C5LA 3DEFA 4GKBA 4S1OA 3IUQA 4TTQA 3LXMA 1A5BB 1B0AA 2HWWA 4WKPA 4XA8A 5KB3A 3EGIA 2IYUA 1T9KA 1VA5A 2ZJAA 1XZLA 4FBLA 3TBFA 4KN6A 1LK5A 1RKXA 1XJCA 1KE2A 1QMIA 4LRUA 3OSUA 1B26A 3M6AA 2PJZA 4S35A 5LPNA 1JQ3A 5IZCC 4KHPB 1Z25A 2TSYB 1PS8A 4EF5A 3HG7A 5F1KA 3GMIA 4TTJA 3U4MA 1NRJB 1O94D 1S7CA 3E7DA 4YV7A 3U16A 1XNRB 5AKLA 2FFQA 5C8YB 2QZ4A 3PNOA 5AK6A 1E3DA 2B1JA 4ZCIA 3HP4A 4PV7A 4C5CA 1P80A 2BM8A 5FOVA 1ZUNA 2AI1A 4HX2A 2FXVA 4D96A 4FOPA 3AUTA 1TW3A 2QN9A 4M22A 5LWQA 1ZA1A 4WZAE 3BSSA 3F78A 5BPFA 1YVPA 4E3WA 3LUGA 4RVHA 3TD2A 4G4SP 3A3OA 1A7KA 1E9RA 2O0KA 1NXXA 1SN7A 3SR3A 3OZXA 4I5EA 4UEOA 3SFTA 1PFWA 1EVKA 1JP7A 1OXBB 2A5LA 5ARBA 3OTOB 2PQMA 4FFMA 2QYSA 3U2QA 2HQOA 1E8MA 1BX3A 2W2XA 4JJEA 2A92A 3E03A 2EJTA 1JDTA 3MLBA 3WA6A 4N03A 2BR3A 2DOKA 3E0XA 3NBAA 4CV2A 5LYJB 3FN4A 2IT1A 2F90A 2WHXA 2BOVA 5A7GA 4RPJA 1JQ5A 2ORED 4FXPA 1I7PA 5FLKA 4YXWD 1JEDA 3CZRA 4N76A 3QKIA 4I4CA 1MGPA 2PZ8A 2R7MA 3AB3A 4N5IX 2O19A 2J41A 2WU3A 1EDEA 4NX2A 4LF7B 1IBMB 2PHZA 2IY7A 1EXMA 1X1TA 1UIRA 1ULSA 3ZJXA 4M1ZA 4E0BA 3FCYA 2ZDGA 2BFEB 3IUJA 4WLEA 5CHEA 3R3ZA 1SXPA 2CE2X 2Y0BA 1VHLA 3NDRA 5BMVB 4HUJA 3F97A 3TWOA 4BKQA 5I8PA 1EK6A 3JQRA 4Y9SA 1ZK4A 1KC3A 1KP3A 3EG5A 4MVYA 4NPAA 1Z0SA 3VO8A 2GLTA 1ZD9A 3VZDA 2DUWA 1ZAKA 3G5TA 3TOXA 1GTRA 3GLUA 4JZKA 5HF9A 1YQQA 1KY4A 3M1LA