4DMCA

Crystal structure of the cftr inhibitory factor cif with the e153q mutation
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
296
structure length
296
Chain Sequence
AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMQAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSRGRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrolase
publication title Visualizing the Mechanism of Epoxide Hydrolysis by the Bacterial Virulence Enzyme Cif.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 109
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dmcA01
5C8XA 5T4FA 5T4HA 3R3WA 5DJ5A 4FBLA 3STWA 4MJ3A 2EDAA 3FSGA 1BCSA 2WIGA 2EDCA 5EHZA 3F97A 1VA4A 3R3XA 1FSSA 4DYHA 3H1AA 1RYYA 5J3JA 5EIHA 5D3KA 5IVIA 3G7NA 5FP0A 3H2KA 3WKEA 1LZLA 3QMMA 2JGKA 4X71A 3FBWA 5AO9A 5EHXA 1Y7IA 1MX9A 1XLWA 1LPAB 2GYVA 4Q3KA 3LP5A 2WU3A 4Y2JA 3O4IA 3I1YA 4QDXA 4K5QA 5AM3A 1QOZA 4Y2PA 5AKLA 2OCLA 3F8SA 1IZ8A 3T4UA 1X70A 2V96A 1JT2A 2QRUA 1G66A 4QLOA 4J03A 4K2AA 4W1QA 4B7ZA 4FDMA 2HA4A 4IHAA 1VA5A 1A8UA 5F4ZA 1EH5A 4X93A 4MWTA 1CUDA 1GZ7A 2PSDA 5CH3A 1A8QA 3O4GA 4IH4A 5JD4A 3HI4A 3WMRA 4IO0A 4QA9A 4X6XA 4G9GA 3U1TA 3W2TA 5FXMA 1FJ2A 3EBLA 1XQYA 2GYUA 1XZCA 4BATA 4CIBA 1CUGA 3H17A 4LXIA 3BIWA 4X90A 4B83A 2AJDA 5AM1A 4J0KA 2WFMA 1BN6A 2IITA 1Q83A 1J07A 3VJMA 5ALRA 3BE8A 4OSEA 2BJHA 5DTIA 4XIIA 1GKLA 5AKHA 2QJRA 2WG1A 3LIPA 3NGMA 2RONA 1CUSA 3ESDA 4J3JA 1YAJA 1UWCA 5JZBA 2XQKA 4P92A 4DNPA 3WKBA 1ETHA 4GHWA 3WL5A 5HF6A 4EY5A 5ALEA 3EQ9A 3I1IA 4P9NA 4DTCA 3AIMA 3V1MA 3WA7A 2C58A 4Q05A 2I3ZA 4Y2UA 3C6ZA 1CUIA 2VT7A 3V48A 2B9VA 1QTRA 2HFKA 1Q0RA 2DFPA 1O6GA 2XT0A 4UPDA 1TKRA 3ED1A 2CB9A 4Q34A 4K6GA 4UBOA 2B61A 3KD2A 4W1SA 4C6HA 4DMFA 2BUBA 4H35A 4J0DA 2XB6A 3BDIA 3UUEA 3BF7A 4X3CA 5FPQA 4J0IA 3VDXA 1QLWA 3WK7A 1EA5A 4RE5A 4Y7DA 4UBIA 2H1IA 2ONCA 1JFRA 2V97A 1HL7A 2H7XA 5AIAA 3DS8A 5JZ9A 5A7HA 3OPMA 1EK2A 3I6ZA 1SFRA 4G8CA 2WTNA 2HDWA 5AP9A 4RGYA 2XI4A 3ESBA 1XQWA 3HSSA 4MQMA 5AK4A 4FKBA 4X6YA 2XMDA 3VVLA 5C7YA 2V98A 1MAAA 2HA6A 3AUKA 4I4CA 1CPYA 1YS1X 1YCDA 2QTBA 3ZLTA 3E0XA 5K3FB 3AINA 1UOPA 5EHQA 3JW8A 2XLBA 3VJKA 4UHBA 3STTA 2XQJA 3D0KA 2PM8A 4QLAA 1LBSA 2XUFA 1DT5A 1ZI9A 2XMGA 3TGLA 1W52X 2G4LA 4GI1A 4KE8A 1XKTA 1ZJ4A 1IVYA 3H04A 4A5SA 3OM8A 4M0MA 5JAOA 1VXOA 1YSCA 5AH0A 3WWEA 1DQZA 2AJCA 3H0CA 4ITVA 5JD6A 1AKNA 4QWMA 4X94A 3B5EA 3FVTA 3KOOA 1R3DA 1VZ2A 5ALWA 2WHPA 3JWEA 3VVMA 2PBLA 5JANA 3WKAA 2HFJA 3HLKA 1R50A 3GELA 2G5PA 4X7BA 4X97A 3JYHA 3G9ZA 5BWBA 4UBJA 2BGNA 1UFOA 1E89A 5ALJA 2JGIA 2RIPA 4LXHA 5HZGA 4FOLA 3DKKA 1FFCA 3DD5A 3ZLUA 5FDFA 1AX9A 1THGA 1LLFA 5FLKA 1Q0ZA 1Y7HA 3SX4A 4BCBA 3D7RA 5CT8A 1WPXA 4DNOA 5AOCA 1LPBB 3W9UA 5CRIA 2QT9A 1F8UA 3O95A 2JGFA 4B85A 1B41A 4K6HA 5CBKA 2H7CA 4FLFA 3M81A 1MNAA 2Z3WA 5E4YA 4BBZA 5LZ4A 1HKHA 4B0OA 4HS9A 4WY5A 2Z5GA 1CUEA 3NOXA 1O6FA 3FSGD 4L9AA 1ACLA 1ZI8A 1OCEA 3HACA 1EINA 2ACEA 2BFNA 1DWPA 4B82A 4GBGA 2WFLA 1PJAA 1AGYA 1TRHA 4Z49A 3LIIA 1IUNA 3R3UA 4BRSA 4B84A 2ECFA 2VJBA 5ALUA 4INZA 1WOMA 4B9EA 1E8MA 4UBMA 1X2BA 1VXRA 2WILA 4MEBA 3D4LA 1JJBA 1BROA 3G0DA 1CRLA 5ALLA 3U0VA 3G9XA 4JNCA 3I2JA 1IMJA 2P8SA 4BB0A 2YXPX 4AN1A 3R0VA 1YASA 2WHRA 2JF0A 5KREA 4X6UA 3AZQA 5IKXA 3I6MA 2JGJA 4BYMA 4BVKA 3CN7A 4ZRDA 1ODCA 4AQDA 4WFKA 2XUJA 5ALVA 5FPPA 3C70A 5IVHA 1E5TA 4ZGBA 1XZMA 5D7BA 2PSJA 2PUHA 4CCWA 2ROQA 5CT9A 5K3CA 5C81A 1EK1A 4Y2YA 4N8EA 3IUQA 3HC7A 5LKAA 1HQDA 4OCZA 4XWGA 1UKCA 3QMWA 3H1BA 4BTVA 1U65A 2Y1KA 4GXNA 3TJMA 4WCVA 5HK8A 5LKRA 2ZJFA 3G0GA 3QMVA 4H7KA 4BCCA 2G63A 3TEJA 5JAHA 4HXGA 4ETWA 5JADA 3O9VA 4NMWA 2OPHA 3IUJA 1DT3A 3IA2A 4PSCA 4BAUA 1EHYA 2HADA 3HXKA 2ZVDA 5K3AA 4Y2XA 1JKMA 3G8YA 4DGQA 2VT6A 5AJHA 5KWIA 1K5PA 4DMHA 4CCYA 1VJ5A 1AUOA 2Z8XA 2JEZA 5A2GA 4CG2A 1T4MA 2H9YA 3O4JA 3ESCA 1KU6A 1LGYA 2G5TA 3WWCA 2PSEA 5SYMA 4BDSA 3I6YA 3IURA 4DM7A 5JIBA 4H7DA 1M33A 3R3ZA 2QR5A 2O7VA 4BE9A 3MUOA 3OOSA 5AI0A 5DYTA 1MX5A 2OCIA 4PQEA 3N0TA 4HVTA 1IUPA 4E11A 4IQ4A 3H2HA 3WL8A 1UK6A 3WK8A 2GYWA 2HU7A 4GEGA 2RAUA 2WIDA 3FVRA 1QIGA 2J3QA 2BUAA 1GPNA 4JYMA 1TK3A 4C89A 2RGUA 3D5EA 2XDWA 4WFJA 2FJPA 4KAFA 4X00A 1USWA 4G4GA 4FHZA 3D3NA 1VLQA 2IX9A 3OURA 4YASA 5A7FA 5I8PA 4N8SA 4UFPA 5A6VA 2CJPA 1EB9A 1CFJA 1P0MA 1G4HA 1I6WA 4BVLA 1BCRA 1CUWA 3ZLVA 1BU8A 2VAVA 1QONA 4LIPD 3LS2A 3ZI7A 1H2YA 1R9MA 2ZSIA 3PICA 5AKIA 1XZDA 1WB6A 3CN9A 3OC0A 5HCUA 3I28A 3S8YA 1LBTA 1BRTA 2OAGA 2XQFA 4F0JA 5CH8A 1TCAA 1BEZA 2K2QB 1DINA 3KXPA 1R1DA 3PE6A 2X5XA 2O2IA 5EI5A 3E1GA 4C4XA 5H3HA 2YYSA 3SK0A 4G4IA 2FUKA 3HZOA 2VSQA 2QZPA 4C87A 2C5FA 2J4FA 4I3FA 4UUQA 1QTIA 3C5WP 5LZ8A 1XZIA 5ESRA 3FYUB 5JZSA 3HEAA 3STYA 1XZEA 4DSAA 2DQYA 2JEYA 4IH1A 2VA9A 3FWHA 1C7JA 1CUAA 2ZYHA 4YK7A 5AM2A 5LZ5A 4X95A 3DNMA 2QS9A 3FAKA 1W4LA 1ZOIA 1JU4A 3VISA 4B80A 1H2WA 5BOVA 4CG3A 3FCYA 1WPRA 1TAHA 2XMCA 1BS9A 2WUDA 5ALSA 3WWOA 5D3ZA 2X76A 3DYIA 1W76A 4EY8A 3W9BA 1PV1A 1QFSA 4DNQA 3K6KA 1XRPA 1MTZA 4G1FA 1K63A 1CQZA 2WJ6A 5HKAA 2W6CX 1ZIYA 3HYSA 4QE3A 3F96A 3KWJA 5ALPA 4OUKX 3DOHA 2WJ3A 3AIOA 5JAPA 2JGLA 3FNBA 3STUA 4WDRA 5AOAA 4DIUA 4OYLA 5ALKA 1LPMA 1DX4A 3C5VA 4BCDA 2QVBA 3PFBA 1GT6A 4EHBA 5AM0A 5CXXA 4MEAA 2O7RA 2WG2A 4QEKA 4KE7A 1OXMA 4H7EA 1CUYA 4Y2QA 5AI5A 1A88A 4CFSA 3KSRA 5CT6A 3OG9A 1KU0A 1QFMA 4J7AA 1A8SA 4UHCA 1S8OA 1XZKA 2XUPA 1JMYA 5AIBA 3KDAA 5JD5A 4B6GA 1G42A 3G9UA 2ZYRA 1VE7A 4U2DA 1FFAA 1XRQA 2R11A 4FNMA 5KWJA 6YASA 3DL7A 5HF5A 2DR0A 3SC2A 4Q1VA 4PF1A 4EY4A 1L7QA 3WYDA 4UBKA 4KAJA 5AKYA 2HHAA 2QJWA 3O4HA 4OPMA 1JMKC 3E4DA 1WHTA 1YA8A 3DLTA 1N5MA 1AZWA 4E14A 1CUXA 4BE4A 1HDEA 4CG1A 1YS2X 1MJ5A 2BAGA 4KE6A 4G9EA 1SCIA 3WJ2A 5JARA 4OB8A 1JU3A 4H0CA 5CMLA 4TGLA 3GBSA 4BP8A 3ANTA 4NVRA 3AZPA 3CCBA 1CV2A 1ZI6A 3WK4A 1SCKA 4HAIA 5CXUA 4LYDA 1K4YA 4KACA 4G5XA 3UMJA 5FV4A 3AZOA 5BV7A 1W1IA 1CUFA 1XRNA 3K2IA 3YASA 1GQSA 4NZZA 5ALDA 1P0IA 3QM1A 3C6YA 5AK6A 3STXA 4CCYB 2PU7A 1QIEA 3QBJA 1XZGA 1E8DA 1EI9A 3IIIA 4F21A 1LPSA 2UZ0A 3DQZA 2E3JA 4ARBA 2FJ0A 3GFFA 1ZGCA 4HXEB 4LYEA 3FLEA 4PV7A 1R4ZA 1YR2A 2CBGA 1C4XA 4WDQA 5ALNA 3C43A 1UKAA 4UHHA 4ZV9A 2OG1A 4ZI5A 2PSHA 2B20A 3NWOA 2QKYA 4GW3A 2VATA 3STVA 3ICVA 5LLSA 1XRLA 1FFEA 3F67A 4DLNA 5K3DA 4WY8A 2Z3ZA 1THTA 4OD0A 4M0FA 5CURA 4H77A 5ALQA 2CEKA 2HA0A 4YPVA 3EIOA 1QIHA 1E3QA 3D59A 3EQ7A 2ZJ7A 3FYUC 2WLSA 1SOMA 4WFIA 4EA6A 2XMSA 3WJ1A 4AO6A 3VXKA 1MNQA 3FOBA 5A62A 3W04A 1DWOA 1UKBA 4O08A 1J06A 4IH9A 1XLVA 4OYYA 5T4EA 1Y37A 4F5ZA 2HA5A 2OGTA 5DYWA 2HU8A 5AKJA 1CLEA 4AMYA 3WKDA 3WWDA 1E8NA 2Y6VA 1EVEA 5YASA 1XZFA 2AJBA 2C4HA 5AICA 1XRMA 4FMPA 2WIJA 2AJLI 1LNSA 3MVEA 1JI3A 3WK9A 3ZV7A 1A7UA 4QDZA 1FFBA 3WLAA 3F9CA 2BGRA 3M3DA 4BRZA 2XUKA 1U8EA 1EDEA 3L1JA 1BE0A 1LPOA 1QIFA 2XUAA 3WL6A 2RHWA 4Y2SA 4U2CA 5AM4A 1EX9A 4KEAA 3QYJA 3WA6A 2DCMA 1QO9A 4PSUA 2QM0A 4Q3LA 2ZYSA 3HRHA 3PI6A 4EB0A 3QH4A 4C4ZA 2VJDA 2PKYX 3R40A 3WIOA 3PFCA 3WK6A 1QGED 3BJMA 4MYSA 5ALTA 5EFZA 4UFNA 3QPAA 4ROTA 3SWWA 5LZ9A 2DHDA 1YB7A 3FLBA 3DL4A 5ISMA 1ACJA 2OLEA 2GBFA 1CUVA 4V2IA 1HPLA 2ZJ6A 1VKHA 5DYYA 4JYPA 1LPPA 5DNVA 2HL6A 4FFVA 1XZBA 4AB1A 3H2IA 5K3BA 3K9BA 2WUFA 3IDAA 3G0CA 2QXUA 5AKZA 4NS4A 3BJRA 3P2MA 1MAHA 1CUBA 2WIKA 3WZMA 2Z8ZA 1QIMA 4UBNA 4OU5A 4AX4A 1CUHA 5ALFA 1ZGBA 4UHDA 1ZD2P 3DYVA 5ALYA 3WKCA 5ALHA 3GUUA 4GDMA 4A23A 1MT3A 4EY7A 4XVCA 2NW6A 2WHQA 1ODTC 3IBTA 5AOBA 3MGAA 3ICWA 4JEIA 3WZLA 2YH2A 5LZ2A 2AJ8A 4FLEA 1XZHA 3ILSA 1ZD3A 1NU8A 3FCXA 4FFWA 4MWSA 1MPXA 3C8HA 1ISPA 5I7UA 4L3WA 1VE6A 1UK8A 3E3AA 2XUDA 1KEZA 2ACKA 4ARAA 4WJLA 2HRQA 4AXBA 5AI9A 1J1IA 4KJXA 2ZYIA 1C7IA 2Q0XA 3G0IA 3C8DA 4P93A 3QPDA 3AJAA 1QZ3A 4AMZA 1TCCA 5I9IA 1WB5A 3NUZA 1VZ3A 2QXTA 4A16A 3C87A 1XRRA 2HA7A 2GZSA 3I2FA 5JASA 2XMRA 1UZAA 4XJVA 2QUAA 3M82A 3W06A 1XROA 1AQLA 4HTAA 2OQVA 1X2EA 1MN6A 2XUIA 5FOQA 1SC9A 5JYCA 2GBCA 4CIAA 1NU6A 2DSNA 4BZWA 5EIAA 2WJ4A 2BKLA 3B3QA 4GECA 4FBMA 5EGNA 3LCRA 3PF9A 5HFAA 1WHSA 4OB7A 4U2EA 5CTAA 2WSLA 1UT6A 1ZIXA 3V1LA 5HKBA 5LIPA 4KRYA 1ORVA 1GPLA 2I3DA 1DWQA 2WQZA 3I2GA 2DHEA 1TIBA 2PU5A 2Y2VA 5AI4A 4B9AA 1R88A 4L0CA 4FNGA 1CUZA 3M83A 3G0BA 2GBIA 1MX1A 2QOEA 2XLCA 5ALGA 1F0NA 2OCGA 1L7AA 3LLCA 1QE3A 2OAEA 4N5IX 1JJIA 3KWFA 2XQGA 2CMFA 4LHEA 3L1HA 3I2KA 5CH5A 4H7FA 1XFDA 4PNZA 4UHFA 4Y2RA 4MYDA 5AM5A 4ZXFA 5ALZA 1XZAA 1LPNA 4G8BA 1HLGA 1P0PA 1CVLA 5KBYA 1GXSA 4EBBA 1K8QA 4B81A 1Z68A 4D9JA 5FRDA 1ZD4A 2YASA 2PL5A 4E46A 2VJCA 5IVDA 4AZ0A 5HF8A 2XUGA 4Y2VA 3WYNA 5BWCA 4U2BA 5FUMA 2RHTA 2D0DA 4P08A 5DNWA 3F98A 3BF8A 2HA2A 1QJ4A 4C88A 1P0QA 1HBJA 2ORYA 1U4NA 2XUHA 1J2EA 4W63A 2VQ6A 3A2MA 3HABA 5HF9A 4JUIA 2WUEA 1GKKA 2GBGA 1DU4A 1XLUA 5D6OA 5IH7A 5ALXA 3DKRA 5AHXA 1WM1A 3BXPA 3C6XA 4Q82A 4DSZA 2VTVA 3MUNA 1YAHA 3GZJA 5EHNA 2I03A 4UFOA 1F6WA 1CUJA 2DHCA 3DOIA 3ZWQA 1DTEA 5A71A 4K6KA 2IIVA 1UOOA 4QDOA 4W1RA 4EY6A 3A6ZA 1EDDA 1D07A 1AMNA 5HQ3B 2JGMA 3R41A 2WM2A 4UHEA 4BC1A 2JIDA 5AI8A 5SYNA 3IUMA 3V1NA 4B0PA 4KAAA 3R3YA 4QZVA 5K3EA 3FYUA 3S2ZA 1K6EA 2XE4A 5LP1A 1G5FA 3L1IA 4J0CA 2PVSA 2C5GA 1DX6A 3AFIA 1U2EA 3BL8A 5E2IA 3WQHA 5FKJA 2C0QA 4BZZA 2ES4A 3QZUA 2AXEA 1N1MA 1EVQA 3A2NA 1E66A 4AZ3A 1WB4A 1H2XA 2HA3A 1AC5A 3H18A 3VKFA 3EF3A 1ZICA 3H2GA 3UUFA 5JAUA 2D5LA 3PUHA 4FLMA 4EZIA 1YB6A 3GROA 3H2JA 4LKOA 5AKGA 4BC0A 3TRDA 2OQIA 5T4BA 3A2LA 3C6BA 4BAGA 3IULA 3DDUA 2O2GA 3A70A 2DQZA 4U2GA 1ZJ5A 5K3FA 4I19A 1UOQA 4ZV7A 1H22A 2I78A 4QDTA 2XMBA 2LIPA 5C8VA 4DMKA 4H7IA 1QO7A 1EDBA 2O2HA 4PSDA 4H7JA 2GZRA 3B12A 4BVJA 2FX5A 4AO7A 3C45A 4GWLA 2QMQA 2JBWA 4KRXA 4U2FA 3IB3A 2X8BA 3D2BA 5AK5A 4HRXA 1WCYA 5AI6A 2WKWA 2HU5A 1TCBA 2XQIA 5CT4A 4C4YA 2R8BA 4AO8A 3PDCA 3T52A 3WI7A 3WK5A 7YASA 2WUGA 1UK7A 1DQYA 3O0DA 4UBLA 3RM3A 3AILA 2XUOA 4XX1A 2OCKA 3D2CA 3AIKA 3CXUA 3QITA 2V9ZA 4DMCA 5HK9A 1CUUA 1CEXA 5DTJA 2XMQA 3O9MA 1XQXA 1XZLA 1B6GA 4HRYA 3RLIA 4RNCA 1JJFA 4E15A 3DCNA 2VJAA 3EQ8A 1QIKA 2RI6A 2VEOA 2JGEA 1N8SA 5E4TA 4W1PA 1L7RA 5C8ZA 4KE9A 1SCQA 1H2ZA 3DJYA 2OGZA 4ZWNA 1FFDA 1XQVA 3OTQA 3GA7A 2B4KA 1F0PA 3G9TA 4OB6A 3R3VA 1ZD5A 2BCEA 1GQRA 3QPCA 1T2NA 1QIJA 5ALOA 5ALMA 4BAZA 2PX6A 4F60A 3PF8A 5K5EA 1LZKA 4X85A 1VOTA 1AURA 1CQWA 4G8DA 2WTMA 3IVMA 2PPLA 4TVKA 5E4JA 2WHPB 2C0PA 5JATA 5AKXA 1XZJA 4ZREA 1W75A 1CR6A 4W9RA 4J0JA 1H23A 4C01A 4BDTA 1GGVA 4N5HX 3D2AA 3I2HA 5HFNA 2OGSA 4M0EA 3FYTA 2EEPA 4H7HA 4RE6A 1GPKA 2WIFA 2BUCA 1BN7A 2Y2UA 1RWQA 2J3DA 4PW0A 1IUOA 3HJUA 4PO3X 3V1KA 4LXGA 1PFQA 1OILA 1MO2A 5DWDA 3X3HA 4J0HA 4RPCA 2VAXA 4KYVA 4BTLA 1RP1A 2H7YA 4HZGA 1Q84A 3PUIA 2OXEA 5AK3A 2W22A 3V9AA 3BDVA 4X92A 1UXOA 4DNFA 4Y9SA 3BIXA 1QIIA 3IUNA 2WG0A 5LZ7A 3I2IA 4CI9A 1R9NA 4FWBA 4J0GA 4QNNA 3RK4A 3G02A 1IZ7A 2WFLB 3WWPA 2VF2A 1XKLA 1ORWA 4N8DA 3ZPXA 1EXWA 5CW2A 4FTWA 1CIJA 2WFZA 4MXDA 4YX9A 2HM7A 2XUQA 3Q8WA 5DLPA 4Y2TA 4S0XA 4AN0A 2Y6UA 1YA4A 2CUTA 2J4CA 4GLBA 4OU4A 4TPKA 3ANSA 4EUSA 2PUJA 1NX9A 3DEAA 2ZSHA 3ESAA 3N2ZB 2QUBA 3H19A 2HRRA 4L72A 2HIHA 1QIDA 1EB8A 4KR0A 3RARA 4MQLA 4X91A 5EIEA 4Q3OA 5JALA 4QWWA 1MU0A 1N5RA 3W05A 3WL7A 3FLAA 5ALIA 2PSFA 3CCCA 5HQ3A 4H18A 4G4JA 5CT5A 1CUCA 1BEEA 2C7BA 4JH0A 3WIBA 4HXFB 5DNUA 3QVMA 5AKKA 2CZQA 1ODSA 2XMZA 2WU4A 4QDUA 5IVKA 1UK9A 1TQHA 1W6RA 3RKSA 5AKEA 2CKMA 5LYYA 3VJLA 3Q0TA 4BP9A 3BWXA 5A7GA
chains in the Genus database with same CATH superfamily
2V54A 1P4GA 3U3JA 4TZTA 3R3WA 2D6FA 1EX7A 4C22A 1OI4A 3GUCA 3H05A 2Y99A 3OFVA 3BTSA 5HOQA 5D5QA 3QMPA 4REOA 2WIGA 1VL0A 2OL4A 4F4FA 3VMFA 1E98A 5JEDA 1UBNA 5FUYA 4CR6A 1PSWA 2D4HA 1H5QA 5J3JA 2MMCA 5EIHA 2J6BA 5IVIA 2P9FA 2P68A 4QX6A 1DJMA 2YOHA 3B3FA 1L3IA 2Y1EA 1DQRA 3QMMA 2JGKA 2X0IA 4WNAA 4ZK2A 4I2NA 2QR3A 4JVOA 1Y7IA 1MX9A 3KR2A 1UBGA 1HX7A 2G76A 4P7FA 1EUCA 1UDCA 4P86A 1X87A 1LPAB 4PLCA 4ZOLF 1MQAA 1A5SB 5HZKA 3NBAA 3I04M 1E64A 2GVZC 1GFZA 3DR3A 4LJ4A 3ELBA 4ZPXA 4P7GA 2P2DA 1S3SA 1UJ6A 4Y2JA 4YP0A 2WD7B 1Y81A 4J6FA 2X2PA 3X1WA 3A0UA 3NBFA 3U9SA 5AM3A 3WLNA 3AHEA 4JX9A 5IN5A 4FQ7A 3D3EA 2RHMA 1FBNA 1G1MA 1IYZA 1JILA 5AKLA 1G291 2OCLA 5EG5A 4OX9Y 4QRHA 1HXHA 1OA0A 3VO8A 2PJUA 2RHCA 1OX6A 4MO9A 4KGVA 1C8KA 4BO0A 2D5AA 1JHXA 3T4UA 4J7XA 1P3JA 1P5HA 5U9CA 2X5JO 2QD4A 5JLJA 1NATA 5ABPA 4R0NA 1R6VA 4LJAA 3AW9A 2LCQA 3TO5A 2X3UA 2PLFA 1I4OA 3B1XA 3CPJB 1P5RA 2BF7A 5C37A 4B7ZA 1AG9A 3QPWA 1MC8A 4FDMA 3FRJA 3ZKWB 2GJ4A 1X8LA 1VBMA 1EH5A 1RZRA 2WPNA 1GFWA 2GB4A 3IB6A 1NNUA 4MWTA 4HB2A 3VUEA 5HE9A 1ZK3A 2RH8A 3TIVA 1Q22A 4XIJA 2PSDA 3IAUA 5CH3A 1JAYA 4IUYA 5JD4A 3HI4A 4DCJA 3WMRA 5EJ6A 4B4VA 5E7IA 2PMWB 3FDIA 1QAMA 2PR2A 1ZH0A 1TM7E 4EJ2A 3GT0A 2CHUA 3SZUA 4X6XA 1B26A 2OD7A 2GA9A 1JDSA 1PJ3A 1M76A 3W2TA 1I36A 2PMFA 3EBLA 1XQYA 5CYGA 5HS4A 3U61B 2W6ZA 1XZCA 5FL7D 4BATA 3OZUA 4MVWA 2EP8A 4UXJA 3WR5A 1FVOA 4EGQA 1BDHA 3NIDB 4F4UA 1YOVB 1JHZA 4CNQA 4X90A 1K7XB 3CMMA 3MERA 1GTG1 4RSMA 5CNKA 1H2EA 2IITA 5A9SA 5LU9A 1F7VA 4US1R 1EA7A 1QORA 3G49A 3KQMA 4U7HA 3FTQA 1WY7A 3N6RA 1TC2A 3USZA 5ICGA 3U7QB 1J07A 3VJMA 4DE5A 4G0PA 3A9RA 3KAPA 4FDVA 5ALRA 3S99A 2R8YA 3H4MA 4UAJA 5I7RA 3IKJA 4PYMA 3GFSA 1CDEA 4ZO4A 1SCUA 1J23A 3FOFC 1FYDA 2BJHA 5K2MA 4F4CA 2E89A 3BRWA 4A36A 4G5QA 4UCQA 4MA5A 2AGVA 3K5HA 4G67A 5FPHA 2H8KA 3DW3X 3UIEA 4CGYA 1R6TA 2FY8A 3RHFA 5KSZA 2CJXA 5G3ZA 3D6MA 1YS4A 3NGMA 1AXEA 4P5PA 4WKBA 4UUPA 3THXA 1SBZA 1L8AA 4FXOA 5EERA 1NW5A 2RONA 1SIWA 3PGVA 4BZQA 1AS2A 1R8XA 3JY6A 4QRDA 3UJHA 5DN6A 3EB9A 2EZ9A 2ACWA 3UMVA 5LP6A 2ZAMA 4XDHA 3AJRA 1RPJA 2W58A 2V8OA 3ZDEA 1SM4A 2KQUA 3WXBA 4DSUA 1M73E 1P7PA 1TUGA 1TT5B 2HJRA 4D8WA 4LE1A 1EESA 4DNPA 2H1FA 3DE2X 4C7KA 5EZSA 3UY4A 1V41E 2X7HA 3WL5A 3SI7A 1F8FA 1HMYA 3C3AA 4YI3A 4D4KA 4EY5A 3EQ9A 3I1IA 5KYNA 1U8ZA 3LNCA 1HTTA 3HJHA 1YRQA 1XIVA 2GKGA 3AX6A 3NV7A 3AIMA 4ZVVA 3V1MA 3ZK8A 4C0LA 4F1KA 2GOYA 3JRXA 3QELB 4PLTA 1SGWA 1ZVKA 3AYXB 1B8PA 4K9KA 4Q9JA 4YN3A 3JR7A 2BI4A 1PF7E 2KW5A 3F3YA 3D8NA 4LOLA 4Y2UA 4UNPA 4QUBA 3C6ZA 1CTQA 5CW1A 4LFCB 3DJFA 2J9XB 4DDKA 1C2TA 4RS3A 1Z39A 2H8GA 1YDEA 3HB5X 4JKIA 4X61A 5ICSA 4V2UA 1GRNA 1NC3A 4HATA 4MGEA 1E6MA 1M1ZA 4KUEA 5K4HA 4QXPA 1YKGA 1UPAA 2G9VA 2I6XA 4URVR 2PWYA 3QVWA 1BA3A 3EXIA 2DFPA 5CRIA 1H0HA 1XALA 1XMXA 1KIFA 1E59A 1PG0A 2A58A 4UPDA 1M34A 1N6PA 1S8AA 4N3GA 1RYZA 3PDHA 1SAYA 4IDNA 4HMPA 1E2EA 2C8VA 2GETA 1O9HA 2VBFA 4KIFA 4QXMA 4UVGA 2Z6AA 1Y3IA 1YL5A 3AOEC 4NMHA 4UBOA 4MIKA 2HUNA 4ZZIA 4HLUA 2EFHB 1JNXX 2GBPA 4RK7A 3WJ7A 1YOBA 4W1SA 1RLJA 4BO9A 3D0OA 5HM6A 2JW5A 2WM3A 1IWOA 1PV2A 4H1HA 4P35A 3NEPX 1XEFA 4Z8YA 2OHOA 2YVQA 2ZRDA 3MAJA 3BK2A 1TM4E 2DR3A 3BDIA 2FEMA 2J85A 3KEOA 1JE1A 1JFFA 1M5TA 2X14A 3D7KA 3EDCA 4LF7B 4KR3A 2O5RA 4M0LA 5A4KA 1UWKA 2QVYX 4U00A 4ADSG 2BRUA 2YOFA 3UFBA 1RXUA 4Q4AB 3EN0A 1RRFA 2QRQA 2CFSA 2Q9UA 2Y0DA 3DV0B 5DT9A 2HXYA 4BU1A 4NPHA 1PFYA 2ZI7A 1OLSA 5C1IA 1ODIA 3GNSA 2XX3A 1KEVA 2GD1O 3MEQA 3QF4B 2YYZA 4Y7DA 2F1HA 2X77A 3CH6A 2MSNA 1K0UA 3CZ4A 3DZKA 1F4VA 2HWXA 3T34A 5HKKA 2H1IA 4JLUA 4LHZA 4RQAA 4UM9D 4XASA 1JFRA 1FK8A 4J1NA 1D9ZA 5NLLA 3S5UA 4AYXA 4BQFA 2BFFB 2AFIA 3WLTA 3FH0A 1NN0A 5JZ9A 1NHWA 3MCZA 3WHPA 2PRKA 4NONA 1Z4NA 3ADPA 5IAJA 9GPBA 2R1VA 1PR3A 1QRDA 3RS7A 4PLYA 4YJ3A 1RD4A 3EG9A 3MTIA 2P2ZA 3OETA 4I5GA 4MV4A 3I9KA 2HDWA 1YI0A 1REQB 2D1SA 5AP9A 4UATA 1NULA 3OSZA 4F4IA 4BB6A 4CUJA 2IXBA 3AKCA 3CEPB 1DRKA 3ESBA 4OH1A 3HSKA 3NVAA 2BI7A 3NAMA 4QYTA 4YQZA 2NVBA 4HQNA 5AK4A 3RC3A 1AKYA 1PQYA 1YJAA 2XEDA 5BRNA 4EUHA 3G5UA 3P27A 4KFCA 2VKQA 1DO2A 4Q66C 5FO1A 1TYEB 5J58A 1GAWA 1JHRA 4HDSB 3W5DA 2VUIB 3B9RA 4L22A 5C7YA 4ZVLA 2C03A 1AUXA 2H1RA 1KS9A 2PBFA 1QRAA 4ZYLA 3FPCA 3I0NA 4RANA 4BP3A 2BH2A 3K32A 2Q5OA 4QXRA 2DRIA 3E0XA 1ZR4A 1KY5A 4PEVA 1BXZA 4L4SA 3VDNB 5K3FB 3G6WA 4LMAA 4RC9A 1KVQA 1XXHE 2P40A 4W5RA 1YWGO 4YUAA 1U3VA 1ETUA 2PLRA 2R6HA 3JW8A 3BREA 1WZCA 4MOWA 4ZT3A 3DUFA 2XLBA 1AMOA 4EZEA 5TRTA 3PLAE 2VDUE 5EMMA 2W90A 4TTRA 1B6TA 3ABQB 4IINA 5REQA 3F8WA 1KERA 1C4WA 2FN9A 1XDWA 3JARA 4MGIR 4C04A 4ETMA 5M04A 4W5QA 3CUVA 2RBKA 4ESVA 1VIDA 3LV8A 1MIOA 1R6UA 1T0BA 3LRPA 4QVKA 4BNGA 4IXNA 3VV2A 2DFVA 2BLLA 3TCXB 2XMGA 5B4VA 4QHYA 5FBQB 3X1XA 4ANFA 5FLEX 3W77A 5BUZA 1KF0A 4IHQA 4C29A 4EB6A 1TLTA 1Q74A 1L5FA 1Z0JA 1MQSA 1V5EA 3VHQA 1SWVA 3DXYA 1U1GA 3CF4A 2N9UA 1JLLB 2CHQA 4HGYA 2CXTA 1KEEA 4IGKA 5IS2A 5LA6B 4EVSA 3S4YA 2GK4A 1NZDA 1VBNA 1V9SA 3IA7A 3HY6A 4R2WA 1PYDA 1PCXA 1LSJA 4MRMB 4OIFA 2QU8A 3KQOA 5DKFA 1I33A 1NONA 4LPSA 3FJ1A 5DHUA 4A6DA 4YECA 2R00C 4ITVA 2CNWA 5EQTA 2NU6B 2VWGA 3OKAA 4NZOA 3V7WA 2MINA 2GNOA 2Z2JA 1HZZC 3B5EA 4X94A 2FF7A 2F43B 5CIWA 3V42A 1CLUA 3UZUA 3ZCRA 3M6MD 1DBPA 2MIIA 1DBQA 5ALWA 2UUBB 1OV4A 1WLYA 4LBVA 1OH5A 1JTEA 3EVNA 4K8RB 3K3PA 1XC7A 1INLA 4A2PA 4IWNA 1LK5A 3JWPA 4WY2A 5GJVC 4D25A 3IOEA 1BVRA 3UK2A 4DJJA 2G9QA 4W4TA 4QGAA 3WKAA 4D6PA 5B3AA 4YMHA 3VR5H 4IIVA 3MPOA 5BQPA 1QRUA 1R50A 1NYRA 2I4MA 1C1HA 3T12A 4V0NA 3RNLA 5HUQA 1I2AA 1UR5A 1YJBA 2GCOA 3S7ZA 3WL6A 5EA2A 1KEUA 4F6LA 1DZ3A 2XNHA 4OJMX 4UBJA 2BGNA 1UFOA 4KPUB 3RWBA 4CKCB 1FS4A 2IVFA 5JZVA 1NXPA 2GTHA 1CRQA 1KZ6A 2JGIA 4RWZA 1I3CA 2JGNA 2PMBA 3AEKB 3I5AA 3JD4A 2I7DA 3M1YA 1VJ0A 4N47A 3R76A 3ZDXB 4D0GA 1G3MA 1WUIS 1Y89A 5K6RA 3SIWA 3EFOB 3LPCA 2DP4E 3HBNA 2LTAA 2P9TA 4KI0A 2JD1A 3G2MA 4INOA 4FMCF 3IP1A 2W93A 4EG3A 4FZRA 1RP7A 3HVJA 3GGDA 5FLKA 1Q0ZA 3NGLA 2DEUA 3B60A 3DDOA 4ZCMA 2CHFA 1Z07A 3K6SA 4DDUA 1W94A 3G13A 2XB2A 3H6HA 1U9IA 4E09A 2YJ6A 2EX1A 3IH5A 1KS2A 1T1IA 4AQ7A 3TZKA 1QE0A 2J0QA 2G7ZA 2M2IA 2Q3BA 1UJ5A 1MXFA 1ULTA 2ZRQA 3OJCA 1JAZA 5DM70 4W5NA 4D9NA 1E5LA 1KZ9A 1M6VA 1NZFA 2C83A 4KXXA 1G5QA 1N5LA 2DBYA 2Q6IA 2XE7A 5HGJA 5CBKA 1DTSA 1XCBA 4LHXA 3SZ3A 3OEHA 3DE0X 4B8YA 4S04A 1WBDA 1MNAA 3WX0A 1GGEA 4BBZA 4XQCA 1HT0A 2Z09A 3RFCA 4MUFA 4PG5A 4B0OA 4LGVA 3T7IA 2IY8A 5U4XA 2MSLA 3BFPA 3IPYA 4JQOA 1CUEA 1IEQA 2OM2A 3NOXA 3TD9A 1QYIA 1Z34A 2FLKA 4O3FA 2WV9A 2Y05A 1RZVA 3DYBA 1ACLA 3A3YA 1ZI8A 3OIUA 1GAJA 2AZDA 3DKPA 3TMAA 1J00A 3M5PA 4RF5A 5FR1A 1VKNA 1G6HA 1N6NA 4KGZA 3EUEA 2C4MA 2IZZA 3PBKA 1SR8A 4H3HB 1CZRA 4PO9A 3SHVA 2ACEA 2PYIA 2J8ZA 3W5AA 2DZDA 4B82A 4XPIB 3JZMA 2WFLA 3IYLW 1NF2A 1TRHA 1ND6A 3LIIA 2Z57A 4XWAA 4CM1A 1MB9A 1ZX1A 2YC2C 2IU3A 3OHPA 4XD7A 4KR6A 1SIUA 2Q4BA 4RH3A 3H87A 1Q12A 3PNVA 3G8CA 2ECFA 4JT4A 1DXYA 1KI7A 2QSUA 3GAZA 1II9A 4IW3B 5TT0A 3T1QA 4C4SA 5LIRA 1IHUA 1MQ9A 3GU3A 2DUWA 3G0HA 5H7XA 5H80A 5FQNA 3SXUA 4II3A 1Z6QA 4ZEMA 3OICA 4FONA 3O8RA 1X2BA 3C6KA 5B1SA 3OOEA 4LRSB 3TDKA 4TYYA 2WILA 2OV4A 4ALJA 4OUDA 5K99A 3IUSA 1R0ZA 1YR1A 3QY9A 3BB3A 5LSAA 5B2FA 1VDZA 5KTOA 3K9HA 2N75A 1E7QA 5BSVA 2Q41A 4ETIA 1NV9A 1BW9B 1KKLA 1X1AA 5IJWA 4DUZB 1GUDA 3U0VA 3G9XA 1QPGA 1DUSA 3QVKA 3UV3A 3BB4A 3OPVA 3UK1A 2PXHA 3ZHZA 1IMJA 3ELDA 4P33A 2YY6A 3JD0A 4FGUA 4PYLA 4F84A 4H15A 2PD4A 3DCJA 3R0VA 1YASA 3HY3A 5KEIA 2Y1FA 4TLDA 4LRTB 1RI2A 4OKIA 4JI5B 3KZOA 3R7WA 4C6TB 2GM3A 5D1HA 5LXTA 2H4FA 2ZJ4A 3C5HA 4XGRA 5IARA 4D9GA 1JBKA 4BN5A 3ZE6A 4Z53A 3BDAA 2QZJA 4D92A 2X58A 1Z2OX 4LZJA 1WJGA 4JC0A 4CTOA 1JEQA 1GYRA 1B0ZA 1A9OA 1JLMA 4JXZA 2D5CA 2OO5C 4TMFA 2PPVA 4NEHB 3WGTA 2DM6A 3VPSA 1ODCA 1GYQA 1VHWA 3KYDB 4BV3A 3FWNA 3G1UA 4KV9A 4DV3B 1N9KA 3B8HA 4IFBA 4K26A 5JXHA 2ZBDA 3E9YA 3MWDB 5JY1A 1E2UA 4UU0A 1PN3A 1LF0A 1X1SA 2AA3A 2P9ZA 5FPKA 1E5TA 5BRAA 3THYA 1QF9A 4O4HB 4AULA 1G6OA 4EA7A 1XZMA 3WP0A 3D4NA 3PCTA 4JU9A 1DX9A 8LDHA 2IYPA 2AV6A 2DQKA 4CCWA 2UVQA 1UIRA 5KINB 4GGOA 1A7KA 5K0LA 1CWUA 1X86B 2IYXA 2BE7A 3PD0A 3RG8A 2OHIA 3VPXA 3NTOA 1OI2A 1SKBA 3PNKA 4BLSA 1JR6A 4BFCA 1OX4B 2F1IA 2JHPA 3DOEA 4NJMA 4BLQA 3SR4A 2E4AA 3AXSA 2R8XA 1NLZA 2BM1A 1ZOLA 1Q7RA 1BVUA 5F35A 2VIIA 4CFZA 2XTJA 5FLYA 5JYEA 2VWQA 2QLBA 2PQ2A 3N07A 3JAWA 4ZYWA 4G5HA 3FLMA 1XCGB 5F5XA 3T5BA 4RLFA 5LKAA 5DM2A 1ZJWA 1HNNA 1IBCA 3C1OA 4XWGA 1UKCA 5SV2A 2OK7A 2QMOA 5KNLA 4G36A 3DDWA 3PHGA 1OAAA 1PZFA 1U65A 5KKCA 3TJMA 2BEWA 1FDIA 2I2CA 5F9HA 4M55A 3VHXB 4FFLA 4N7MA 1Y1PA 2YIVX 5HK8A 3GRFA 3GNLA 2P2LA 2W8BB 1T15A 3OJFA 4WACA 3S6JA 2VN8A 1V95A 3G0GA 3MOGA 3QMVA 4KTTE 1U99A 3KX2A 1QAQA 2O8DB 3AFGA 4U7GA 3TEJA 2BF4A 2YMPA 3JSAA 4KQCA 4CUKA 1JDZA 4KPYA 2PQ0A 5F9MA 4G1MB 3TECE 1NLMA 3O9VA 3S1SA 3K9WA 2WYIA 1JH8A 4C5AA 4DPMA 5C1PA 3BWBA 1M5UA 1LQTA 2ZVPX 3EEIA 3EGXB 3NO4A 1REQA 3IA2A 3RAEC 1ZC3A 1SHLA 1O97C 4N6NA 3SOPA 4DCCA 4HB4A 4C43A 1VSUA 2CEAA 2ODAA 4YRGA 2FW0A 1TF7A 2ZVDA 3AK4A 4EYKA 4Y2XA 1S3FA 3G8YA 5I8WA 2FOLA 3VNSA 3F71A 3WNBA 1N7GA 4LF6B 1NMXA 3SS7X 1XTJA 3ZXXA 4DMHA 1OGIA 4PGFA 2Z2YA 4PC2A 1UBTS 1C81A 3EMVA 1ECJA 3WAGA 1EE2A 3H1EA 4W6ZA 4EUEA 4PN3A 4YMVA 1BGVA 1DEKA 4IDDA 1VJ5A 3MZ0A 5A3JA 3O03A 1BQ4A 4CZ2A 3DCYA 2F3PA 4NATA 2Z8XA 1K3UB 4LJ9A 4UNNA 5A2GA 1T4MA 3CV3A 5EGSA 5A2QA 3WIVA 4JL6A 3TTTA 4YT8A 1UWLA 3BGOS 2QX4A 1WXXA 4I5FA 2F2TA 4J91A 3RRJA 5JZMA 3HXQA 1OH7A 2IBSA 4L95C 4D45A 1MD9A 2ZS8A 2AQKA 1KR2A 1VGRA 3V9PA 1P31A 5JSKA 4KMMA 1FU4A 4V0ME 4DC1A 1LGYA 5G3YA 4PC7A 1J2UA 1PP4A 3M4JA 1ATZA 3AC0A 4HDRA 4LI3X 3V80A 1JR3E 3I6YA 3EVZA 4DV4B 3M6VA 2OT3B 3KAKA 3M34A 3RROA 4NBNA 3F3KA 2ZRMA 1G63A 1ZNQO 3NHFA 4H7DA 5C51B 1V11A 1Z0DA 2QR5A 2XZTA 3A6FA 3RH0A 1F4PA 1T9CA 4GOXA 4JLOA 4ZVPA 3KXDA 2BFCA 3AP1A 5E7MA 3R0ZA 3E9ZA 1KRWA 4CPDA 1I51A 3N0TA 5P8WA 4KITB 4GNRA 1AK2A 2WF7A 3GA5A 5EHIA 3CUSA 1V4BA 1NE7A 3JASA 1H6AA 4AY4A 4EW3A 1Z26A 4F3CA 1Q0LA 4DLRA 1JQ5A 2YHUA 3BEOA 3PP8A 4C0AC 4FFPA 4LVUA 4AI6A 2ZT6A 4GEGA 5DHQA 4CDMA 4LJ8A 3IR6A 3ROQA 1QIGA 4L02A 1GPNA 1QGUB 3WGYA 2OK8A 4RA9B 1WS6A 4R6XA 4QOFA 1PK8A 4C89A 5JAZA 3H4IA 1GU7A 4FCWA 3T7EA 2QV0A 2RGUA 3WC4A 4L15A 4BL5A 5I01A 4X00A 4MUJA 1BX3A 1USWA 3K1AB 5G1PA 3UMCA 4KG7A 5JZOA 5F77A 4QATA 2GEKA 3PJEA 3TQOA 4AJ1A 2PS1A 3OURA 3E58A 3KZ1E 3K9QO 2A35A 4OMDA 4Q6WA 4R2LA 5A6VA 1GL9B 3QBTA 1V8ZA 2CJPA 3P9RA 3OUTA 4ZOLA 2VT3A 1DKMA 5D6NA 1G5RA 1PT5A 2Y1OA 1GU0A 3FUVA 5DNEA 4LCBA 4Y6QA 1S0UA 1PFKA 4J6EA 4X1IA 1PG5A 1G4HA 1ICEA 1JSLA 2E48A 2OHXA 1I6WA 2QRVA 3FPKA 3LGXA 3QEMA 3L7YA 4M83A 1CUWA 1NM5C 1HH4A 3LECA 4GX1A 4MCHA 3TNDA 2BCGY 4XQEA 1N36B 1PS8A 2D1FA 3SC6A 2HF8A 3PHJA 1O8CA 4GRIA 1BU8A 4JR1A 4PNHA 7ABPA 3EEOA 2VAVA 4Q4JB 5AW3A 2I99A 3LS2A 1OZ0A 1VLHA 4UOZA 4GI3A 3H2SA 1JG7A 3IEXA 5DZSA 3HBAA 3X43A 4DXHA 2VTDA 2F8TA 1J8VA 2B4TO 1WMFA 2X7XA 3ZNNA 2Q49A 3QSYA 3O75A 1H2YA 1R9MA 3EEYA 2ZSIA 5EUBA 1H93A 4JLPA 5IM5A 1L1FA 1JLHA 4G5RA 3TLXA 3AL2A 1RWWA 1C9JA 3ASYA 4KVFA 4ZI5A 1RI5A 2ZFUA 2V5AA 4NBKA 1ATIA 1SA0A 3CLRD 5A6SB 1VPVA 3LUAA 3CBGA 3PQ3A 1XZDA 1SBQA 1WB6A 1M0TA 1VJCA 4IIDA 4PAGA 4BEVA 3FHJA 3WTBA 2AOWA 1VB5A 1N2GA 3Q8KA 1WXEA 3CRRA 2Y1XA 3P9NA 2J7KA 3S8YA 1T91A 1R4MB 4HEQA 1R4AA 4DEYA 2XQFA 1XWWA 3SJAA 1Y48E 3IT0A 5K03A 3DV2A 5B37A 3PPIA 3OE4A 4MYRA 1TYDE 2WPDD 2X9NA 2JH3A 3FETA 2RGRA 3EXHC 4IDCA 4XB1A 1NVVQ 4DV0B 3ZGLA 4MGZR 2LD4A 1WDWB 4HWRA 1DKNA 1ADFA 2JZNA 3U4IA 3G9QA 4DBZA 4GMKA 1MGOA 2YYSA 5L45A 3BXOA 4AECA 5DSTA 4HUTA 3U1BA 1DAOA 2FUKA 3OE5A 4RENA 1I6LA 3DT8A 2P1DA 5AVRA 5LMCA 2YW2A 3U4QB 2YIDA 4HB3A 1BKYA 1NRIA 2LCIA 1UBKS 1QTIA 2PZBA 2NTVA 4UUQA 3U4AA 1NQXA 1RU3A 1XPRA 3C5WP 3QX3A 3RG2A 2OG2A 4PX9A 1UC8A 3TL3A 3Q15C 421PA 3IEPA 1RLIA 4JSYA 1BSVA 2FUG6 5ESRA 1XMPA 2VHQA 3GRVA 1OJLA 3HEAA 2NZUG 1XZEA 2MYNA 3L0YA 3FDZB 3ZQJA 1VIVA 2JEYA 1YHYA 4PFQA 4I1PA 2XW6A 4U0KA 3DBOB 4YROA 4QVGA 2ZIUB 3R6LA 4C6SA 2I2AA 4BEBA 2AX4A 3COPA 2I7CA 4MTCA 1TM5E 4MPTA 1U6KA 1BWSA 1EVKA 3OAAA 1SY7A 4R8KA 4YK7A 5AJXA 3SFTA 5AM2A 2EJWA 2HQ1A 4UVEA 3VR4H 2D74A 3AKDA 3KT8A 5TLSA 1W5EA 4QTXA 2ZG6A 1XCOA 3MWJA 4U7DA 2VZ8A 1V1RB 3HY4A 4TSRA 5AHOA 1DVRA 1TADA 1Y3HA 4MKHA 2A3RA 1DCFA 5HA5A 3JTEA 1RQGA 3SHTA 4XVUA 1H2WA 5BOVA 1H6DA 4PM4A 2DLDA 3BH7A 4IVNA 3QBEA 1NBWB 2AT1A 5T41A 4QBKA 2XMCA 4J0QA 5COBA 4G0QA 2HRZA 2CVHA 2WUDA 3DOUA 1GVNB 4MQBA 5ALSA 3VUFA 4YCCA 4ME6A 3CE9A 2OHGA 2X76A 3DYIA 1JIXA 1J9GA 3PU6A 4M9XA 4XYBA 3RTDA 4CU2A 5JCXA 2Z2XA 3CNHA 5EJ8A 1WW2A 2NTYC 2V0CA 2ZTLA 4RPKA 4B79A 2IUFA 1RMQA 4QJ5A 3HCNA 3K6KA 4DDWA 2GJSA 1R4NA 3PNYA 1XRPA 4XD2A 4OQ4A 3QKSA 1JEDA 2ZKLA 1MTZA 1UQTA 1OZGA 1KO1A 3NX4A 2OSBA 3T7SA 3LQ1A 2JLZA 3LF2A 1XVIA 5F1PA 4E5UA 1XSEA 1N2SA 3BGIA 2BTQB 2ZJBA 1K86A 2LUOA 3IMEA 3TLMA 1PYOA 3LX4A 5CVCA 3PNPA 1Z5GA 2W6CX 1F5SA 2BFAA 3CU5A 1AQJA 2FMTA 5CVVA 2MWMA 3L8EA 5KNDH 2R44A 4K86A 3KWJA 5ALPA 2EERA 4U7PB 2WJGA 1E2IA 4DLAA 2WKRA 3CNQS 3DBLA 1SUFA 2WJ3A 2ZBRA 2WJHA 3AIOA 3O4RA 3TMYA 4JI8B 3L1KA 2JNWA 1NOKA 2B0CA 2QVCA 3LFUA 2R7MA 3GC6A 4MV9A 3BHNA 4ZMSA 1N92A 3H5AA 1KIMA 4OQPA 1YB4A 4WN3A 1LBHA 1OAOC 3O6VA 1XAIA 2RHBA 2F1KA 2LR0A 4HFNA 4NSNA 2NQ8A 3IXMA 4KBGA 5ALKA 2HSJA 4ZIRB 1DPFA 4D3SA 3RTAA 2C5HA 2HLDD 3QPUA 4YJ3F 3D1VA 1YJCA 2YJ5A 3HJGA 3OBIA 4GQAA 4GM1A 1U3CA 5AM0A 3E7FA 3SY8A 4EHBA 5CEJA 3QVLA 3MJCA 4MEAA 4RJIA 2ZBUA 3WWYA 4IJUA 2BLNA 3A58B 3PC8A 1GGMA 3DUWA 1NDUA 2VDQB 2WG2A 3QVUA 4MR7B 3OD1A 2ET6A 4Y9TA 2WF5A 1CUYA 2LXNA 1PR5A 4IV8A 4CQNA 4TL8A 1D4AA 4OI2A 3Q88A 3HYTA 3FYSA 3SD7A 2QA5A 2GEFA 5ERGB 1X1EA 1S96A 1MAUA 1IEWA 3ISJA 1MB3A 2JAPA 3QVVA 2HSZA 1ICIA 1UAGA 2R60A 4PYNA 2C61A 2ZJ5A 4ZOBA 2H4HA 1OX4A 1P7CA 2NZYA 1VPDA 2YV3A 3FI0A 1OH6A 1KE2A 1AXRA 1KU0A 1Y82A 2A0XA 5K20A 5F1OA 3T3OA 1PTJA 2E4YA 3QNUA 1I2ZA 2VG8A 3W5CA 4KFSA 4O2LA 5GP1A 3GK3A 4ZALA 1YB1A 1VIYA 2XUPA 4TLBA 3RYFB 1RM3A 3VBEA 1BAPA 4HLCA 2VTEA 1IQPA 3DE5X 3TQIA 2ZYUX 3K1TA 4JP8A 2X23A 1NXSA 4R9SA 1Z7EA 2GEVA 2Q2NA 3QKUA 2AK3A 3DLHA 1HZJA 2EJCA 1QGAA 1X7DA 3R0XA 2RKWA 1XZPA 2ZYRA 3AV0B 2G08A 2PYZA 1N2HA 3KKOA 3D02A 2CJYA 4B8WA 1W49A 1SU6A 3F49S 4MWBA 2R11A 3OO0A 1U2SA 4MUIA 3LKBA 2HT6A 2IQIA 1Z4PX 2CLEB 1T8SA 1Y6GA 3D1LA 3WYDA 4I5EA 5L3SA 3EEQA 1M1XB 4AYWA 3OZ7A 2OP0A 1IBSA 2HEGA 2HHAA 4D98A 5TSDA 3OFND 3Q8LA 3MD9A 1QOQB 3O4HA 3B3AA 3OEYA 4N4AA 1JMKC 1XVLA 3HFJA 5KVAA 3OE1A 4MIOA 3DVRX 3U60B 4C5BA 2V9CA 4HT3B 2W70A 2FSPA 3E4DA 1TK2A 1YA8A 5BYJA 3ADOA 3RYHB 2RHLA 3WGGA 4JQZA 1N5MA 5KTYA 3R7NA 2QN7A 2R6R1 3DM9B 4KO2S 4E14A 3RS8A 3U3MA 5IANA 3WMXA 1T34A 4CG1A 4YGYA 2H4YA 3LW7A 5IH3A 4TWZA 2FX3A 3DBVO 1IHOA 1RMTA 3ZWXA 3EVBA 3WGIA 4G0MA 5EPOA 2WMDA 1NDQA 1SCIA 1ID8A 4TYQA 1JAHA 2I4NA 1EM8B 2YOGA 4R9NA 1CVIA 1CZUA 1QMGA 3WJ2A 5M7EA 2PV0A 4TUYA 1QHNA 2PUAA 3QI7A 1JU3A 1Y3AA 3SYKA 8AT1A 2P65A 1GSIA 1MF7A 1T2FA 4OKSA 4BVLA 4MLDA 4O63O 4Q19A 2QX7A 3PQ5A 2HRCA 1EXVA 4QBTA 2FRDC 3AZPA 3MTJA 2PE5A 3TLBA 3HZRA 2NVUA 1MJHA 1WCWA 3TLAA 3RRFA 3NHPA 3KHSA 2F9MA 13PKA 1AE1A 1KZGB 1PHRA 2PS3A 3KKLA 3H9EO 4HAIA 3E9DA 4EGCB 5JNRA 3N2IA 1BWRA 3QYFA 1HT3A 2ICAA 4JJ7A 3FR7A 4BKQA 2GPTA 4UM5A 1T1EA 4Y2GA 1RVV1 3ZU4A 1GN8A 1EHCA 2X2FA 4C4PA 5H70A 7GPBA 2OAP1 1EHIA 4Q7KA 3LK6A 5C7OO 5AXCA 1CUFA 3HNPA 1GDHA 5GZ1A 3ITNA 1YZQA 2C7VA 5LQCA 4PLHA 3SX0A 5I7FA 5KUTA 3VR0A 1Z0UA 2ZPAA 3RAFC 3BZWA 5K9ZA 3HVKA 1UP7A 4NDZA 5TMBA 1ZONA 2ZKIA 5ALDA 4JR2A 3LMKA 3QM1A 4B3GA 3C6YA 4D6XA 1MO4A 1FP6A 2JCXA 2PGLA 3C8MA 5C52B 2AMFA 1XF9A 2H52A 5ER6A 4CCAA 3LVQE 4CCYB 5BN4B 1L8OA 2PU7A 1G8YA 2VHXA 5AW1A 3G2PA 4OHZA 1PDOA 4P3NA 4EF6A 1BE1A 1X7XA 5KYXA 1IOZA 2ZPUA 5L53A 1AGXA 5JVDA 3OUZA 4KZPA 4C30A 3TVTA 4L9SA 3C16C 2JJ2A 1D0SA 2WA1A 4DR5B 1FRQA 5J2UF 2BHLA 2ORIA 3AM4A 2CDRA 3CB4A 2YHBA 4DCNA 3EOZA 3L9XA 2ZWMA 2VRWA 5JCJA 2FJ0A 3NCTA 2OBFA 1R0WA 3AEUB 2RCYA 4AF8A 3SAJA 5DDIP 1V8FA 1YZHA 1ZGCA 4LYEA 5IXSA 1O89A 5C35A 1Z8FA 1HGXA 5AW4A 2AC7A 1RKVA 3NOVA 1TZ2A 4G5GA 4M76B 3G59A 4D97A 1VPLA 2XNJA 1FVFA 2ERCA 5KQPA 2Y0EA 3C43A 3RSFA 4RH0A 5F23A 1V9LA 2OG1A 1ZXBA 3R7DA 2GPAA 2XCIA 4UQPA 4E2XA 4HAZA 1G8JA 1P9LA 1QR6A 3ZDAA 1NAIA 2IWRA 5MFZA 1WF6A 3L0DA 5K0NA 1QSGA 3W6PA 721PA 4GOLD 2B92A 3AR9A 2EKZA 3KOXA 1NJFA 5DX8A 4ZQFA 1RBMA 1CRWG 2JIPA 3FAZA 4YRLA 2IQ5A 5G2OA 2GJKA 2QBYA 3WGZA 5JU6A 3FY4A 3RE1A 2F8SA 4EO7A 4L3VA 1B43A 5F21A 2PIDA 1E99A 1FFEA 3F67A 3NHSA 2J07A 4QBIA 4CL3A 3HDYA 1TEZA 5K3DA 4WY8A 3KUKA 3Q3EA 3UGQA 4JCCA 2IY7A 5FNVB 4AJHA 2R6DA 2FW9A 3DDHA 4P4GA 3L5KA 1Y5RA 2VHYA 3R09A 3OKFA 4NJEA 2QV7A 1U31A 1D1TA 3KOWA 5KSWB 2JFFA 2R66A 3J7AC 3GPLA 5CURA 1NX6A 3T1OA 3FKJA 3PGLA 3TCKA 1E4YA 2R8ZA 2OFXA 1TQ2A 1CS0B 3F5DA 2WYWA 1QYRA 2JLBA 2J9YB 1ONPA 2AN4A 1Q50A 1N3IA 5AUQA 5ELLA 1DKOA 1O4VA 4DJ5X 5H9WA 1YD7A 2HMYB 1I2BA 1GA1A 3D59A 5A1JA 2BCJQ 1JSCA 4CMJA 3GJ5A 3KZXA 3OZCA 4IIYA 4WHMA 1E4EA 1U7ZA 2V65A 2F6RA 3B53X 4IJQA 1WTAA 2WLSA 4QJIA 1QRRA 1SOMA 3JVEA 2XF2A 5LP6C 2I4LA 3IP3A 2FPSA 3VH4A 5K3SA 2JLAA 2HK9A 2M1XA 4JYBA 4GSYA 4WFIA 2W2OA 4LOJA 5HX7A 3IXQA 1R37A 3Q12A 4HBZA 3TVDA 2WUWE 3WB1A 4AO6A 3HK2A 5GPBA 3RSSA 3DF9A 2FETA 3AUTA 4I14A 2H4ZA 3OD5A 2W2PA 1C7EA 1UKBA 4N7BA 2OO5A 4GKAA 4IDPA 1G3IA 1TA4A 4I9GA 4NE7A 5T4EA 2Q3LA 3FM9A 4ZYXA 3E84A 3DLBA 1Y37A 1X1RA 2A7QA 2R7LA 4CQLB 4EHLA 4EYOA 4ZMRA 1ZA1A 3QX8A 1KJZA 3WL3A 1T2AA 3KOMA 1I2MA 2HHLA 1F8YA 1LSOA 1M2OB 4OBWA 3GW8A 4UU8A 2HU8A 1J42A 3CNLA 4GMXA 1D2AA 2ZETA 3KNZA 1KC1A 4BX8A 4O4LB 4NECA 1RXVA 1DADA 2O0HA 2IH5A 4FB4A 2TRSB 4JB2A 1E8NA 4NV0A 1EVEA 2PJZA 2YWGA 3RU9A 2C84A 1XZFA 4NJOA 5K0GA 3DP7A 4YA6A 2AK2A 2A9FA 2C4HA 3MM4A 5AICA 1N9GA 4FMPA 1OXSC 2XPCA 2X19A 4LHVA 4M21A 3ZD9A 3EWAA 4E6EA 3TXYA 5D84A 1SUIA 2GMWA 1V5WA 2GN4A 4O2BA 2AJLI 5ADHA 3KSBC 1PUJA 3FHTA 3HVHA 3JZIA 4LRUA 5HTKA 3ZV7A 4I4NA 3DEZA 4QDZA 4V0RA 2ECPA 1ULHA 4IHJB 4MYUA 3UH0A 3K9GA 2MR5A 5K8IA 1CF2O 4XJSA 1Y42X 3JQGA 1DKRA 1BZYA 2F3RA 3JXEA 1AGNA 1ZNYA 3R6GA 4TWAA 4BRZA 1M6YA 2B5WA 1AQUA 2VLBA 3BWEA 3HPRA 1A98A 4JLDA 1ZRMA 2CNOA 4CM6A 4YUWA 1TJ5A 3P7MA 4YREA 5KU7A 4MO2A 3U6KA 2HSEA 4RA9A 1GNQA 1I3MA 2WMOB 4NU0A 3ZQ4A 2LE0A 4Q9HA 4GUDA 1D03A 4L51A 2VRCD 3DD1A 5CYOA 5IKEA 1PEYA 1DRVA 3V3KA 3BKXA 3Q98A 1MB0A 1G8MA 4XIYA 4OQDA 2B6NA 1NBAA 1VBFA 3R7LA 1WHSB 4OHOA 1B4DA 1HNWB 4I3GA 4Q3LA 1EM8A 2OLKA 1QGOA 2ZYSA 2VO1A 3B20A 2P9YA 1DUVG 4FE4A 2FZ4A 1VRCA 2VJDA 3IPRA 1EVZA 3R40A 1KSJA 4HNHA 5IK2D 2I80A 3I1FA 4PXAA 3WDLA 4G0YA 2FE4A 4NC9A 1QGED 2NAFA 3IMKA 4JC8A 1OBFO 4MW1A 2E37A 4U3JA 1B14A 2HRDA 5JFTA 3MOSA 2BZSA 1II8B 1PZNA 4ZQHA 3R7AA 3WDSA 3PV0A 4PLZA 5BWLA 3ZUPA 3R24A 2Z4TA 1ZYUA 2UYOA 5FUQA 1NLFA 3L7NA 3H7IA 1A2OA 1F5NA 1YB7A 5FTMA 3DL4A 5ISMA 1ZVQA 4HTFB 4M22A 3VR2A 1KVTA 2OLEA 1OD6A 1S4MA 1YC5A 1N32B 4U8HA 4I55A 2W43A 3BM5A 1WTCA 2XZDA 3MYRA 1E3IA 4V2IA 1QQAA 5JDCA 4AC9A 3CLVA 3QTTA 4QNMA 2CLIB 2UYYA 4M0DA 5BSRA 1XZBA 5J4LA 3F6YA 1HDCA 3H2IA 1L5KA 3K9BA 2C94A 4M0UA 4MQ6A 3IDAA 1Q92A 4JS0A 5FEMA 4FKZA 3ZXIA 2VDVE 4L6CA 4NS4A 1GCAA 3NALA 1XYYA 4CUZA 1MAHA 4EPRA 3HYNA 1F6DA 2W2NA 4Q7MB 5L51A 2WIKA 2BOVA 1UADA 1YA6A 3FWYA 3I0ZA 3K2EA 4XR9A 1QIMA 4GPIB 1A4RA 3GJ8A 1IATA 4ZDIA 1DC8A 1TKBA 4OX9B 1U02A 3UXEA 4AX4A 4LC9A 2D8MA 1E60A 1IE3A 4GYWA 3U17A 5GOZA 3VTKA 4Q1AA 4G6ZA 3ZZNA 5F2KA 1W0JD 2WAXA 2GARA 1YDFA 3B2NA 1P91A 1ZD2P 2IEDA 4MRSA 5L7WA 4PY2A 1DKUA 4A6XA 5FAKA 3E18A 3FNIA 3EGCA 4DBLE 1KRXA 2QG9A 1HE1C 2BGWA 4HB0A 4EFDA 2PH7A 3AG6A 2YIMA 1YFKA 2EBHX 3P0FA 3KJEA 4RHUA 3PT9A 5KX5B 2ZEJA 4EY7A 1DDGA 3KHTA 5BR7A 2IDKA 2GI4A 4MKXA 2GJ9A 1GFIA 1RWXA 2QNRA 3TGPA 3J80A 2O2DA 3D6AA 2R8OA 3TJZA 3WZLA 3P8ZA 5JECA 2YH2A 5LZ2A 2AJ8A 4DG8A 1XZHA 3DE4X 4EKGA 3ILSA 4OQEA 1ZD3A 1NU8A 3PSAA 2Y93A 1YBHA 4FFWA 1NUTA 1U3GA 4MWSA 4J90A 4KN9S 1MPXA 1PI3A 3B1YA 4IDQA 3IR5A 2QT1A 3N2KA 2PXCA 5SZHB 4PTZA 4L3WA 1ORTA 3E3AA 4ZAZA 4J3NA 4EGSA 4BGUA 4QOGA 4KU4A 5KNBA 5EJ9A 4JB3A 1PRYA 3C4JA 1IULA 3ML1A 3D81A 3JCZA 2IP4A 4MJLA 5FA5A 3ZIDA 3EARA 2JLCA 4ER0A 3GRCA 2GHQA 4IMRA 2NUTA 1GXSB 3ESQA 3ICQB 4Y9DA 3H0KA 2G83A 3DAOA 3HCRA 3GFPA 4B44A 4BGIA 1K9VF 3WFJA 3SVTA 5TF0A 2WB4A 1ZH2A 2JIRA 3ZY6A 3JZAA 4P93A 4Q00A 3MILA 3QGMA 1GV1A 1XMJA 3AJAA 3CTMA 1BJTA 1N5JA 4DFDA 4PAMA 4ES6A 4UULA 6GPBA 5I9IA 1QYCA 3ACDA 2OFWA 4KDRA 3MJRA 3DA8A 3NUZA 4HX2A 2NZ8A 4ML3A 1VZ3A 4HVLA 4AK9A 3EVFA 2O2YA 3ND5A 2WYHA 1V7QA 2P11A 4FHFA 3LSYA 4H0NA 4EKDA 3HJAA 1O5OA 1F20A 3ND7A 1PL8A 1T5HX 4G24A 2GZSA 1QUEA 2E6UX 4CIDA 3I2FA 3MD0A 4HPXB 1YRBA 4JYCA 5J63A 3HXTA 2QD2A 1SXPA 1U5BA 3BQNB 4YBRA 5E1BA 2ZQZA 3RT9A 4MPRA 2PUDA 4RCZA 1P17A 1OZAA 2C2YA 2P0EA 2X0RA 4WUVA 4AP9A 3UJDA 4B2PA 5ADUS 1GUYA 5CLIA 5H4GA 4II7A 2H1OA 2J0EA 2ZR9A 4AURA 2FFBA 2PZFA 4F11A 2VDRB 3KV3O 1AQLA 3E9EA 3OCCA 4FGSA 4U7JA 2OQVA 3SC3A 1MN6A 2AZMA 2XUIA 4HYQA 1DKQA 4M1EA 4EM6A 2W2VA 3HE3A 3NXSA 1R0XA 3GEPA 3E15A 4HXYA 5JYCA 1K68A 1WSDA 2G40A 3R5SA 1W36B 1TDJA 3QU4A 5BN1A 4B3RB 4BZWA 1H42A 5EIAA 1DTWB 2GM4A 3O93A 1DAIA 4FBMA 3RWMB 3ZU2A 3ZWOA 1T6BY 1G3QA 1OBCA 1GUFA 4B4KA 2ANCA 3CURA 3AHJA 2O8FA 2J46A 4RABA 4KO3S 3F5MA 3AHFA 4E21A 2JCGA 1XQ6A 4DQVA 3FNQA 3P5BA 2YYYA 4OB7A 4ZOEA 4P58A 3Q3VA 4ARZA 3CUKA 3PQ7A 4R1NA 1UT6A 2Q4RA 3MQ4A 1JXMA 4XI9A 3DEHA 4EMSA 3T7KA 1Z35A 4TN5A 3FOEC 1ONNA 1IDOA 2QI9C 3WRYC 5FBVB 4MLCA 5KTRA 3ZVNA 2I3DA 2QUIA 4OK6A 5E6UA 3N0VA 4OY3A 4WZAB 3GHYA 3SCZA 5LP6B 1V4VA 3I2GA 1Y3CE 5EAIA 5IC5A 2ZRAA 3NGXA 4QOIA 1EK6A 1QVRA 3BH0A 3EVDA 4ZO7A 3RW9A 4AUMA 2IPAB 4NDNE 3TD6A 4XCXA 4B4DA 4BRWA 1SCNE 2CY0A 2GTIA 2QK4A 4B5LA 4EECA 5AI4A 1JPJA 4E08A 1RXIA 2IZ6A 2XKAA 4WNCA 4AJPA 4F2DA 2YW9A 2J5RA 1LWOA 4L0CA 5FX2A 2C7QA 5DK6A 5IYZA 3OOJA 5K0BA 2H7VA 5EXSA 1P6XA 1ZPDA 2AG8A 1WQ3A 1QGUA 2NO4A 2XD9A 4Z4IA 4QQKA 4BKRA 4CKEA 1GFSA 5FT9A 1Z62A 4ZCTA 1GAXA 4YP6A 2OCGA 4L0QA 3QG1A 4KXLA 3KALA 1FVHA 1EFVB 4FFBB 2WI8A 2ETXA 2MINB 3OZWA 4JBWA 1UXGA 1M67A 2YJ4A 3R7SA 2GT1A 4LNAA 3IP8A 5BYAA 3W1WA 2AZ4A 4LJSA 5BSMA 3KJZA 2FR1A 4A8JC 1IJKA 2RG1A 1XDGA 4TYMA 5K09A 5SZIA 3ZHSA 1DCKA 3KOYA 4R40A 3HBFA 1U3UA 5F76A 4NPCA 2M6KA 2CMFA 2HJVA 4G23A 4LHEA 1V96A 4PFKA 1LWNA 5EPUA 4OI1A 3FE2A 3HGQA 3L1HA 2WTXA 3KSAC 2I1WA 2AOTA 5DH9A 3I2KA 4MWOA 3S29A 5PGMA 5KDDA 5J5CA 1PZGA 1G41A 1XVUA 2AKYA 4Y2RA 1RWOA 2Q9AA 4UAVA 4G5OA 4D9KA 5ALZA 1XZAA 1LPNA 2IKQA 1P0PA 5HNKA 3ZBQA 4N1AA 2AUTA 3IVGA 1JHMA 2CC2A 1OT3A 3R3HA 4IYRA 4N9WA 1WDTA 4NCNA 1N5IA 3L7CA 2ZBQA 3R77A 3GRUA 3GWGA 4LV5B 5FJJA 1GRRA 3TI7A 2FMHA 2YL2A 4YUVA 1FFHA 3OQNA 3H99A 3NW9A 4MPDA 5HIIA 5LVAA 3LPLA 1YK0A 1DCTA 1J24A 3ILVA 2OORC 1O3YA 4D3ZA 2V6MA 1OR8A 3IAS6 1G9SA 3AF4A 4TZKA 1JKFA 2CXXA 3KE9A 3CLUD 4YDRA 4F56A 4JLMA 4YC7A 1Z6YA 4ZKEA 2XUGA 3ID6C 2R79A 4JXKA 2FEAA 3BG5A 4UMFA 4Y2VA 4TV9F 2EJBA 4HC4A 5E1MA 1RYHA 4QPJC 1P9NA 3WGJA 3CRQA 5BWCA 5FWXB 1NG9A 2IH2A 4M7PA 4CTKA 3HL0A 1RBZA 4D4HA 2XYPA 4DMMA 2D0DA 2A5YB 1XJQA 3BF8A 3GY0A 2D13A 1SRRA 3UT5B 3PX7A 2ZRJA 3O5AA 4MRRA 2HA2A 3RVLA 1QJ4A 3HG7A 2ZI6A 1P0QA 3N8KA 2ORYA 1JBEA 1U4NA 1AS3A 3KKKA 4OKNA 2BMFA 2NUAA 4Z2YA 3KDPA 2IK8A 2Q0SA 2FH5B 1WBJB 1VLZA 4BJ5A 3B9BA 1X3LA 3Q3HA 1DO0A 5EVCA 4YT5A 1T3TA 2WNSA 3A1EA 4JUIA 3UXMA 2CB0A 1OFGA 2XA1A 4KGDA 3QFCA 1DU4A 1RYDA 5BV1A 1RJGA 1M2KA 3FHOA 2J6IA 4LDJA 5D6OA 5DBOA 4DG5A 1Q0TA 1CP3A 2OZVA 3ED5A 3E2IA 5TS2A 1I7LA 1VL8A 4TKVA 1QQ7A 3A4MA 3QWAA 3HJCA 3FWZA 1O96A 3EISA 1WM1A 2DAPA 4QT0A 1DC7A 3MRXA 4ODIA 4R8SA 4WKPA 2Q1XA 1H66A 1KQOA 4LTNA 2KPOA 2WZQA 4IDFA 1Z3CA 4ZFNA 1P5JA 1T0JB 4FYPA 1CQPA 4LSGA 1U63A 4B2LA 2H17A 3PXEA 5FQOA 2C5BA 3GBPA 3WVNA 4N48A 4GU5A 5I7VA 1KAEA 4I9HA 4DIBA 1XG5A 5EHNA 1QH8B 4YRSA 3D7NA 3F4KA 5DGHA 1ZKDA 1Z5UA 3DM5A 1BWPA 2P3SA 4QGBA 2EW8A 5DI3A 4JLWA 5HJ2A 3PC8C 2XGOA 3WLIA 2V74B 3RK1A 2AW3A 2OZEA 3ANNA 3PQDA 2ZRHA 5C4IA 1G21A 3KYCA 4C1NA 1HT1E 1EIZA 5CA0F 5IT9A 3P9ZA 1DTEA 4JBXA 5D1NA 2I6UA 3D3JA 1X38A 4ZARA 2VPWA 2IIVA 1UOOA 4QDOA 1L8QA 1J0DA 1QH9A 1E1CA 1H0SA 4PWYA 5J1TB 1SZDA 4EAAA 5HWSA 2BPOA 2B78A 3ZU3A 1H6CA 4FFSA 5LLDA 1C30A 1NA5A 2X6TA 3OFJA 4CL8A 2KM1A 1AMNA 3R4CA 4QLBA 1EEHA 3AJEA 4HRVA 3DMGA 5HQ3B 3R41A 4RKEA 4TS3A 4WOBA 3KTAB 5KAPA 3ZBPA 4N76A 5FWYB 1RI4A 1G2OA 3A4LA 1SVWA 4Y6SA 4LDPA 5TIIA 5IWAB 1KVUA 2I54A 3NHKA 1HTBA 4QICA 3B1WA 3FSEA 4CM7A 2UYCA 3ICEA 3LE8A 1EP2B 2WVJA 1CZHA 1LSUA 5DTRA 1MO5A 3A32A 5ITWA 1X1DA 2PRIA 2VNIA 3ANLA 3T5GA 1XNRB 2Q1UA 4D9EA 3C1TA 4HMOA 4PBRA 5K2OA 1SXJE 3ZEIA 3G5LA 4B7XA 4EELA 1TD1A 2PANA 3D3WB 4M9SA 1JTVA 1G5FA 5JQWA 1TUBB 4J0CA 1QQ6A 3PTZA 1TYCA 4WXEA 2C5GA 4NH4A 1JDUA 1FU8A 1J09A 2J9GA 3JQGB 3L6EA 4RM3A 5CFPA 1BJKA 1T1RA 2ZT8A 3LDAA 1AKWA 5DGDA 1N2EA 3AFIA 4D3XA 4DA4A 5IPFA 1ZITA 5EKDA 5H5JA 1NE2A 1TJYA 2XVZA 1OLUA 3ESXA 4N0EA 5E2IA 1ZR2A 2A5DA 1M54A 3IC5A 2D1QA 4JB8A 4QD3A 3L93A 4W5HA 3SJUA 4A1OA 3KM0A 3TMKA 1N1MA 2QXYA 1IVSA 4B6OA 4J16C 4HUQA 4ZZ0A 2BP7A 4KOAA 1V1MA 2WT9A 2JVKA 4CM4A 4X64B 1C9NA 2P67A 3C14C 3G6KA 1EVLA 4FJ2A 4HBGA 1Z2DA 1E7RA 1K06A 1SVKA 5BSFA 1Q1AA 2J30A 4LWQA 4WTOA 4ZAXA 1WB4A 4DT1A 2WT4A 5MGBA 4CIWA 3Q41A 4ZV4A 3GEBA 2X0DA 2QU7A 3H2GA 1O94A 3GDWA 3LCMA 4P80A 2NADA 2D5LA 1UJBA 1FLNA 2M6SA 4WBSA 1KO5A 4DIDA 3THRA 5BQXA 1P77A 2C8LA 1SKMA 1DWUA 5A03A 3HMKA 2DB3A 4K0RA 4CE6A 2REQA 1ZMXA 3I39X 4J2HA 2JB9A 1ITZA 3FBGA 3H8SA 4W9NC 1J9ZA 3H2JA 4X41A 4U6SA 4DC9A 4QUIA 4JLJA 2YRWA 4OXIA 2W2KB 5AKGA 4BC0A 3DF7A 4PLPA 3P2OA 4GPEA 5LB2A 3GVHA 4AIIA 3TFQA 1FYXA 4R3WA 1T6YA 4RXMA 1N0VC 4J16A 3EHDA 4J2TA 4DKXA 4DAEA 1E6LA 1FUIA 3HDHA 5KQMA 4BAGA 5AVWA 1EAYA 3QLUC 3IULA 1M1YE 2VNJA 3KWMA 4GBED 3BK7A 4IDBA 2VPIA 3AHDA 3I4CA 2VWHA 3FSRA 3GCXA 3NDPA 1XX6A 2OV2A 4U2GA 4CIYA 1U9JA 1T1GA 1W48A 2FPPA 2J3HA 2O48X 2Q21A 1KZ7B 4F8EA 3A4VA 1H22A 2IOQA 2W2MA 3V2GA 3GP5A 1II0A 4Z7NB 5DCLA 5C8VA 5J2UB 2V7EA 3T35A 2EV9A 1C0PA 5F1YA 1IY1A 2PZJA 3BAZA 3RVBA 3SGLA 4RULA 1QP0A 1J2TA 1FP1D 1NUUA 1N4DA 1QO7A 4E5DA 2ZRFA 1OOEA 4JUAA 5TPWA 5FUBA 3I6BA 1L1RA 2C97A 1ZWKA 1GNRA 3JYNA 3K5WA 3MAAC 4Z3DA 3ZCSA 4H7JA 3B12A 2KI5A 4PR3A 1A4UA 4FCTA 1QM5A 2I34A 4ITRC 3C45A 1TTQB 2QMQA 3GHHA 3RC2A 621PA 1ZW6A 2JGRA 4BFSA 2WVGA 3HB0A 5ITZB 3LQ2A 1U3WA 3B9QA 1RCTE 4OLJA 4N5NA 1UJMA 3HA2A 3L7LA 1NI4A 4RMNA 2I8CA 3N6XA 4MB0A 5EIWA 1X1BA 2JI8A 4QU9A 4MVJH 3NHAA 4MRAA 2DC1A 1S8FA 4IRUB 1TCBA 2RAFA 1UEJA 2JA1A 3HJRA 3MCVA 1V48A 4M7RA 2J5QA 4NYIR 2HDNB 4Z9YA 3TNYA 3WYBA 5CDSA 3ZEAA 1GNSA 1JDJA 2R8BA 2DULA 3H42B 1V11B 3OFNA 1OWOA 4JJIA 3RUIA 2NXNA 3OMLA 1VMIA 2CDCA 1TVEA 1ZFNA 1GVHA 1SBTA 4LVCA 3F78A 2GWRA 4LWPA 4ALKA 1APBA 4HNAA 1H5UA 3BHJA 1I6KA 1UZMA 2X6RA 2G77B 2RK4A 1HEYA 3OH8A 1Z17A 2I6FA 3ONFA 5E7QA 4ZI2A 4DBLC 4K2HA 1GYPA 4IR7A 1WXQA 4BMNA 1UMCA 3E7DA 2HUPA 4TQGA 4Z4FA 3AFMA 4CV0A 3RM3A 4PPQA 5EC8A 2HWKA 1R10A 2AC4A 1IFXA 2J45A 2XUOA 3HYCA 4NG5A 1VG0B 2HSGA 4NP6A 2WE8A 2WHYA 4AS3A 1DLJA 1G2PA 1B0PA 1KMHB 1PWXA 3NEAA 5CM9C 2FP4B 3D7SA 4KR2A 2V9ZA 3AJDA 1U3FA 4DMCA 1J4AA 3MS4A 4BX3A 2BELA 2A0UA 5M5BA 1Z2PX 2XMQA 3WMWA 3IQDB 5IP5A 4QOEA 4QQNA 2W2QA 3RLIA 1JQAA 3M2PA 4DQLA 2HPZA 4Y30A 1VMDA 3IMGA 3QWFA 1O58A 1DRWA 4KDEA 1A9ZA 3DE7X 4MVJF 5THKA 1IBKB 5AVUA 3GLHB 3ANXA 2I3GA 4PZLA 4LYJA 1ZM3A 4H2DA 2VTBB 2O8VA 2QTGA 1QVAA 3DCNA 1O5TA 3GGGA 4HX5A 2VDNB 4Y3UA 4YT2A 5C18A 1KWKA 4KQFA 2YXDA 3LA6A 3VGPA 2AXQA 3F7NA 4OQFA 2QN9A 2VEOA 2A0WA 1QCYA 1MC1A 2HK6A 2WD9A 1RDFA 5E4TA 4D99A 3UPUA 3KR0A 4KFUA 3UPTA 1SCQA 2I1VB 3VU0A 2PJRA 3OPNA 2DFTA 2J0SA 4A4DA 1ESCA 2Q62A 5B7PA 4MI3A 2C2XA 4A91A 1VKRA 3I4FA 4N6GA 2EKQA 3GA7A 1C3LA 4L8VA 1P1IA 2B4KA 3OCJA 3BE5A 2HLDA 2H08A 4B7CA 4M9ZA 2QL7A 3TAHA 1R0LA 1BMDA 1AIPA 5L4SA 4AKGA 2C3YA 3KUDA 1QH0A 2FSSA 3DFUA 4HSEA 4FOPA 4IL5A 1A8IA 3THOA 3CNEA 3NTLA 2GN1A 5FFFA 4ZI7F 2IVZA 1VBKA 3LHDA 2HYIC 1GQRA 5L6LB 3AFHA 4WVFA 1T2NA 3KKMA 1M66A 3LCUA 3ZBUA 4B75A 1Q0PA 5ALOA 1U1FA 2Q5CA 3PRKE 4DLPA 1NQVA 4F60A 1XAJA 2J3IA 3LDFA 4BECA 1UC5B 3EF0A 3B78A 4TL9A 4RXTA 1ZVVA 1E1QA 3GIDA 4WPGA 1FDRA 1J2JA 1K8RA 1PFVA 2WOJA 3HXLA 4ENTA 4G8DA 4DYVA 1R3UA 4IIXA 2NO7A 1DAEA 4LDRA 4TVKA 5L3ZA 2FPGA 1I3LA 3RTBA 2WHPB 2DPMA 2EATA 1MP0A 1UPTA 1T13A 4MVJG 4BU0A 5IEJA 2Q50A 1Y4UA 4FSHA 5EE5B 2IHBA 2XB9A 2YMMA 1RI3A 3ESRA 3GO4A 4DMLA 3U09A 3TLKA 4QU5A 1IWPB 1R16A 3BJIC 4FJ1A 3VNRA 3GMDA 4WLNA 4N39A 5LDDC 4KPGA 2WWHA 4DJFC 4RMJA 5KS2A 4CKYA 2H16A 1GSOA 1XZ8A 4FFRA 1IDN1 3KYIB 1KSGA 4AVYA 5HE8A 1AH2A 5DHSA 3UWKA 4A73A 1Z16A 3EYAA 4N5HX 5HFNA 4AXXA 3JD1A 4XGKA 3CH7A 4ROSA 4HG2A 4RGVA 3Q7PA 4MHOA 1LDMA 2GVDC 2RAPA 3FYTA 4IQFA 4L5YA 3A06A 4TSFD 4RE6A 3LPNA 1OU4A 1RSZA 4R3UC 3ZGNA 2HREA 5LOVA 2WIFA 1X7ZB 3V4ZA 2ZUTA 4FHGA 1E3EA 1KAOA 1GO2A 2O6HA 2OV8A 4BJHB 4TZ6A 4OMUA 1JHDA 3R9WA 2P30A 4BNLA 4MUNA 2EFJA 3GEHA 3ORFA 3V1KA 2O5EA 2Q46A 5DASA 1Z8NA 4ONEA 1FXWA 3CX3A 5KOIA 4HNQA 4MJ7A 3QKRB 4KZKA 1AMUA 1OILA 1UXKA 3P2JA 1E96A 1MO2A 3CR8A 4G1CA 4LDNA 1JEJA 3OP1A 4LGYA 2ONJA 3X3HA 4RPCA 2FYTA 1Q7BA 4MUBA 3ONEA 2C2MA 1SUDA 4RVGA 2I8LA 5CFMA 2G06A 1OYWA 2IP1A 2J08A 4LMPA 4R2MA 4DEVA 5CXSA 2XCSB 1D2GA 1TLLA 2AWOA 3NHRA 3GOQA 2FWJA 1DARA 4HZGA 2I91A 3LKZA 1JUDA 1U2ZA 2MDTA 2P4SA 3NANA 4DS3A 4ZOCA 1RACA 2QRPA 3BDVA 1TK9A 2YRXA 4NRDA 4NNJA 4X92A 4BO8A 5BSGA 1WDLA 4P5DA 2GVNA 4MMXB 1TVMA 2YVKA 4Y9SA 1E2PA 4O4LA 1SHUX 1B2LA 4WEOA 4X63A 3B51X 3OT4A 3MHTA 5DXJA 4A0SA 5ED4A 2JPDA 2AYXA 2EXXA 1TZJA 4OQMA 4QXQA 4KQGA 1G7TA 1SVMA 2VCHA 5FNVF 3MIIA 4CVNA 3JQ6A 4NL4H 1P1BA 1R9NA 5HDQA 2ZDHA 4QYMA 5HUHA 1O0BA 5KDLA 4FWBA 4KTVE 3QLJA 4QNNA 4XWKA 7REQA 1BC5A 2CHVA 1FUUA 1RE1A 2NO0A 3QFRA 2QTCA 3PLRA 5KQLA 1XKLA 1PR4A 1AUQA 4FZ5A 5DCUA 4EEXA 4F8JA 5HTOA 3D0QA 5ARCA 3A4IA 3PI7A 5JWOA 1CIJA 3FFWA 4GKJB 3EAFA 4YX9A 3KL2A 1Q0SA 4TYWA 4HAOA 1PJTA 4IJVA 2XUQA 1XL1A 2F3SA 4XUGB 4MROA 3Q8WA 2W4QA 5K1ZA 4AKTA 2E4WA 5KB3A 1VCIA 1H1LB 2O3RA 4FUTA 5T64A 2GR9A 4AN0A 3DZFA 2O2EA 3P1JA 2CUTA 3IO3A 4GX0A 1FRVA 1UPUA 3U4GA 5EZYB 4QYXA 3LYAA 4OU4A 2C2GA 3CG0A 2LDXA 2GO1A 4M9RA 3UPDA 4DWJA 4EUSA 5ELMA 2ERYA 1XA3A 4AZWA 1J8DA 4MR9B 1UXIA 3AUXA 3LUBA 1NPTO 2W11A 1U0SY