1OXSC

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
352
structure length
352
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, ATP binding protein
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
total genus 106
structure length 352
sequence length 352
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00005 ABC_tran ABC transporter
C PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxsC03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxsC02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxsC01
2IYTA 5IP7G 3ZDQA 5KU1A 2BVNA 2RAPA 2A9KA 2O8DB 2FGJA 1GFIA 3A1SA 4JI1Q 1E0JA 1ZU4A 4TN1A 1N33Q 5JSZB 2A19A 2B7CA 2F43A 1UBGA 4LJZC 1KHIA 2ZROA 5FBQB 3DM5A 5LMUQ 4DR7Q 5JS8A 1DAKA 2O8FA 4JC0A 1EIYB 4ITRC 2P67A 4POAA 2ZIAA 3SHFA 2CDNA 3IHWA 1JAHA 3T34A 3AP3A 4DUGD 1S72A 4PV1C 3RWOA 3FMCA 4NCIA 5FJ8G 2YWEA 3LWUA 3VX3A 4IDQA 1QVCA 1Z0IA 1P6XA 1XMIA 2FPLA 3LQQA 2BMDA 2UVQA 3T15A 1U81A 4TYYA 5FUWA 2FG5A 1OXTA 4JI8L 3B13B 2BEKA 2K4KA 4FIDA 1QZGA 4IEIA 2KHJA 1SHZA 2J0VA 3LBNA 4IFBA 3UG6A 4QRHA 3EZ6A 2IL1A 4AI6A 2B63G 3HYTA 2YVUA 2HHHL 4MRVA 1U94A 2ASBA 2D06A 3KZ1E 3EZ2A 4TKOB 1EESA 4DR5L 4C3ZA 2Q9CA 2ZREA 4PC7A 1CKEA 2GTPA 4HB0A 3GTGH 5JEDA 4GZMA 3W1BA 1I3QH 4LHZA 4KYUA 2VNUD 5M3FH 2D0PA 4QL5A 4WJ4A 2A5DA 5J4KA 5JSZA 4B3ML 1GUAA 4AKHA 4LFBQ 4ZDWA 3RS3A 1GO3E 2GCOB 3WDNA 3UPUA 5TB5A 1QHGA 2WJYA 2TMKA 1NMGA 4NXNQ 1HNWL 1KDTA 1XZPA 4O3MA 5C44H 2O0HA 1XTRA 1X6VA 2OBLA 2IX1A 3AVUA 3CCQA 2QP9X 4XOIA 4PMWA 1U9IA 1KY3A 1FX0A 4IOMA 4OI0A 3M3YH 4HB3A 2WWWA 4II7A 4OHXA 2ZJ8A 2G0NA 1NBMD 3HOXH 1OHHD 4DR2L 1W36C 4CT4B 1W49A 3LGJA 1EFTA 3PV0A 4A3LG 1GNPA 1SVIA 1YZNA 2YOFA 4DT1A 1ASYA 1AE3A 1JNYA 1NJIC 3CF6R 3P26A 5C0XH 1V43A 3B9PA 3ZZ0A 4EQ5A 4LF4L 1QHSA 1G16A 1XMJA 1IJFA 5JRZA 1X1SA 3MGCA 3C16C 4B3DA 3CZQA 1NVWQ 4EFMA 1VYVA 4KVAA 4BRUA 2ZITA 2JLZA 2ID0A 3UE1A 2GEUA 4OQXA 1E9EA 1IHUA 4CEJA 2B3GA 4H0LC 1KTVA 1P3JA 4R1JA 4Q9LA 3BXZA 2DR3A 2ZYUX 1XMVA 4IFDI 2OTLA 3U7EB 2HYDA 2E76C 2HLDD 3OTOL 3TEHB 3M0EA 4AYBG 3O47A 1C4OA 1KRSA 2FV8A 2MSCB 1SVSA 3ADDA 3OE7A 2ERYA 2BWJA 2GRJA 4HLUA 3VU9A 5GJBA 1TUIA 2PI2E 4Q4HA 1G19A 2EJMA 1IYJB 3M85A 1RZ3A 2G3YA 3LLMA 1PH1A 4X8LA 4XVRA 5C4JH 5A5GA 4LYAA 1FGUA 1OSNA 2XNDD 4YXWA 4XWOA 1Z6XA 1T4GA 4JI2Q 3KTAB 1OHHA 1Z06A 4PHHA 2GESA 2KBFA 3KF6B 3BERA 2H17A 4TLBA 3VMFA 2WTUA 4B44A 5AJWA 4JI4L 3SE0A 4QY7A 4P4TA 2Y0SG 1UKYA 1QVFA 3CW2A 2P0EA 2WP8J 4JI3Q 2W2XA 3ZJYC 1KIMA 1J5EQ 1M1YE 4GPTA 2YJTD 3OESA 5CIWA 4O2LA 1B0UA 4Z54A 1QVRA 3S15H 5IP9G 1KO1A 1Z29A 1CJTC 4LV8B 4AQYL 1FJGQ 3W6PA 3MG9A 3ZQJA 4LHVA 1EIFA 1ZNYA 2D2FA 1E9DA 3EIHA 3TMKA 4V0NA 4X65L 2H5EA 1XRJA 3A1UA 1PLJA 3QXXA 3I32A 3ONWA 3FHWA 2V1UA 3KFVA 2KWIA 2F7SA 2CCGA 4N3NA 2JLUA 3U7HB 2HF8A 2Q2IA 4GP7A 4JOIA 2EWWA 4BECA 4OO1I 3K9GA 5IYDH 1AKEA 2Q3MA 2YYZA 4QQBX 2VPPA 5IDVA 2H16A 3RRMA 1P2VA 4C0BA 3U3OA 4AYBE 1E1RD 2LWIA 3OAAA 1DG1G 4LW1A 1N2CE 2WSMA 5M5WH 1GRRA 1W4CA 2XTMA 3J81k 3OTOQ 1HR0L 4PZ6A 3HJNA 5DISB 3GLFA 1M8PA 1NF3A 2AX4A 3HYRA 5CK4A 4A82A 1JECA 1PHJA 2V1CC 1MRNA 4QHYA 4EDHA 2DYKA 4A4DA 4BFTA 4LNQA 4HZIA 2A2ZA 1ZC4A 4B2PA 3J81j 5UKDA 3UATA 1G8GA 5J47A 1E1TA 1Z6HA 4OO1H 4KSCA 1KAWA 3C4JA 4ARZB 2QU8A 4PFSA 2CHGA 3PCOB 4JYAL 1BYIA 4F92B 2H7VA 1E2QA 3RWMB 1NBWA 1N5IA 3IQXA 4GI7A 1QF9A 4OQNA 2ONJA 2R7DA 4JKIA 1EX6A 5IYBG 2NPFA 3CRLC 4HAZA 1K83H 4B3MQ 1CBUA 2H18A 4OQFA 4V0ME 4R71A 1S96A 3TS2A 2JJ8A 4C7OA 1FNMA 4C30A 3IGFA 4OHVA 2PNHA 1E2EA 1WJJA 2CCZA 1VQNA 5HCIA 2UXBL 1T0HB 4TZ0A 1N36Q 1MRSA 1YZUA 1KKLA 4ESHA 3CCSA 4RFSB 2PNRC 1RW4A 1HQYE 2RGNC 1II8B 4R2HA 1NY6A 3W6OA 4L9SA 1T3LA 4HAWA 1PLLA 1A5TA 2C8VA 4P4SB 3GPLA 3F5FA 2RHMA 3DHWC 3IIJA 1XMOL 2Q8IB 4WBSA 4QNMA 2VP6A 1CS4C 4BFWA 5JI2E 1U90A 2XXAA 3A8IE 2AUKA 1OLOA 1Y8NB 4PANA 2BM1A 4FI3C 4D4JA 3G6EA 5IYCH 2A6HC 4L8JA 4ARZA 1UE1A 3KJOA 2CCJA 1E9FA 1M7GA 3LW8A 5JEAJ 1V9PA 1IY0A 1TU3A 1IJEA 4X64Q 1VCMA 4JLNA 2WB1E 2IYWA 3AQ4A 4DR3L 3W6NA 1GM5A 1ZD9A 2PEYA 2ZUDA 2QE7D 5G3YA 1YNXA 1ZYRC 4TQUS 3K0XA 2GXSA 3CRW1 2R6DA 1VQIA 2IEYA 1X65A 3B8HA 4DV1Q 3VR5A 4BFUA 2GEDA 1UKEA 2YINC 2Q2UA 4BXXG 3TH5A 421PA 1NVXQ 1W2HA 3CXCA 2NVTH 1A1VA 4IOKA 2VY3A 3QSYA 1Z0KA 3UK6A 5J4VA 4XTCS 2RGNA 3SBEA 1T6NA 4AYTA 1XP8A 1P7CA 4IDOA 5FI0B 3AKCA 3PVSA 4JMPA 3SFVA 1GHKA 5KUTA 4KLKA 3R7WB 4Q1DA 1XTIA 2QMOA 5FBWB 2WPDD 2I5LX 1HV8A 2HCJB 3GEHA 4JT4A 1Y8OB 2N78A 3CH5A 4QJ4A 5FFMA 4QOSA 3VKWA 1VYUA 3T1QA 1T3SA 4GOPC 4MDEA 4GNXC 2GDJA 1YJ5A 5JJKA 2J41A 4LFCQ 4EJSC 5A0FA 5BQ5A 4YMSA 4KAXA 4C2UA 3IFTA 2YWFA 4NYMQ 1KI6A 1XFAA 1KI1A 1KJWA 4JI0L 4IXMA 4DR6Q 5GJWC 1YNJC 3L2OB 2JK8A 3BE4A 4PHFA 3RN2A 1SROA 1Q1QA 2EU8A 1EQQA 3TW4A 2UXCQ 1PH6A 4M22A 4Q19A 4PTLA 1YU9A 3TRZA 4O0MA 4BRWA 3BG3A 2ZRFA 1IONA 2GXAA 1G64A 3GTKH 3X1YA 4B3RQ 1UAAA 1RRPA 2JA5H 3AEVA 2F1IA 4PSVA 1R4AA 3U3MA 5L8VA 4IQZA 5SZHB 2UUBL 4DV4L 3FHTA 1E2DA 5JHGB 3RS5A 2ZR0A 4MGKR 4A3GH 4DV6Q 2IHBA 1XDBA 2N49A 3DM9B 1NKSA 3EC2A 4JYCA 1GL7A 2BM0A 1H8HA 1QVAA 2K5UA 4EPVA 1QDEA 1VQEA 2ZQ5A 5LPNA 4JI5L 1A82A 3NEYA 1IW7C 1JXOA 3V4RA 3U3JA 4DK1A 2RB4A 3M4OH 4ACAA 3PITA 3SDZA 4Q66C 2ALYB 1R0ZA 3T5DA 2NZJA 1UE6A 1JJ7A 1YNNC 4LF5Q 1I4TD 3H86A 3K09A 3WP1B 4JBMA 1ZM7A 3NKVA 5JWRA 3GLGB 1N5KA 4KYIB 4BLPA 2LCFA 1YKSA 4X62Q 1FX0B 4M1WA 5J40A 1WOCA 1R2QA 2N46A 3QXHA 4WXRA 3MJHA 5IK2A 1SFOH 1U2RA 4JJKA 3DVLA 1IXSB 2JJ1A 4ME3A 2AK3A 4W9MC 3RRNA 3A8TA 3ZZUA 4KKTA 4M1OA 5E7MA 3PG5A 4AG6A 2PZGA 3KOJA 3ETLA 3C14C 3CBQA 4KV9A 4G0NA 4POGA 4D0NA 3HOZG 2XB4A 4DB4A 5HZHA 5CJ2A 4B3GA 2ZRKA 2F3TA 1WRBA 4OHWA 4BFZA 1PV4A 4Q03A 1E79A 3SC3A 3TLXA 3IPXA 1G7TA 3TVTA 4AWXA 2ZTSA 2QEXA 1IYVA 2JLRA 1JAIA 1H9SA 2F43B 1PH8A 1XNQL 1SULA 2V6IA 4CZ2A 1AQUA 4M9ZA 3SYLA 5FLMG 5LDDC 1HH4A 4B3FX 1B23P 2VLIA 1QRAA 4FW9A 3N2EA 4KLZA 2IS1A 2R6AA 1KNXA 2CNWD 5FUVA 2OV2A 5GJVC 5IWAL 4WW0A 4P31A 1J70A 2LKCA 2GK6A 3C7KA 4LF9Q 3VKHA 4ACBA 1Z6TA 2J45A 4UNNA 1CSQA 2BA0A 1E9AA 1ZM2A 2NQ2C 3EWAA 5JHHB 4HDQB 1Z6GA 1AGRA 2WJGA 3NH6A 5FUYA 3KQLA 3EPJA 4M53A 4LK2A 4GMDA 2C9OA 2VHUA 2IUUA 2OSBA 1H95A 3RLOA 3RAPR 2DWQA 1G7RA 5CLQA 3JVUA 1ODFA 3MUFA 4FWIB 5IP7H 4QG7A 1OT3A 4QFMA 4YMVA 4LOAA 3OEHA 1XZQA 3HR8A 3S24A 2CHVA 1E3PA 2BC9A 2WWGA 4PZLA 3JC66 5H8WA 3RR5A 3KL4A 1KQSA 4ZDJA 2ZTCA 5JEAG 1XNRL 4LFBL 1G7CA 2K32A 3CNNA 4V0OA 1XD8A 3ZVRA 3FMIA 3SGIA 1H9RA 4HUQA 4QBIA 5L3QB 3HWSA 2OM2A 2ZRLA 4BEBA 3SEAA 1VQ7A 4JL8A 1E2KA 3GLGE 2QSYA 2WJIA 4OK3A 4AY2A 1FP6A 3NXSA 1F2TA 2NG1A 2XZOA 4JBWA 1KJYA 4X62L 3E9IA 3PO2H 2F1RA 3N70A 3GTOH 3B78A 4B33A 4EJSB 1N6KA 3DO6A 1D2NA 4B47A 5JS7A 1Q21A 1VQOA 4P3YA 5L3SA 4KMUC 1NY5A 1PA6A 3GJ7A 1B8AA 5JZVA 2Q3FA 2Q2HA 2EYUA 4XVUA 4A6XA 4DPGA 3VNVA 1NMZA 3I5YA 2R44A 2QAGA 1JB1A 2FFQA 3SNHA 4V0KA 2IUSA 2BEJA 2R7FA 3TUZC 3EIVA 5DGXA 5HTKA 1UDWA 4M2LA 1S8FA 3OPOA 3B1YA 2REXB 1Q0UA 2PL3A 4FXPA 3MFYA 2GCNA 2N1BA 2ZSEA 1EWQA 2VO1A 2ZU0C 4N1AA 1O87A 2V8OA 1JR3A 3IQWA 3VX4A 4KHPL 1OB2A 5M04A 2JQOA 1NG1A 1RJ9B 2IWRA 3T1VA 4Q48A 4FMCB 1UEIA 3AVVA 4FWTA 4DV5L 1NBMA 2RMKA 4IXNA 4RVCA 1G8HA 2QZ4A 4M9SA 2J5XA 4HAXA 4IDNA 5GVSA 4PPFA 4H02A 4I81A 3AVWA 3STBC 3M7NA 1E9SA 1E2VA 4OWXB 4WAUA 3R8CA 1R9TH 1W0KD 1AZSC 4DC9A 1GZSA 3K9LA 4LHYA 2OG2A 1MABA 3K70C 5DLQC 3DPUA 3MAAC 4KU4A 3QE0A 4P4SA 1HR0W 3ADKA 1E0KA 4OX9Q 2VQSA 4BFSA 2VRWA 4JZKA 1KO4A 4A92A 1CTMA 2GJKA 1Z28A 2AXPA 2IBMA 4R9UC 2XGTA 2F6RA 4JLVA 1JEDA 5FOXA 4BE7B 5BYJA 1M7BA 2PLFA 2J7PA 4YWMA 5GAGC 5M3MH 4DV4Q 4KXFB 5LB4A 3W34A 2B63H 1YJWA 3AVTA 2QGQA 2I5MX 2R6FA 2WFWA 3PF4A 2GZAA 2ZYTX 2NIPA 3MMPA 2D4HA 4I1OA 1EYGA 1MOZA 2GXQA 3PFIA 1AQYA 1FL9A 3MWLA 2CK3A 3C5HA 3QOFA 2PJRA 2VSFA 1WE2A 3DZ8A 4FCVA 2WIBA 2J59A 3L43A 2NN6G 1UM8A 1SXJD 2ORVA 4FMCF 2EVWX 1XTJA 2PH1A 1US8A 3K0CC 1MV5A 3R7WA 2G88A 4AK9A 4DRZA 2HYIC 2P65A 3TR5A 2YC4C 3M1IA 1WYDA 1MO6A 4YMTA 2QN6A 3SN6A 3ULLA 1AS2A 3LXXA 2NZOA 2VSXA 2BKUA 1KNQA 1T3HA 4GOKA 3TNFA 5C46F 1XWIA 1S9HA 2B6HA 5K36G 3GTMH 2Z6KC 1JXMA 1TWGH 1QJOA 2Y8EA 4DV2L 5EE1A 1UADA 4HB2A 1S0UA 1ZIOA 2VIIA 1R0WA 4I7ZC 3QIAA 1PFSA 3GLHA 3L0SA 4A9AA 1RIPA 4D26A 2A6ED 5L3SB 1RRGA 3V4FA 3FMFA 4DIEA 1UE7A 3I55A 5FTNA 3FMOB 1OH7A 1JALA 2OAQ1 2WWXA 4NL4H 4NYJR 3R20A 3RS7A 1XJCA 5DO9A 1ESNA 4DBLC 3K0CA 3EQLC 4U00A 3PO2G 5LMNW 3EN2A 2CL6X 2ZETA 3T1TA 5DNYB 3TKLA 5BN5A 4A3LH 1R10A 2IYYA 3H15A 2ZM6Q 5JRJA 4DLXA 1F2UB 1Y14B 4DNIA 3MLEA 2HQLA 1P60A 1ZC3A 4HSEA 4A0GA 2Q3HA 1J6QA 2GXUA 3DL0A 3T5GA 1DG3A 1XPUA 2A6EC 1L4UA 4HLDA 5CITA 3Q85A 3CX7A 2ZE8A 5AUNB 3KYHC 2F4VL 2W2TA 4ESVA 4X64L 2X8AA 4CEHA 2BE5D 4TVAB 2UU9Q 5JI3E 1Q20A 5AK0A 3TUJC 5FI1B 3L8YA 3AQQA 2E87A 2QQEA 1YHBA 4RG1A 1P72A 3L0IB 4FD2A 4NHOA 3CX6A 4PC3A 2ZJAA 4YDHB 1TADA 4Q9KA 3WYAA 3RRYA 1G4AE 4QJ5A 1XTKA 3AB3A 2G1JA 4Q7KA 5BXQC 5EZ5A 3T1YL 1DXMA 5B58C 1S9DA 2VP5A 4LDJA 3QVUA 1S3SA 3FKIG 2VQEL 4HAUA 3EIEA 4DZZA 2OXCA 2FN4A 3R9WA 2C98A 4IRUB 4F4CA 1W4AA 1Y8PB 3E2IA 3AP2A 1YVCA 2QG6A 5KSZA 5IT5A 3O8DA 3QI2A 4JLDA 2GF9A 3VR2A 2N42A 4TZ6A 3IDQA 2VW9A 4JBKA 2UXDQ 1K8GA 2GN5A 3GJ8A 2GJSA 4W7SA 1OXUA 4MRRA 1VQGA 1FOEB 4ILEA 4QGHA 2OBNA 4R4TA 1X55A 2OCPA 1GKHA 2JA1A 1E9CA 4M1YA 3S1QH 2ZUBA 4LJ8A 3OHMA 1S1CA 4WZAE 3SJZA 1SVWA 4OHYA 4DLVA 2LSSA 1KI4A 2BDOA 3NE5B 1AS3A 3I8XA 1II9A 4IJMA 2VUMH 1T9HA 1NP6A 2F1HA 3WBKA 4GZLA 3U7FB 1JJVA 1IOZA 1TQ2A 2NVXH 4RZ2A 2CFMA 1CLUA 1VIYA 2IYZA 2ZPTX 4Q00A 1YIJA 4TYPA 2IX0A 3MXNB 4NXMQ 1SKQA 4FINA 3BS4A 4A0FA 1I94Q 3BU2A 1EWRA 2WOJA 2BIFA 2MO0A 1YR8A 1NSTA 4OJQA 4HR7B 2ZSAA 2HT6A 1FP7A 1WA5A 2ZRJA 1GRQA 1FVIA 4TSFD 5TARA 3HDTA 1N34L 1HA3A 3PR1A 4NMMA 3P32A 1HNZQ 1X6OA 1SN8A 1II0A 3UKDA 4TMTA 3IEVA 3IO5A 1N34Q 3RC3A 1O78A 4OI4A 2JEAI 2LMCB 1SMYC 2WAYA 3FPPA 1E4VA 2ZSDA 4PR0A 5FBRB 2XITA 1Y1WG 1D8TA 3D4RA 4O0AA 2NVQH 3PO3H 3B5JA 4C0QC 2JLVA 3K70D 3G48A 1YEZA 2BCJQ 2RHQB 4DUZL 3EZ7A 3WHLA 3EG5A 1E2WA 1WQ1R 2Z83A 4NB3A 3QEOA 2VL7A 4D0LB 1F6BA 3H0GG 2OCBA 4AQYQ 1FJGL 2ZI4A 2EJGC 3HOVH 2PEZA 5H1YA 3CCLA 1AZTA 3E9HA 4RD4A 2PMZE 1ZP6A 1HY3A 5C0XJ 1PH7A 4O25A 8OHMA 3HU2A 1YBYA 2C99A 5KNBA 1YI2A 4EPRA 2GVBA 3HPQA 5FL7D 1KMQA 2ZUCA 4TMZA 3P1JA 4UJ5A 3F1ZA 2RH5A 5K8IA 2X19A 4LF4Q 4UQOA 2JJQA 4BFYA 3SBDA 721PA 2JA8H 3AH8A 1IN4A 2IUTA 2JLYA 4NU0A 4M8NE 4IFDH 4BWYA 4B3SQ 4R4IA 3HOYH 2WOOA 3LV8A 4GS3A 2UXDL 1NL3A 1P4SA 3E1SA 3AGPA 3C41J 4X8MA 1DAIA 4DR2Q 4TSFA 3X1WA 5IK2D 4QM6A 4A3BG 1SE8A 1R6BX 2K5VA 1W1WA 4GMXA 3CPFA 1J5EL 4F93B 4HAVA 4BBSH 4JI3L 5M5YH 4PHGA 5CYPA 1FUUA 2W0SA 2CVHA 1XTDA 5CJPA 1O7IA 5DYIA 1VQJA 1L1OC 2FU5C 1VQPA 4QGUA 1E99A 2WWHA 3E70C 1EFWA 1Z7TA 1PH3A 1ZNZA 3B60A 5C0XI 2Q21A 3CNOA 4A2WA 2V1XA 4EQ6A 2GHIA 4R4QA 4WIAA 1SXJB 2YWHA 4HB4A 1NIPA 2A5FA 1L4YA 1Z3IX 1OYWA 1X56A 4GKJQ 4YMUA 1H8EA 1KI2A 4DAMA 2O52A 2J0QA 1W44A 2L15A 1EGAA 4EPYA 4DCUA 4A3FG 1XNJA 2V7QD 1U0HC 1VHLA 1FTSA 1FL0A 4MKIA 1F3OA 2Q9BA 3HPRA 3ND8A 5DE3A 5GJCA 3PIPA 3RHFA 3MWKA 1KK1A 1F48A 2F9LA 5KPJA 2JEBI 4RZ3A 3VR4A 1HZCA 2P5SA 1H8HD 4H13C 2C03A 3VR6A 2LXJA 4FCWA 1XNQQ 2GA8A 5E7NA 2VF7A 2XGJA 3I4MH 1OKKD 4P71A 2VA8A 4PO9A 3MEFA 4D4MA 3GCGA 4TQ9A 1ETUA 5SZIA 3CPWA 4LSGA 1K9MC 2WAQG 3T12A 1GWNA 3U4VA 1VPLA 1DOAA 1Z6AA 1JPNA 2QROA 2ZRCA 4LWCA 3RZDH 1IBML 2GJ8A 1NVVR 3Q9LA 5JCPA 1LYLA 1SVOA 4DK3C 1ZINA 1XEXA 2R65A 2X1VA 5EP4A 3NBYC 1LF5A 1G21E 2JGNA 3EPHA 4C2MH 1COWD 1QBKC 1YZQA 2ZE6A 2CW0C 1R0XA 4DLWA 4A3IG 1VQFA 3CQZH 1Q7YC 2BJVA 1RRCA 5FOTA 4A3MH 3AB9A 1N0VC 1Y63A 4M9QA 4JV5L 1XPRA 3TQFA 4PC1A 4TTPA 1Z0DA 2P6NA 4JLAA 3GLIE 3AP1A 2PX3A 3CLVA 4GP6A 3ULPA 4LHXA 4C0HA 1RFLA 1Q82C 2IHFA 1KDRA 1SGWA 3OEEA 4YHHQ 4B3BA 1G3MA 4KO8A 4N0DA 1UKZA 3A74A 3THXB 2DFKB 3U60B 1CXZA 2FEOA 3SS8A 3BD9A 3HOVG 2GKSA 4DIDA 2HLDA 1Z08A 4QL3A 1IBKL 5FL3A 2Q0HA 3G4SA 1MABB 4ZIRA 1OH8A 5A4JA 2F3IA 4APVA 5K8UA 1EQRA 3H3VH 4B75A 4LF7Q 1E32A 4JI1L 4BEJA 3HOWH 2IXGA 4JI8Q 4D4KA 4NTZA 5EP1A 5FBVB 2VYFA 4JSTA 4UKDA 1JB7A 1PYSB 3TSOA 4ZIRB 1W46A 4L5BA 1FQJA 3RSOA 3Q7QA 3BH6A 2VHCA 1E7ZA 4U02A 4MDFA 2OEPA 2IF2A 1A0IA 1NN0A 1BOFA 3KKQA 1DCZA 1SRUA 1MO4A 3B6EA 4UNRA 1G41A 2ZSFA 1P16A 3BJUA 3T1HL 4TLDA 1C1YA 1N9WA 1NSFA 1KAGA 2ZJOA 3EXAA 4ZI3A 3K0EA 4JVMA 1ONLA 2DUDA 1LABA 3ZVMA 1BDOA 3RNLA 3I4LA 5EAYA 2PBRA 3LNCA 1KK0A 3R8FA 4CGZA 1CRPA 4URWR 4DDVA 3AF1A 1A4RA 4R4OA 5ELXA 4TLEA 2FA9A 3IUYA 2F1MA 4BA2I 2D2CC 4YY3Q 2Y0SE 4JG2A 4DR4Q 1DVRA 3L82B 1IAQA 4GBMA 4IW3B 4PSAA 1VDZA 1NVUQ 1YHAA 3HU1A 3VTKA 2QRNA 3MRSA 4OJKA 3WHKA 1G5RA 2ZS7A 3LNNA 1NLZA 1OIXA 4NCNA 1M2OB 4GOPB 1LY1A 4TMXA 1G5PA 2G9NA 2YHSA 3A4NA 4DLUA 4LX0A 4TQAA 4X66L 2A30A 3ZQ6A 1EWHA 2NO6A 4Q1BA 5KOYA 2VH5R 3LFUA 4RCNA 2ZI7A 2V4ZA 4ASUD 1KL9A 2BKEA 4NYIQ 3AFPA 2NMVA 1L2FA 5EP2A 4OWWB 1AKYA 4XD7D 5EZ6B 1BS1A 3CCUA 3KDSE 3IO3A 2KJQA 4BY7H 1PH4A 2DGYA 1E94E 2AK2A 2GF0A 2C35B 4A4IA 1ZM4A 2AKYA 2OAP1 3NBFA 4HZUB 1EFHA 5EXPA 1T8TA 2IYXA 5KPDA 1W36D 1GITA 1CR1A 4TYWA 2FF7A 5TY0A 3PSIA 1C0AA 3BFVA 2RHDA 2VL6A 1E2GA 2NO9A 2NZHA 4A3IH 2R6CA 5SZKB 3PXGA 1NJGA 4RSGA 4A36A 4DLTA 4GN4B 3I72A 1EWIA 1Y1VH 3HOZH 2KCCA 3G71A 3B1XA 3LX8A 4A3DG 1FW6A 1IM2A 2KCTA 1GVPA 3DMNA 4OK5A 2A68C 1YZ6A 2OQKA 2RF4A 2QPOA 2PZEA 3MSXA 3M4QA 4LZZA 4URYR 4AKIA 4NH0A 3A1TA 4OYHA 2FOLA 3D31A 1N8RC 1QHYA 4NP6A 1E69A 4MTNA 1OIVA 2JJ2A 5E95A 1SHKA 2IS4A 1VQ6A 4DSOA 4CYMA 4BZXA 1CI3M 2MNAA 1CKNB 3KJPA 5JJLA 1R7RA 2DY1A 1EXMA 5DHAA 4PZ8A 4DV3Q 4CF7A 1PMRA 2QGNA 5FOSA 3GLHE 2OUKA 5EXSA 3S1MH 4UP7A 3EX7C 2ATWA 3QPWA 2JATA 5JWOA 1K8MA 4LPKA 1YVDA 1OJLA 2QL6A 2WMOB 1VG8A 5IF9A 2A68D 1UWVA 1KI9A 3WNDA 4BUJA 3NDBB 1P73A 2UUCL 3EZFA 2NGRA 3KJGA 4C0AC 3THWA 4Q4HB 4MYUA 1WBBA 1LS1A 2E75C 4LJ9A 4PAMA 3KLRA 1I50H 3D8BA 4Q1CA 3KX2A 1E2MA 3TREA 4RD1A 5EE5B 1SXJA 4MYTA 4G5OA 3PUXA 4P75A 2NZ8A 3QG1A 4RCZA 1UEBA 1Q8KA 1U5KA 4LRWA 4LF9L 2K52A 3WXMA 1TPZA 3SOPA 2XNSA 3DXJC 2AR7A 2XZPA 2N8NA 5J5CA 5ANRB 2LKDA 3ICEA 1N0WA 1X1RA 4QKQA 1XCGB 3SJAA 2MMCA 3QJYA 2VS1A 2ATXA 2ERXA 2FX3A 2KSQA 1NBME 2JJ2D 3U58A 3HOXG 1GUNA 2QA5A 4RZXA 4AC9A 1T0JB 3REGA 2ZVPX 1VIAA 2WBLC 2F1JA 2GNOA 4HUQB 3VQTA 4LC0A 2CNWA 2V6JA 2IX3A 3REFA 3HKZE 3B1VA 4PG3A 5IRCD 1YR9A 4OQMA 5CB6A 4EIWA 3EBEA 1EUJA 4AYWA 2JXMB 4TTQA 3WNBA 1TWAH 4MUAA 1SVLA 1D9XA 1KI8A 1W48A 4JI5Q 3DLLA 1NIJA 2FPKA 2W83A 4M1MA 3GLIB 4JI7Q 2REBA 3EA5A 2DFTA 1KMHB 1ZU5A 2ORWA 3AF2A 3KQNA 3OFND 2W2VA 2OILA 4IOAA 3BB4A 5DIFA 1N6OA 4LUVA 2MSEB 2R62A 1NN3A 3GTJH 5G40A 4A8JC 2O8EB 1G8FA 1YITA 2PQAB 2PCLA 3M4PA 2ZJ2A 4I4LA 5GADl 2A78A 3PGZA 5K36H 1K0RA 4GN5A 3L8ZA 2MFIA 4FCTA 2JLSA 5H68A 3CD6A 1HJPA 4ZCLA 1E4YA 2PCJA 1IBLL 2K7VA 621PA 1A6XA 3T53B 2XOKD 4DNRB 2J0SA 2GAOA 3EIQA 1VHTA 4OL0A 2FZ4A 4UXHA 2DBYA 2ZI3A 2H92A 1O7LA 1DE0A 2UKDA 4PZZA 4LJ4A 4JI0Q 4X8OA 1N3BA 1M34E 2EFDB 4HLQB 1P2UA 3PUWA 4MRPA 3IBYA 3PEYA 2O8EA 3RVBA 2BA1A 2ZE7A 2J7PD 4DSUA 3TZUA 2B7BA 2IYVA 1XD2A 1S4QA 1HE1C 3RN5A 2WZQA 5DHFA 5LBIA 3I73A 2GJAA 1KOFA 1GD7A 2J9RA 1A7JA 2Z0MA 3AKDA 3LXRA 1N6RA 4IKEA 3S2HH 3A37A 4UNQA 2D3WA 3RS0A 1JR6A 2QI9C 3T1HQ 2A6HD 4C3HH 5KSPA 3KKOA 5F9FA 1KK2A 2FDCA 3QXJA 1MIUA 4L4UA 5AUPB 1PH2A 4R7ZA 2VSOA 2PX0A 4WZBE 3EASA 2JLWA 3U44B 1AIPA 1NI3A 4TL7A 5D3MB 3AUYA 2MMGA 3CRVA 4HJAA 2B8FA 3OIUA 2BHRA 1IY1A 1J7KA 1CIPA 2KBEA 2PPBC 2FFHA 2KI5A 1G3RA 1UF9A 3BFXA 4DUYQ 5EXTA 4DEYA 1N25A 2AUJD 1G6HA 4BLRA 5B2ZA 3U4ZA 2DNEA 1VQCA 3A5UA 2ZRIA 4Q02A 2L5TA 3VAAA 4AG5A 4W5JA 2ZAOA 3GJ3A 4HJ7A 4BXXH 2K5NA 5FOUA 1BYUA 2CL7X 3ZD7A 2WIAA 3IHLA 1P9RA 2HHHQ 4IFDJ 5JWHA 2ZJYA 5M5XH 2V4DA 3FKSD 3GTQH 1T5IA 4JV5Q 3I4OA 2GBLA 2R92G 5IY0A 3BB1A 3J80c 1K8AC 4ON9A 3U4QA 1NLFA 2PZFA 4PHTA 3AF4A 3ZGXA 1MT0A 1CRQA 2O8CA 2VUMG 3SQXA 4RCYA 4M1SA 1D2MA 1OXVA 4LC1A 1GDDA 1TF7A 3V9PA 2Q9AA 3SR0A 4DJTA 3N6RA 5LD2B 5JCZA 1CKOA 1YHQA 1WDTA 4LYFA 1WCMG 1XXHE 4URVR 3GO5A 2N3SA 4RFSA 1VQBA 4N0EA 3BORA 4DSNA 4YCWA 3CCEA 2QE7A 2E1RA 3AVPA 3NH9A 1KYIA 4W5HA 5FTJA 1GTVA 5BW8A 4DLYA 1M6NA 3GFTA 3P4YA 2EQBA 4W5WA 5GADC 2JJ1D 2OFOA 1K6MA 5GAHC 3AKEA 2VHTA 3K80C 1KRTA 2VP0A 3KKNA 2WHXA 4XWAA 3K0FA 4B3TQ 4WA7A 1DTSA 3CRRA 1VQMA 3WMEA 3BB3A 3DM3A 3E0EA 2WAXA 1ZUNB 4S35A 1LB1B 1U0LA 1DAHA 4D82A 3T56B 5CYOA 1ELOA 2HJVA 2ZEJA 3QY0A 5FPSA 3R9IA 3GLGA 4FMDB 4QC2A 2EJFC 3OYYA 1P9NA 4JYAQ 2XJ9A 4BLQA 2XTZA 1CTQA 3FKIH 3NHBA 3QF7A 4E07A 1G9XA 1LTQA 5CDFA 4BGDA 2ZM5A 3CMAA 3HKSA 4Z1MA 2DNCA 2VP4A 3CF2A 2VBCA 1I5FA 4GOPA 2ZRBA 2KHIA 3CB4A 3H0KA 2EFEB 3KB1A 1Z6YA 2ZRPA 2L0XA 4A3JH 2IEZA 2WVJA 1DAGA 4PC6A 1XX6A 1X54A 1ZCBA 3LBHA 5FBLB 2ECKA 2BMEA 3CO5A 3KKMA 3FFBA 4URUR 1XU4A 2J3EA 1G20E 3U50C 1CJKC 1AS0A 1KO8A 2J87A 4Q4AB 4AH6A 1O3YA 5TV2A 1VG9B 5CLLA 1E2JA 4IFDG 4HJ5A 2ORIA 2ZRNA 3O8BA 3HOYG 4QGFA 4JBXA 3RANA 3SFZA 1W36B 5FTMA 3VDYA 3CMEA 1LM0A 2HCBA 3NVAA 1FQKA 3W8RA 4B2LA 2H5XA 4A75A 3CRQA 1PUIA 2O8BA 2JA7G 2J1LA 3S2DH 4HLCA 3QKSB 3UXMA 1CEEA 5SZJA 1Y3AA 3H3VI 4HIDA 3G5UA 2K33A 5GROA 2R7ZG 1I2DA 4M1KA 3FPAA 3S1AB 3BGWA 3PF5A 3N5CA 3A0JA 3NTUA 4A93G 3FWYA 2VF8A 3KFUA 2Z4RA 2WM9B 5CM8B 1W7AA 2A5JA 2G0TA 1Z2CA 3QENA 4PQRA 1G291 1LVGA 4TT3D 4M1TA 521PA 3FYHA 3LH5A 3D3QA 5FPYA 3T06B 2YWGA 2UZ3A 4JI4Q 1RIFA 2IHEA 2AXNA 3K0AB 1ZMXA 4A3GG 2HEIA 4LJAA 3KUDA 3CRKC 3NBZC 2WWYA 4BLSA 3ZLJA 1Y1WH 1ZRHA 2PLRA 4A3FH 2RCNA 2VTKA 2VP9A 5D3QA 4B74A 1RL2A 1VMAA 4LYHA 5E3HA 1Q3TA 1HEIA 3RLFA 3I62A 3STBD 4D0GA 3H0GH 2GILA 1HH2P 3I4MG 3SZRA 4K81B 1Q90A 4BBRH 3K0AA 3MCAA 4GDFA 2CLSA 1VKJA 4BPBA 2GWHA 2OLJA 3KLWA 4JLKA 4U7DA 1QHNA 1TX4B 4RY2A 4HATA 1I94L 4DHEA 2ZRDA 1WB9A 3L2PA 4NXML 2CMKA 3GJXC 2G1KA 3OEHD 1XEWY 4KKUA 3HU3A 4NCJA 3W8NA 2REOA 1CKNA 1DELA 2AFHE 4Y0AA 2GEVA 4DKXA 1XNRQ 4G01B 3NG1A 1Z63A 1E2ZA 1JJGA 5AJVB 1TU4A 5H1SE 4M9XA 3OOCA 2CKZB 1R5OA 2GBLC 1N32Q 4MKFA 2YTVA 2XSZD 1XJVA 1JEEA 3I8SA 2AN9A 4UNPA 2DN8A 4Y0VA 3THYA 2HUPA 2IYUA 1FPMA 4LV6A 1Z8FA 3MWYW 1SMXA 1J8MF 4JYBA 5HY6A 4ZKEA 3T61A 3TUIC 3FOZA 2K5HA 1XD2B 3CCMA 2IK8A 3BIFA 1TXYA 1GOTA 1YE8A 2ZS9A 3FTQA 3THOA 4JS0A 3KFXA 3OZXA 2ZYWX 4WZ6A 4A3MG 2CLCX 4JVNA 4PAOA 4BZPA 3Q8XB 1MH1A 4D25A 5EUQB 1OH5A 2GZHA 4HJ8A 1ZBDA 4K8OA 1YR7A 1V1QA 3AV0B 4GOJA 4Q1EA 3KQUA 5KSYA 4J15A 1G6OA 3LAWA 2NTYC 2QQ0A 1K8OA 2E2HH 3AUXA 2B8TA 3KUCA 1BBUA 3RZOH 3LVRE 4HZUA 4NYMR 1W5TA 3C8UA 4QGAA 5C2JB 3P4XA 2QMEA 3JVVA 1VCNA 4TTRA 3CPHA 1W47A 2ZRMA 4JLOA 1E9BA 4WVFA 2WWIA 5LMNQ 2IXFA 4A3JG 3RC8A 2EVBA 1AM4D 3D7MA 3S16H 2FFBA 4JLJA 1Z47A 2ANBA 1QHHA 4ZDIA 1TQDA 5B57C 1L1OB 1Q46A 1NN5A 4YC7A 2XEXA 2WKQA 1E1RA 3OAAD 5L3VA 4DKAC 1QZXA 3ULJA 3HOUG 1ESMA 4ZCIA 5C4MA 5EJEA 2AWOA 4IVQA 3CW2C 4LV5B 4ALPA 1IQPA 1NRJB 2IWHA 2V9PA 3LO5A 4OONA 1QG4A 4PXAA 1OB5A 1ZAKA 1G8PA 2ZJPA 1OW3B 3KB2A 4URZR 4G7OC 1X3GA 3EWSA 1VQHA 4A2QA 3BK7A 2MSDB 1V5WA 5HGQA 1ZD1A 4IOCA 2QTFA 4O2RA 3CPEA 1YQTA 3UMRA 4DEXA 3VKGA 2A3RA 3SQWA 2QP4A 3KXKA 1L1OA 3CF5A 2BE5C 1ZUHA 4QIWE 1DO0A 1NMFA 4HIKA 1XCMA 1JQJC 5EXXA 5BR8L 1G4UR 4K0KQ 1YRBA 4B32A 3TSWA 5BN3A 3NENA 5CDFE 1OYYA 4A1FA 4P0TA 4A3CG 1DAEA 2ZRGA 1VS0A 4MZ9A 3UDXA 3H94A 1BKBA 3UE0A 4LF6L 2HXYA 3W9YA 4RJLA 3AF0A 4KITB 1GAJA 1I4DD 4MKHA 4LBZA 1S2MA 3GD7A 3W1GA 4LF7L 4Q9IA 1JI0A 3ZIAD 4BY7G 4DK0A 4Q47A 4HDOB 3Q8DA 2RGEA 4XH9B 4JK1C 3SHWA 2ODEA 4ZV4A 2R93G 1CUKA 1HZ9A 4A8JB 4G5SA 2SHKA 1IN6A 2CE2X 3PEVA 1N6HA 2B8WA 3OIWA 1GHJA 3B6YA 1E1QA 2ZJQA 3QBVA 4XSGA 3UG7A 2V3CC 4PAQA 4Y7NH 3F2BA 1WP9A 4B3CA 2YTYA 4YY3L 4YXWD 4DLSA 1HQCA 2RGGA 3BBPA 2B29A 4Q18A 4TMKA 4M4SA 4CDGA 3QXSA 2ZSBA 4LJ6A 5IT9c 1P8LA 1T8UA 5FL7A 4C0LA 1EFRA 3UIEA 1NVVQ 3QKRA 4DLZA 2QBYB 2JE6I 3CCJA 1KI6B 1PYBA 4POFA 4Q21A 3BJIC 1UBFA 1PJRA 1ANKA 1RRFA 1MO5A 1SXJC 2YNMA 4YMWA 1Y1VG 2CEAA 4DCTA 2CQOA 3VHLB 2WKPA 2VHQA 4BASA 3SYNA 1D2EA 2FNAA 2O8DA 1Q3HA 3BWDD 3LLUA 4TYQA 4DDTA 4D4LA 1QHHB 1ZD8A 3I56A 2C5LA 4DVGA 4I1VA 4YWKA 3IEUA 4IVRA 4ZO4A 2EIFA 2QORA 4X6AH 2BJWA 5FR2A 3BOSA 2C77A 4DV7L 1GUOA 3C15C 4LUCA 4M0LA 1HNXL 1TNDA 3SYKA 3W5OA 1IBKQ 4JT2A 4B6FA 1TWCH 4NBSA 4A76A 4KFSA 3TQYA 3LDAA 3U3RA 5JECA 3IRBA 5C3EG 4YHHL 4AD8A 3GLHB 3QNUA 4EFLA 5HR5A 3J81i 4LUOA 3CWZA 1ASZA 1I6VC 4DAYB 2E5LQ 1SXJE 2G77B 3LY5A 2JIZA 1P61B 3KQKA 2A7QA 4DWJA 5GVRA 2QAGC 2XOKA 1U8ZA 1YRAA 4JBYA 1LTLA 1W0KA 1U99A 1JR3E 3NIBA 4EPTA 2I4IA 1E2HA 1P75A 2ASEA 2ZYVX 1OTCA 1G8YA 1NN1A 1YZGA 1TUEA 3HP1A 1G3UA 2GJ9A 2J0UB 4P73A 3CRMA 5BWMA 2FH5B 2OLKA 4BBSG 2VQFL 2QGZA 4JIMA 4H44C 3VR3A 3H1TA 4U5XA 2A5GA 3DZDA 1ZM3A 2I1QA 2P6UA 3PIRA 5E7JA 4B48A 5J4YA 1KO5A 4US0R 4KODA 4A3DH 4DUYL 3A7LA 4C3JH 1GJXA 1Z9FA 2CWPA 3GDEA 3OW7A 4XJXA 4FMDF 4G7ZC 2IHYA 3S1AA 1VQ8A 3VU9B 4RKEA 3FDIA 2ZTEA 1J8YF 1MKYA 2Z6VA 1N32L 4JI6Q 4DNTB 2WSSD 5BN4A 1TWFH 2XAUA 2ZVQX 3GFPA 5J4HA 1L7VC 3I7FA 2QMHA 4CEIA 1NTGA 1YJNA 4GT1A 2AWNA 4L5SA 1X3EA 2F52A 3BZCA 1CULC 4IPCA 5KNCA 1EFCA 3CIOA 1W2BA 1AGPA 4O2DA 2CL0X 3EPLA 4H9GA 4MYCA 2MO1A 2WAQE 5HKKA 2K50A 1XMSA 1Z2AA 3NBXX 4KBGA 4R98A 4E5UA 4EQ6B 1HR0Q 3MWJA 2UUAQ 3TR0A 1G18A 1BVSA 2E2IH 2RKOA 4LUZA 5FTKA 3K9NA 1VQKA 3U3KA 1IBLQ 2QP3A 4UJ3A 1HTWA 4OHZA 1K73C 1KI3A 1W2GA 1OF1A 3OIYA 2ZI5A 3CF0A 1NMYA 1I2MA 1UDXA 3I3SR 3EPKA 1LF0A 2DWPA 5JLJA 4DT1B 2OWOA 1TL7C 3VR1A 2D2EA 4A2PA 2ZANA 1CKMA 4Q4JA 4KN4C 1IN5A 1IN8A 4B2IA 5G53C 1W4BA 5A35A 2BDTA 2IYRA 3FKQA 4G3XA 4DLRA 4LBWA 5F98A 3B1WA 4KSBA 3RNUA 1KK3A 3GTLH 2OBMA 2E8GA 3OFNA 1KSJA 3OEED 4PX9A 2JA8G 4RKFA 1XXHB 2HDNB 3A8JE 1TF5A 5AJZA 4L8GA 2IYLD 3QUSA 3MD0A 1GKUB 3L0PA 4YDSA 1HNZL 4F38A 3PUZA 2I5HA 4DV0Q 3WRYC 4CW7A 1WBDA 1VCIA 5AWFC 4LF8Q 1YR6A 1XMQQ 4DV0L 1E96A 1E98A 2BOVA 1M1KC 2D62A 1XEXB 2GVZC 4FMBB 4HLUC 4MGIR 4DCVA 4Q7LA 5KYKA 2AMCB 3B2EA 1Q12A 3CM0A 1N6NA 4BY1G 4QHSA 1MKHA 1HPCA 2AD5A 1KMHA 5JMTA 3S17H 2XSZA 1A8VA 4P4UA 1UBEA 3FHCB 4KBFA 3TGPA 1HUQA 3S14H 3KTAA 2YC2C 1P2SA 5BYKA 1H65A 1IW7D 1JE5A 4OGQC 1R5BA 1YZLA 1DEKA 3TIFA 1XEFA 2C9CA 3RRZA 2CK3D 2R2AA 2IXEA 3CH4B 3HOWG 4H1VA 4GKKL 4JI2L 1F5NA 3NC1C 4LYJA 3ZD6A 1OFIA 4MITA 3UMFA 3FFAA 2WICA 3LBIA 4XVQA 2V54A 3K0SA 4C2TA 1E2PA 4E09A 2E74C 4B3RL 4GFDA 3HKZG 1G51A 2DCUA 2FSFA 2ODBA 1NY4A 3W5IA 4V0MA 1PLKA 3F2CA 1RPZA 4HIOA 2VHJA 5C4XG 3CAMA 2CVFA 1H9KA 1A62A 1IZ6A 3KKPA 4P33A 5IE8A 2QPTA 1AE2A 1OPXA 2HV8A 2XX3A 2ZR9A 4RD6A 3U61B 3H4MA 1NG9A 2IC5A 3M4YA 4HEJA 4DR6L 1AH9A 4M21A 1CFMA 1GKYA 3NEMA 2GETA 2GVDC 2X2EA 1K5GA 3TE6A 2ZR7A 5ELOA 1CJVC 4L9WA 1VF7A 1MO3A 1MR3F 1L8QA 1CR4A 4US2R 5L3QA 5K8TA 2IYSA 2WJJA 4TT3A 4L5RC 2ZJBA 1SR3A 1KD1C 1TQ6A 2OCEA 2ONKA 3QKTA 2IY5B 3U7GA 4A3BH 3M9BA 1SZPA 2BCGY 2BH8A 1OIWA 4BLTA 4DV3L 4DR1L 1J99A 2UUAL 5J4LA 1VQ9A 1J90A 2V7QA 3MJRA 4KFTA 4PQYA 3WWVA 5LD2C 3T35A 4EAQA 1K8RA 3B82A 3C5CA 1N6PA 3Q5DA 3AVQA 4XD7A 3S1NH 1ZYUA 4NCHA 3UMSA 4JL5A 3QPVA 1QZHA 2A1AA 1NE3A 1RKBA 3WBJA 4B3TL 2D0OA 2CHQA 4DV2Q 3ASZA 3I4NH 1I6HH 4BQSA 4JI6L 821PA 5JEEA 3UWKA 2MQHA 1EX7A 3UDFA 3GQBA 2W6JD 3T1YQ 4XWKA 3CR8A 2CJWB 4DV1L 4DUGA 2B8GA 4MGYR 5B64A 3KXIA 1UBCA 2QRZA 3LD9A 4DB2A 1Y69U 1X3FA 1ZIPA 1EG7A 4X66Q 4OI1A 2VZAA 1VTKA 3CKLA 2P5TB 2VQFQ 4KKSA 3GTPH 2ZE5A 5F2EA 3W5JA 3AVYA 3IPYA 3RSLA 1VG1A 4ASUA 4DXAA 2NVYH 1D7QA 1N5JA 4TMVA 3K09C 4IFEA 4Q9JA 1XBTA 1GL9B 2JASA 3A5ZB 1C9KA 4B6EA 5GQOA 1XMOQ 1G3IA 2JA6H 2QA4A 4ZKDA 1ZJ6A 1B9MA 1BO6A 4OWTB 4Q1FA 4D80A 1X8LA 3NDPA 3TW8B 1DD2A 2OHFA 1LS6A 1QG2A 4TL6A 5JBQA 1X3SA 1Z07A 2ZT9C 2KENA 1KHTA 3RDPA 1TMKA 4JKYA 4TYNA 1KXLA 1HNXQ 2YOHA 2JA7H 3UDIA 2AL7A 2W6ID 5LMUL 1E9RA 3NEJA 4KFUA 2ODWA 3JAMc 2O5JC 5J3BA 1RC8A 3AVXA 1BH2A 5FLXc 2GVAA 1AA9A 3THWB 4YCUA 2R9VA 5EQTA 4RFVA 5AJYA 4US1R 3HGBA 4A93H 5EE9A 2WWFA 4QGGA 4GN3B 3A58B 2WSSA 1E0SA 1XF9A 3UWOA 4YQFA 4PZYA 2OZEA 2GCOA 4K46A 4NDZA 3GLFE 1OE0A 1KKMA 1FUKA 3RABA 1TEVA 1AJEA 4IEEA 4JBJA 5KSOA 1GP2A 4JCVE 4C9BA 5HKKD 2NO7A 3DOFA 3QKRB 3RYTC 2H8KA 4ZDKA 1PH9A 1E79D 1YHNA 4IOJA 3AKYA 3ERSX 3I92A 2PMDA 1IXZA 2QAJA 4Q01A 3U2QA 2XTIA 2FWRA 1VQDA 2GK7A 1SVKA 2W6JA 1NLYA 3DDCA 5TXGA 3W3AA 1GUSA 1K5DA 2Z6KA 1KI7A 1Z0AA 4ABYA 4F91B 2XXAB 4OKSA 1N0UA 3TAHA 3JZAA 5KDLA 2ANCA 1XPOA 2KBNA 1TTTA 3KF8B 2IA5A 1I4LD 3TVDA 5FJ8H 4AKEA 4CIDA 3PENA 3D6TB 3I1FA 3LVQE 4A3KG 2FSHA 1H8ED 1VQ5A 1GILA 2OFXA 1P5ZB 1TEXA 4Q7JB 4S2EA 2ZXUA 2D7DA 4JL6A 3F0TA 3BC1A 4JLMA 3K7AH 1GNQA 1W0JD 3WMGA 2C96A 4TMWA 4F7WA 2WJHA 3HR7A 3B9QA 1D9ZA 2ES2A 3AYHB 4A3CH 1Q1ZA 1E1OA 1RVDA 2IS2A 1LACA 2YV5A 2HIVA 1TU2B 4RMFA 1IXRC 3ND9A 1Z5ZA 4NPSA 3AVOA 4PPNA 2E9SA 1DS6A 1FFHA 3CP0A 1QHIA 3Q3JB 4ERNA 3VHXA 1GG2A 4KJZA 4A3EH 2GAAA 2WMNB 3IIKA 4BFVA 1M7HA 1BBWA 2Q2TA 2YOGA 2A5YB 3JAMi 4LF6Q 2ZI9A 3W90A 1E2LA 3CX8A 2CBZA 2ATVA 4QBFA 4DDUA 4Y52H 5KDDA 2P6RA 1QVGA 4KHPQ 2ZS8A 4LBYA 4AYXA 1OKKA 4XSHA 221PA 1IBMQ 1T91A 4GL2A 5BR8Q 3PIOA 1EFUA 2JAQA 4HYYA 4MKGA 2NN6I 4L5TA 5HPYB 3AM1A 2FGKA 4GLXA 2EWVA 1DBSA 2XNDA 2RGDA 3ZVLA 4AIIA 1E22A 3ZH9B 3NWJA 3VNUA 3K8YA 4I1SA 1Z0JA 4GKJL 1XTQA 4ZPXA 2YZ2A 2ZRAA 5LMNL 5CIQA 2UUCQ 1WXQA 1EK0A 4WJ3M 4B34A 2NOAA 2D7CA 3F8TA 4I1UA 4L15A 4C3IH 4LFAL 4YWLA 3FKSA 4PO1A 5DI9A 5EUMA 3T1OA 3GJ4A 2XZLA 4IO9A 4V02A 5H70A 1H9JA 2DFLA 1YJ9A 3TS0A 4GSYA 4HDCA 3U5ZB 2O5IC 3LW7A 3WNCA 4MNOA 2OTJA 1UJ2A 3KDFB 2Q6TA 2PT7A 2QPAA 2A69C 2QAGB 5FPKA 1XJQA 3OE7D 4Q4JB 1X86B 2OQ0A 4E03A 4PC2A 3GLFB 3LX5A 1TQ4A 4MRSA 1RE0A 2QM7A 4IPGA 2JCSA 1N6IA 4GKKQ 1VG0B 2QY9A 3LA6A 4NONA 3T51B 1JT8A 4UXIA 4EJSA 1LV7A 1KDPA 1Q1BA 3F2DA 3A4LA 3TRFA 2PMKA 3A6PC 2BBWA 2EDGA 5HZKA 1HTPA 1CR2A 4DK6C 1IYUA 3KDFA 1JJ2A 1W5SA 1E24A 1Z0FA 4QNRA 1XD9A 4KCGA 1VQLA 4Q5IA 5C44G 1A63A 1S3GA 1X9NA 1U0JA 2BBOA 2WV9A 1B70B 4LGMA 1NKTA 3NC0C 2LXKA 1ZCAA 3OIVA 1BMFD 4CEIB 5EE3A 4KVGA 2O8CB 5IP9H 2CLDX 1XXHA 4LF8L 5AJXA 4DV6L 2R93H 2FE4A 1B7YB 1U8YA 4MGZR 1OH6A 2B92A 2EQSA 4TL9A 2YKGA 4B3XA 2KB0A 1NJFA 1JR3D 2BH2A 1QUQA 3J80i 1E2IA 3TJZA 3TBKA 2RGAA 2JLQA 1WCMH 2YTXA 1UPTA 4L5QA 1KGDA 4L16A 4BFXA 2C78A 3W3ZB 3LQRA 3U4QB 2EFCB 1VCOA 3Q5EA 4LBVA 4NYIR 1UE5A 3CCVA 4UXJA 1HE8B 3X1DA 4DR7L 3DKVA 4BA1I 1S40A 1JJCB 2WB1G 4IJHA 4B73A 1DADA 1Q57A 1X8KA 2BMJA 3VA7A 2IW3A 4Q4LA 3LRPA 2UUBQ 1AN0A 1KAOA 4A3EG 4MYHA 5HE9A 4LFCL 2ZAMA 1ZNWA 4LJ7A 1F2TB 2DHRA 1E2NA 3IBGA 1Q22A 4V03A 3WY9A 4HUTA 4Q7MB 5F9HA 1R0YA 4RD0A 3ZYCA 5DN6A 1RYHA 3BFKA 1V8QA 1E2FA 4LF5L 2G6BA 1FTNA 3KQHA 1D8LA 5HE8A 1G17A 2QM8A 1Q81C 5ELNA 2CE7A 3U9SA 2PCFB 2GCPA 2QBYA 1ZNXA 4PZ7A 4ZI2A 4JSYA 2I3BA 3Q7PA 4KHZA 3KF6A 5AJ3L 4IHQA 2F9MA 4JVLA 4TL8A 5DI3B 1TKWB 2RGXA 4WOPA 4B43A 5M3FG 5KDOA 1ZVQA 2BV3A 4TLCA 2X77A 3THXA 2AKWB 4B76A 1WFQA 2I1VB 2XB2A 6Q21A 4RZUA 1OXSC 2GZDA 2XTNA 3QBTA 3BH0A 1P62B 2W00A 2DWOA 2OT3B 3WYFA 1K3RA 2AFIE 4A8JA 5C3EH 1JBKA 3KJEA 1FZQA 2F3RA 5FPTA 3RLNA 1GUGA 1D6JA 1IBRA 1HT1E 2QUZA 4MQBA 1BMFA 2O5VA 3J7A5 2P2LA 1KDOA 4TWZA 5CM9C 2I0QA 3GEIA 2UU9L 1W3SA 1DARA 2R92H 5M3MG 1AK2A 3ER0A 5AR1A 3WP0A 5K8LA 5FUXA 3ADBA 5B30A 1N5LA 2WKRA 4FDBA 2NO1A 2VQEQ 3AFQA 4A15A 1KZ7B 2W6IA 1E1QD 2BMFA 1CJUC 5C0XG 2CXXA 2EFHB 1G3QA 1B9NA 1UEJA 2W0MA 1VQ4A 3QVVA 3O8CA 3KJHA 5P21A 2E5LL 3GMTA 2NN6H 1S3OA 3OW2A 2HJGA 1L0WA 2HT1A 5DI3A 2F55A 2FXQA 4JOIC 3FE2A 1OFUX 4UNSA 5D3MA 5IYDG 4UP8A 3NELA 121PA 1ZW6A 2ZI6A 2ZU6A 4LY6A 4PO8A 4PPGA 4MA4A 4P74A 5C18A 3ZIAA 1E3MA 3ZS9A 1G1MA 2FZLA 1JQLB 1EFRD 4QM7A 3IILA 1G6PA 4GLAC 1JPJA 2JEOA 1XB2A 1C9OA 3FVQA 2ZTDA 4DV7Q 3A36A 4GNKA 1QUQB 3X1ZA 5F3WB 1FMLA 1GL6A 2C2HA 3PEUA 2QENA 2JLXA 5HCNA 3ZS8A 4Z8XA 1Z83A 4CEJB 4G5QA 2E2JH 1Z22A 1Q1EA 1GRNA 1FYCA 1U9IC 4LI0A 4OO1G 4B71A 4ZCMA 1KIXA 4BBRG 4D2IA 3CC7A 3GJ5A 1HCZA 4KI0A 3K9HA 3BDOA 3P27A 5C4XH 1IL2A 5CK5A 2UXBQ 3PEWA 5LB2A 3ZZTA 2FEMA 3AF3A 4DR3Q 3K53A 2A69D 2FSIA 1VECA 3FMPB 1SKYE 3PUYA 1COWA 4GOXA 4JLPA 4QXAA 4DR1Q 4AURA 2R8RA 1ZM9A 4OK6A 3GJ0A 1KSHA 1XEWX 2K75A 4EUNA 3AEZA 4IVPA 5C4GB 5DLQE 1E0AA 2JA9A 2YU9H 2IT1A 2OESA 3ADCA 1ZKOA 2QNRA 3CPJB 2O8BB 1J2JA 4H1UA 4AKGA 4YLGA 1SVMA 5FH9A 5L3RA 4IJLA 5FPHA 3H84A 3B7GA 3FHOA 2XJ4A 1PH5A 1P2TA 2C95A 4EKDA 3CR7A 1CR0A 1H9MA 4X8HA 2HIXA 3CC2A 1A2KC 1F2UA 4MH0R 3I2ZA 4OX9L 3KJIA 4P32A 1N36L 1D5CA 2UZIR 5AJ3Q 5IYCG 4CEHB 2DPXA 3THYB 3CCRA 4Q1AA 2Z0SA 1DGSA 1HT2E 5CB8A 3EZ9A 1GIAA 5TMPA 3K70B 3QKUA 4B3SL 3X2SA 1W0JA 2OE2A 5FR1A 4C0KA 4CRWB 3DEFA 1SLJA 4YCVA 5JJIA 2G83A 3H2YA 4G5RA 3EW9A 4NYJQ 4R2IA 4Q4AA 3GP8A 3A4MA 5AUOB 2JDID 4E22A 4QJFA 2D5DA 3QG5A 3BRWD 1T5EA 2O8FB 2JIZD 1OFHA 4X65Q 1X8JA 4URXR 1GNRA 3L0OA 4D6PA 4XIGS 4RD3A 2WPDA 2RGCA 2Z4SA 3A7AB 3QQ5A 1TF2A 3GJ6A 2AD1A 1CU1A 4HIMA 5AUQA 3QKSA 3PQCA 4Q9HA 4B35A 1C7YA 2BBTA 5IYBH 4G5GA 3B85A 3CWQA 1G7SA 1WMSA 2D74A 2K14A 4DUZQ 3HOUH 4NCKA 4A6PA 3GEEA 2CWAA 3RS4A 4JLBA 1E6CA 1PVOA 3AGQA 1XMQL 4NPHA 1VQAA 3FB4A 2PI2A 4DV5Q 1DO2A 4C0SA 5TDHA 2OO7A 2KA7A 4GNXA 1NMXA 4CVNA 1GUTA 1ZUIA 1HZBA 1H9SB 4MUBA 4EFNA 2AKAB 1ONBA 1IXRA 3BH7A 2ZJ5A 2QSZA 5FLMH 2HF9A 4QJ3A 4KN7C 4CT5A 1FMJA 2CCKA 1LFDB 2R6GA 2JA5G 1VYTA 3S1RH 3OF5A 4IPDA 1II8A 2HXSA 1HQMC 1IN7A 2EYQA 2AHOB 5G41A 1LUZA 3CNLA 4Z8YA 3PJRA 1BIFA 1F60A 3NHAA 2PQAA 3CZPA 4C4PA 4DCNA 3VFDA 5C1BA 4LHWA 3G82C 1JMCA 1VF5C 3PO3G 1WCV1 4J0QA 4PPQA 2QF7A 3BZKA 1KZGB 4OI2A 2KCMA 1KC8C 2O0JA 3N2IA 1R8QA 2R7ZH 2IF0A 4C7OB 4BY1H 1GSIA 1CSPA 3HFZB 4IDHA 4V0LA 1HNWQ 1FR3A 1PZNA 4GLVB 5FOWA 1L2TA 1OXXK 4A0RA 1SKYB 3CUEF 1FNNA 1S1MA 5KO2A 2V55B 4JI7L 1SQ5A 4UPAA 4G1UC 3TK1A 4KLNA 3I4NG 2IYQA 2NPIA 1HYQA 4IDPA 4LK1C 4UY8C 4R4CA 4EX5A 3K7UC 2JDIA 3ECCA 3Q72A 2H1LA 4QBHA 1CF4A 2FPMA 2B21A 2J46A 1XTSA 2NO0A 1KJZA 3QPUA 2ZJRA 3A1VA 4YONB 3QF4B 4TLAA 1MJCA 2H57A 1R8SA 2C04A 2Z5FA 3RS2A 2FFAA 4QHTA 5DYGA 3X1XA 3R9XA 2QMUA 2ZJZA 1KY2A 3DMDA 4P72A 2KE5A 3J81c 2VP2A 3B1ZA 3GLIA 3ICQB 2ODNA 3PCRB 3A8KE 4KFRA 4WXPA 3M6AA 1DAFA 4LPSA 2O0KA 3L7ZC 3QF4A 4FN5A 2PT5A 5FTLA 3I5XA 3ASYA 2JA6G 1DPFA 3EARA 3SI7A 3TAUA 4EPWA 3U6KA 4A0HA 5DN6D 3A1WA 1UKVY 1TAGA 3LWNA 5FOVA 1TWHH 3K0FB 1IY2A 4LFAQ 5IWAQ 4JVSB 3I61A 1PUJA 2OCAA 1XJ0A 2EW1A 2ZRHA 2A8VA 3WYGA 2EFGA 3U6BA 2ZM6L 1CP2A 1NNEA 3EAQA 4PSKA 4DDWA 4MRNA 3K8AA 4LCBA 3TQCA 1EOVA 3NBHB 4NXNL 4Z51A 3ZVNA 3WRXC 4QBGB 1LNZA 1M74A 2J7KA 4OBEA 3FGNA 5G3ZA 2QTHA 1M90C 4GZYC 2W58A 4I99A 4LJ5A 2EXDA 4GNXB 2C9YA 4BLOA 3UDGA 1Q86C 2F4VQ 1RYFA 2QT1A 1KO7A 4GRAA 5DH9A 1US8B 1W4RA 2FSGA 3V00A 1R5NA 5KTYA 3FP9A 3IIMA 3ZJYA 3WMFA 2BBSA 4DR4L 4DR5Q 4BZQA 3F3YA 2CJWA 4OXPA 5JEAH 3D0FA 2QT0A 4C0JA 1BKDR 1CJMA 1U8AA 4HAYA 5EP3A 4DCSA 2AHOA 5JFGA 1YZTA 2FJUA 1OFTA 5IHPA 1GKIA 3JZMA 1N6LA 4A3KH 3E5HA 3QEJA 2QEQA 1YZKA 1T5LA 1HZAA 3EC1A 3CONA 2FMXA 4IOLA 2Z43A 4RD2A 3DKPA 2P3SA 2DFNA 3O8RA 4HJ9A 4Z1MD 4HI0E 1QHXA 2UXCL 4G7HC 3J7ZC 5EE0A 1RJ9A 4NE2A 3MXUA 5E4FA 1OV4A 1Q44A 1UFQA 2DB3A 1WF3A 4XTRA 5DSZA 2RHSB 3SJBA 3EA0A 1N33L 4LWZA 5GAEC 1MJEA 2J0UA 3IKJA 1KSFX 1HURA 4OQLA 4LJYA 4F4JA 3GFOA 3SJCA 4DSTA 2IS6A 3U44A 3DOEA 3QXCA 1KSGA 2RGBA 2OFWA 2PJZA 1P9WA 4NZYA 3K81C 5TVKA 3SU8A 4EPXA 5KHOC 4AIMA 5KNDA 1U98A 2OCYC 3UANA 2VEDA 1WI5A 4K0KL 1LW7A 3BAFA 2X2FA 4IPHA 4UP9A 2OXRA 5E7IA 3CC4A 1XCPA 4PQFA 2QTVB 4F4IA 1G5TA 2WJVA 4JJZA 3TSZA 1A2BA 4D81A 1GVNB 3KXLA 1DAMA 3G0HA 3K1JA 4NKRA 3P20A 3PUVA
chains in the Genus database with same CATH superfamily
4XXEA 1U4NA 5IP7G 1U8EA 2IYTA 2RAPA 2CXQA 3LLCA 4J16A 5KU1A 1MGSA 1GFIA 4KXQA 1ZD5A 4M37A 2IXTA 1I2AA 1E0JA 4NBWA 2DQZA 5CA1F 1WO8A 1SYFA 1UBGA 1KHIA 2CHUA 2Y99A 2ZBPA 4A3BB 3DM5A 2OGUA 2V7BA 3K9WA 4GR9A 4BBPA 2O8FA 1UMCA 1EIYB 3F9CA 1LTGD 1L8AA 4ITRC 4UU7A 1R0LA 3QHAA 2ZIAA 3VNAA 1CUDA 2FPUA 2N9UA 3T34A 1NURA 1I24A 5IWAB 1TJPB 1CUBA 1JLKA 2FK7A 2ENUA 1LQUA 3EDCA 1C4XA 1KEZA 2XVSA 3IALA 3T15A 3U5TA 4TYYA 1U81A 2YZNA 1RQGA 2O2GA 3PX3A 5FUWA 2F1OA 3G0IA 1CZNA 1GUDA 1J8IA 2J3MA 5JE8A 3VI3B 1HDYA 5KWEA 4QPZA 4WHMA 4PGGA 2JI4A 2HTFA 2VNKA 4QRHA 3UG6A 4BQIA 2WB1B 3MAGA 4JELA 2HHHL 1U94A 3SVMA 3DE1X 2ASBA 4J7UA 2I66A 5CVEA 1B26A 4E2ZA 1F14A 4INPA 4IX9A 1AZLA 5NLLA 3E9MA 3VZQA 5AM3A 4MR9B 4C3ZA 1LLRD 4PC7A 4OHPA 1VHJA 4RM2A 3ORFA 4KDCA 3HL4A 3KLSX 1TCUA 2FQQA 2D0PA 2F0HA 4QL5A 5AVWA 5J4KA 3SHQA 5JSZA 1O6GA 4NLLA 1PQYA 5D14A 4LFBQ 1ILQA 1J07A 3EGVA 3WDNA 3UPUA 1S5BD 3PC3A 4KWIA 4IGEA 1E2BA 3EPPA 2X8JA 1FMTA 1XZPA 1EG2A 1KDTA 1BN6A 2GJ4A 4O3MA 3RYFA 3WGZA 4KJNA 3QWNA 1X6VA 2C0PA 3F1KA 1LVUA 2IX1A 1XDSA 3U40A 3W2IA 2QP9X 4PMWA 2IZ7A 3OPYA 4HDNB 3P0JA 1AK9A 3M3YH 1PL8A 3E5SA 1K0SA 1USKA 3LCRA 3NJ8A 4II7A 4PZAA 3EGCA 4KB5A 2G0NA 1NBMD 2IEGA 3HOXH 1JXQA 1ZEMA 1TTPB 1Y6ZA 2PUGA 4A3LG 1GNPA 2YOFA 4DG8A 1SCJA 4DT1A 1ASYA 3ONDA 3AKZA 1T2CA 3CEPB 3Q7TA 4Z86A 3E35A 3N8IA 2OHOA 5SV2A 3PNLA 3PPWA 1CY7A 2PMEA 5JRZA 4I5DA 2FN7A 3MGCA 4GZ5A 3AR2A 2A6PA 1E2UA 3C16C 3CUTA 4MX8A 3V55A 4KVAA 3PIP3 1B8VA 5IDXA 1J42A 5KS2A 5JDIA 3EVNA 2C83A 3H3JA 1L1QA 4R1JA 2PLAA 2VDMB 3ICOA 3IE0A 3BXZA 2DR3A 1YIDA 3CW8X 3GHYA 3QVXA 1XXLA 3MJDA 4ZT7A 2HLDD 3TEHB 4AYBG 4S04A 2ZJFA 3EVGA 3GAAA 2A0WA 3FZQA 4JXXA 3T7KA 2XDWA 3ADDA 1R50A 3V9AA 2JGAA 2E2DC 4RGNA 5GV7A 5GJBA 4ZT3A 1IYJB 1EOTA 3K5OA 1RZ3A 2ZW9A 1OBVA 4FS3A 1EUDB 4OGWA 4X8LA 3KBXA 4B7AA 7ADHA 1FMFA 1CK4A 3W5DA 4XWOA 4WFKA 3KUPA 1T4GA 2N0SA 2H00A 2GESA 3VMFA 3WDKA 3GPCA 2H17A 2XT0A 4JI4L 1CRZA 4PLZA 1SXIA 1P6UA 2GN4A 1H1LA 2OG1A 3R6TA 4R3UC 2WP8J 4JI3Q 3LMKA 4XA8A 2WK1A 1UXIA 4FDMA 4FUQA 4BWGB 5AP9A 2F0DA 3INNA 2H54A 2ZIWB 4Z54A 1QVRA 3S15H 5IP9G 1HOXA 1KO1A 1U3WA 3EVEA 3KBOA 3MNFA 4LV8B 3MG9A 5FX2A 1EIFA 2D2FA 2XMCA 3J7YW 4FF3A 3FSJX 1YA4A 3KG2A 3OF3A 3OZDA 1JRLA 4V0NA 1LPSA 4X65L 1ODSA 3NBHA 1QQ7A 1V39A 1V25A 2H5EA 3BCSA 3HEMA 3I32A 3FHWA 1TM7E 2KW5A 1WTRA 4K6OA 4CTNA 5IVPA 1NW6A 1SU7A 1IHYA 1JUDA 5DXAA 1JR0D 1J5PA 2VJYA 3LKDA 2HF8A 3OLQA 3MEQA 4JOIA 4IXTA 3GLTA 3OQMA 2Z98A 4KX3A 3AMUA 1TYDE 3K9GA 2Q3MA 3N86A 4NBNA 1STBA 1VMCA 2VPPA 3LY9A 4GGPA 3THRA 3KQPA 4FKMA 3U3OA 1K92A 4AYBE 1MB0A 3OAAA 4NJMA 2WSMA 1JILA 5DM0A 3W4IA 1W4CA 1RE1A 2WZDA 2DFPA 3HJNA 1VE1A 4WJWA 4QRDA 4A82A 4UPDA 1H5UA 4D6YA 2HRZA 2WWVD 3VSAA 4DTCA 2A67A 1UZLA 1MVLA 3L18A 4BFTA 3TM5A 5D5PA 5C8XA 2I3DA 1ZC4A 3BYTB 3J81j 1AGYA 2XT6A 3H3XA 3HH8A 3GGDA 3R0IA 5SYNA 4OO1H 1F8XA 1P29A 4RIFA 2F4IA 1IQRA 3QLVA 4HQRA 1ML4A 3PCOB 4JYAL 1BYIA 5JSQA 2BI8A 2DECA 3JQ7B 2QX4A 4EUSA 5FFFA 4OQNA 3SM9A 2ONJA 1IB0A 2FWJA 1JMKC 2WKWA 5FJJA 2R7DA 1T6YA 5IYBG 1Q1GA 2HHLA 3AUJB 1K83H 1CBUA 1T8WA 1V1MA 1QQ5A 2QDKA 3ANNA 1S96A 3I58A 3M6VA 4M1EA 1JLHA 2R97A 5IS2A 5ETJA 1E2EA 2B1GA 2HZBA 4J0KA 2CCZA 2E4WA 2FX5A 4DXGA 2H1FA 3W2EA 4WEQA 3ZWCA 1YZUA 2XWPA 3CKMA 1ACLA 2Z6BA 4FHEA 4I08A 3CCSA 4HH4A 4RCVA 1BGWA 5H9WA 1U2GC 2C3MA 3ZWVA 4L9SA 1Z8HA 4HAWA 1A95A 4KY6A 3D02A 3F9RA 1JBEA 3CLRD 3QUAA 1L3IA 1L0YB 3FPUB 3IIJA 3A6ZA 2VJCA 4WBSA 1NVMB 1R8JA 2B6NA 2WWTA 1E5XA 2N88A 1U90A 3LKVA 4K7JA 4KO1S 1DRWA 2BJHA 4J0CA 1RYNA 3F97A 1FYXA 2FY8A 2AUKA 1Y8NB 1P8AA 2EV9A 5ELLA 4L8LA 3G6EA 4MUHA 4BO4A 2O6HA 1H5NA 2PRKA 3FNRA 1SCBA 3V4PB 4ARZA 2DJIA 3QYPA 1J9OA 1JMYA 3CN9A 3GARA 1MAHA 1QTIA 1P1JA 4X64Q 2WF9A 3KPWA 2WB1E 2IYWA 3W6NA 4DR3L 1JJAA 4U6NA 4F6CA 2OR3A 2ZUDA 3JWPA 2QE7D 4P08A 5GPBA 4BNDB 2GXSA 5T1GA 4RQAA 2OV4A 2J4FA 3AU7A 2SKEA 2G80A 2QUHA 1GPAA 1MHPA 1X65A 1U7HA 1ZH6A 2COEA 3B8HA 3CGGA 3IMCA 4L57A 2GEDA 4TSRA 3G1WA 5A03A 5JQGA 2Q2UA 2PBLA 3QFCA 5KU7A 1NOJA 4RH0A 1HE5A 2I76A 3HVRA 1CERA 2C9BA 5J5AA 1SNDA 3R8BA 1UBLS 1G21B 2L19A 2Z5LA 4UAUA 3R5XA 2VY3A 1V47A 4E0BA 4XX1A 5AVXA 2R61A 3NAGA 4XTCS 2JGJA 3SBEA 2PANA 3TWOA 1P7CA 3WOVA 2BHSA 3ZVMA 3I2GA 1GQFA 2O7NA 3AKCA 2AFIB 3CLKA 5KUTA 4F45A 1GPH1 1N2BA 4J4HA 3ZE7A 2QMOA 4RWZA 2WPDD 3C4QA 1CQVA 4UD2A 3CLTC 4C0LA 4QJ4A 3CH5A 3HN2A 4QOSA 4Z0HO 1VYUA 3DUWA 3FNHA 3UC5A 5CDSA 4O42A 1SKAA 4MDEA 2GDJA 2EZVA 3A6EA 5HTOA 3HLYA 4CLEA 3EVQA 4R8KA 2B0JA 4BRZA 1ORDA 3BXHA 4K8JA 4N3BA 6YASA 1VPDA 4J29A 4NYMQ 3FETA 1KJWA 2W37A 3ZV7A 4EG0A 1HL3A 3L2OB 2JK8A 3BE4A 4K2LA 1RCTE 5ICMA 2EU8A 1U2PA 4BMOB 1U3CA 2IHZA 5K45A 1M2VA 4PRYA 1YU9A 3OIGA 4ALLA 1EVIA 1Q7BA 1D6EC 1EFDN 4B17A 2FINB 4M60A 4ZI7B 2GXAA 3GTKH 2BFCB 1GG5A 3X1YA 4B3RQ 3IOEA 5K5PA 2JA5H 4YJ2B 5LP6A 1IG0A 1TK9A 3EXEB 3U3MA 4UULA 5L8VA 4IQZA 2W43A 2EIXA 1EQTA 2PKCA 3S81A 4XQ0A 3OEWA 1PL0A 3H0GB 4A3GH 2Z9HA 1BROA 3R2JA 2E5FA 3L6RA 3DFFA 1X7WB 2NP7A 4IEFB 5DAUA 3L04A 1PEDA 4H1WA 2K5UA 5JXGA 1GYPA 4IRMA 5F4ZA 3DQQA 2ZQ5A 4CF3A 1O6BA 1A82A 5LPNA 1NXXA 5ALUA 3S2UA 4ZQBA 2QB5A 1YACA 1T5OA 1R37A 3M4OH 2RB4A 2VJMA 3PITA 4GAEA 4KLCA 4Q66C 2ALYB 1R0ZA 4S3MA 3K09A 5DT9A 1JJ7A 3DL7A 4ZCRA 5BSKA 4JBMA 1E0DA 3HFJA 3RBXA 4KYIB 1BCSA 3O6VA 4YAJA 5CPBA 4F92B 1FX0B 3FDTA 1XZ8A 3A9SA 4OFZA 4CCAA 2KHSA 1MJGA 1R2QA 1XTPA 3D64A 4WXRA 4G4IA 1U2RA 3B6KA 4ND7A 3DEZA 2IS1A 4QG3A 1EZ8A 4ME3A 1Y42X 1Y89A 2AK3A 1YZHA 1RMTA 1S7GA 3A8TA 4I1IA 3HVHA 1RMYA 1HG1A 2XPCA 4P38A 4KV9A 5CHYA 4AG6A 4NZ9A 4YP0A 3FCYA 3M4JA 3GFBA 3HOZG 2XB4A 4G5YA 1Y3DE 3W7BA 5HZHA 4O63O 2ZRKA 4YDRA 4QO8A 4BFZA 1PV4A 1W6UA 1YS9A 1WB4A 5K6TA 3L7AA 3TVTA 3G7NA 4ZZ0A 4AWXA 2QEXA 3BMQB 3RSSA 3S3TA 2E2HB 2JLRA 4DR6B 3I2HA 2F43B 3IJPA 1SULA 1WLYA 5JAMA 5FLMG 1SHTX 1B74A 2DUNA 2JGFA 5ALRA 2WINI 3BE5A 1LUAA 2IPNA 1TIID 2OV2A 4CLRA 5IWAL 4WW0A 2ZSHA 3D7NA 4KIWA 4MUXA 4QECA 1N77A 4LF7B 4K9KA 4DJDC 3ZY2A 4RZQA 2BEUB 3A32A 4RYDA 3I30X 4FTWA 4O29A 1ZM2A 2BA0A 1ST2A 1QFYA 5FUYA 1AGRA 3KQLA 5EUCA 3V80A 4LK2A 1F77A 5G3LF 2FRXA 2YIJA 4OLFA 5TGDA 2OSBA 2IUUA 1J8VA 1R15A 1YK0A 2XVZA 2DWQA 3ROZA 1IKMA 1G7RA 4WCFC 4CQLB 3IAEA 1KOLA 1JHDA 4FHDA 4A0QA 4C6TB 5IP7H 5GZ3A 2FW9A 5AI4A 3EF1A 3RE1A 5JTUA 4QFMA 2K2WA 2VJNA 1XYIA 1QF6A 3OEHA 3PQ3A 4Q0MA 4MWSA 2WWGA 1YMVA 3HGMA 2F59A 4QOEA 3BDCA 4E7OA 3EUEA 3JVEA 3LECA 4QTUB 5AJHA 2ZB8A 4OCZA 3IB6A 4LFBL 4LZWA 3CNNA 4N5IX 1YC2A 1RRKA 3F6RA 4HQKA 4JQYA 2F8LA 3ZVRA 3FMIA 3SGIA 3RC9A 2D5IA 4MCAA 4LOIA 1ZI9A 8ADHA 2GBIA 3VZCA 4BEBA 1L5HB 2F00A 2ZRLA 3CZRA 1Z39A 1VJGA 3EZYA 3L4EA 4NI5A 5KNBD 5IJXA 4RHFA 3TBIB 1QONA 5GQSA 3QYFA 4WI1A 2WJIA 2Z2YA 1UT6A 1XEAA 3DLAA 4OK3A 5EYPB 1FP6A 1TMGE 4Q12A 2XZOA 1MA0A 4JBWA 4IUVA 2F1RA 5GIOE 1U5AA 3EDOA 3S9WA 3FN4A 3K9BA 3UCFA 2X3UA 4IXDA 1LQTA 4P3YA 1ENOA 1CHPD 1KVSA 1U9ZA 3P19A 1PA6A 1J24A 1B8AA 3UW1A 2G06A 2Q2HA 5CV5A 1SBZA 2EYUA 1GU1A 3N87A 1NMZA 2ZJ6A 3DA8A 2QAGA 1MW8X 2FETA 2IUSA 4J91A 4RL4A 2R7FA 3DE5X 4LNUA 5ES3A 4BO7A 4DM4A 3SVTA 3ODGA 1JDSA 3OPOA 2REXB 1Q0UA 3IBFA 4JROA 2LGJA 3L7NA 4NATA 3VX4A 1TA9A 2V8OA 4NESA 1DOKA 1P1IA 1U11A 1KFKB 4Q48A 5DI3B 4MP3A 1NQ5A 2Q50A 4EFDA 4LS3A 3ZW8A 2UDPA 1CY2A 3FDZB 1ISHA 3P52A 4FE3A 4OUDB 5GVSA 4FGWA 3OM1A 3LYLA 2W71A 4RVUA 4TVKA 3AVWA 3K9CA 4H6WA 1GCUA 1DB3A 1E9SA 2XNKA 1WDMA 3TG2A 5JCJD 1W0KD 1YCFA 2GKOA 4OU4A 4DC9A 3ZBPA 4LHYA 1OWLA 5H3CA 3HY4A 1C5KA 1XLUA 3Q3CA 5F1KA 5A7HA 3WBFA 1PQ4A 2HMUA 4NK4A 1Z8DA 4A92A 2AXPA 2VT3A 3IEPA 3V2TA 4JUDX 3OZRA 3WJ1A 1RLIA 4IJVA 1HLPA 1NE2A 1K0FA 2BFWA 4KGDA 1R1DA 5DM2A 4BQRA 4BE7B 2J7PA 3W34A 4ZVTA 2QW8A 2K5DA 1SJ9A 2B63H 4ND2A 2R6FA 4OP1A 5L6MB 1DOMA 3PF4A 2CDRA 2J3KA 4KKVA 4R1UA 3AM4A 3C7DB 4I1OA 5FBZA 3J80E 2ODQA 2X0NA 4NHEA 3DF9A 3W06A 3T7JA 2VSFA 4UHBA 4U4AA 4B4OA 1GZ5A 3UHOA 2BGNA 1O7ZA 2PKRA 1CUVA 1UM8A 3KAPA 1SXJD 3TMAA 1SOUA 1QB8A 2Q8QA 3MTQA 2ORVA 2C7OA 2EVWX 1OXBB 4HYQA 2NUAA 2I7VA 2C4MA 4HWGA 2WU3A 5DP1A 3H7AA 1SCIA 4OAOA 3M1IA 4YMTA 4X1IB 4Y1RB 3JCZA 3SN6A 4LOKA 5JD6A 4JKOA 4BTEA 4HS4A 2BKUA 3NS7A 1B6TA 1T3HA 3DOJA 3TNFA 2PSHA 4IZ6A 1XWIA 2CSXA 2QM3A 5K36G 2D1YA 1TWGH 1Q83A 3HWX1 4LXXA 3ZXXA 5JBIA 4U2CA 1UADA 3KV1A 5EE1A 2VIIA 2R751 3DMGA 4MWDA 2CXSA 3GLHA 4CU2A 2D00A 2WQ6A 3BHNA 4FOOA 5C1DA 4ZC1A 4KQWA 5TIIA 3V2UA 3T4XA 3I55A 1XTZA 4X20A 4QJBA 1BCPF 1QS0B 3DE4X 3ZQUA 1Y3FE 4GQIA 3R20A 1LRJA 4GOMD 5I5EA 4BX8A 2GSWA 5DO9A 2EYLA 4HGPA 2C29D 3DE7X 3PO2G 1HZZC 2QYOA 3MPUA 3NWPA 5JNVA 2PLNA 1DEXA 5F9MA 4DF3A 4A3LH 3HUUA 3H15A 1BW9B 4DNIA 3D0RA 2HQLA 1H2FA 2Q8RE 1W88B 2H65A 1DMSA 1PZMA 2FR0A 3DC7A 1R74A 4HSEA 3DEPA 2Q3HA 4X3UA 2ZG6A 2HJHA 2TMDA 4KMOA 4PGHA 3T5GA 1DG3A 1XPUA 4HLDA 3U13A 2OCDA 5CA0A 2W2TA 4RXUA 5IM5A 4AX4A 4HEA1 4CV3A 1VBNA 4CTKA 1YOVA 4TVAB 3WLQA 2MHVA 1PWXA 3R4VA 3L8YA 4ND4A 2E87A 4C4XA 1YHBA 4FONA 4PC3A 3FPLA 4GYWA 4TKMA 4DUYB 4QD3A 3WYAA 1KPGA 1QIMA 2WT9A 4WGGA 5COAA 3UW3A 5BQXA 1XTKA 3IVGA 1UC9A 2G1JA 3O4HA 4F7DA 5BXQC 3R6GA 2QRHA 5AW7A 1Z4QA 2CYAA 1DXMA 2PRSA 4WH0A 2I4LA 5AK3A 1TEHA 1KKUA 2H8GA 3FCCA 1S9DA 3U7JA 4I55B 3WJAA 5B58C 1S3SA 3FKIG 3WLRA 4ENTA 2OXCA 2FN4A 1Z88A 5I45A 4R8NA 1GPWB 2Z4TA 4WKBA 1EJ2A 2NU9B 3RR2A 4F5DA 5AM5A 1YVCA 4A6DA 2VK8A 3AEKB 5ENDA 3KSAC 1SY7A 4CQJA 5J22A 3QI2A 4P4GA 1ZK2A 1L4EA 1ZVVA 3R3UA 1CZWA 5K4HA 2PVSA 4MWZA 5CVCA 1VGVA 5L9AA 3CVJA 2GJSA 4U6SA 4W7SA 4YAFA 1KFJB 4M9RA 5U9CA 2XUKA 2ZTMA 4WADA 2QX8A 2FKNA 3ORYA 4N65A 2JA1A 5JS2A 4P2CB 1E9CA 3EZNA 4KUEA 3S1QH 3KKLA 1J7JA 1D2AA 4LJ8A 3OHMA 5LP6B 4YJ2A 4FPXA 1KI4A 4TMYA 2Q8TA 1DUIA 4UEOA 2DKNA 2VUMH 2X42A 4MTKA 1AF7A 1NP6A 2F1HA 5IW8A 3F96A 1IOZA 1M6WA 1TQ2A 2NVXH 2UYQA 3CF4G 2CFMA 4HWKA 4IDCA 4QWMA 4QXQA 4XIJA 3I64A 3EXHC 1PT7A 2W7TA 1N75A 3B52X 3CNBA 4NBKA 4E5VA 4HX9A 1NXOA 2X69A 2WYHA 4G0WA 1NSTA 3VOAA 2HT6A 1GUFA 4OM7A 1M76A 3I2JA 5TARA 1XT6A 4TSFD 3JQFA 3CX4A 3P32A 1HNZQ 2PX5A 3F3MA 4X61A 1L4NA 3OU7A 4NEGA 3RC3A 1SMYC 2WAYA 1QO9A 2P4HX 2XITA 3MWFA 3D4RA 2RSLA 5J9FA 1PUXA 4C0QC 3GP5A 3S44A 2CSUA 5DTRA 1W4ZA 5FKJA 4AS2A 2RHQB 4DUZL 2Z83A 3M81A 1ISJA 1FYDA 2CVZA 2VL7A 1F6BA 2PA0A 4WZZA 4AQYQ 1FJGL 3HOVH 2PEZA 2VCHA 1BE6A 3CCLA 1KYYA 1M6VA 2WJZB