4NH4A

Structure of the binary complex of a zingiber officinale double bond reductase in complex with nadp
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
352
structure length
352
Chain Sequence
VVVVNKQVLLKHFIPEGAPKETDMELVTTGTIRLRVPEGSNAVLLKNLYLSCDPYMRMRMTKHEEASYVDDFVPGAPITGFGVGKVVDSSHPDFKTGDYVWGLIGWEEYSLITKPQGLFKIHHTEIPLSYYTGILGMVGLTAYVGFYDICSPKKGERVFVSAAAGAVGQIVGQFAKQFGCYVVGSAGSDEKVNLLKTKFGFDEAFNYKKEPDLTKALKRYFPEGIDIYFENVGGPMLEAVLHNMRIKGRIAACGMISQYNLEKPEGVHNLFLIVGKRIRLEGFLVFDHYGSYPEFEEKVVQLIKEEKIKYLEDIVEGLENAPAALIGLFEGRNVGKQVVVVSREKGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zingiber officinale double bond reductase
publication title Structure of zingiber officinale double bond reductase
rcsb
source organism Zingiber officinale
molecule tags Plant protein
total genus 117
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nh4A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4nh4A01
1YBMA 2A92A 4RQTA 3VH1A 3SXPA 3FN4A 2NACA 1ENPA 1LSUA 8ADHA 4B3JA 4YT2A 4WOKA 5JW6A 4TRJA 4G5HA 2HDHA 1H2BA 4EW6A 1V3TA 1Q0HA 3A1NA 1O5IA 3AM5A 1W4ZA 2WMDA 4Y9DA 1W6UA 5F1PA 4KZPA 1JWAB 3TZHA 3I5MA 4D41A 5ITWA 1D4FA 3GN2A 4UEKA 3SX2A 3I1JA 2CVQA 3IDSA 3LC7O 4NR0A 1HZJA 4FFMA 4CLOB 4UVEA 5BNIA 1C14A 1VRWA 1XEAA 4N5MA 1Z6ZA 4PLYA 1I36A 3I83A 1JU9A 3PP8A 4PLCA 1ZUD1 4P22A 1JKJA 3D64A 3D5TA 2HCTA 4J3FA 3ZV6A 1T4BA 3PWKA 5LDHA 3N58A 4AJ1A 5T5QA 3QLJA 4YJGB 4OKIA 3QP9A 3PJDA 1T2AA 1D1TA 4L9RA 3K31A 3RCBA 3HDYA 4C4OA 5A4DA 2BFMA 1PL7A 1BXGB 2X0JA 3HB4X 4IJVA 1BXKA 3LC2O 1ZMOA 1ISMA 1SOVA 1E5QA 3I9JA 4DC0A 4INAA 2IZ0A 4BNYA 2GUGA 2NADA 2J3KA 1UAGA 4I9HA 4FFPA 5DBFA 1U7HA 1NBOA 2QIOA 5FWNA 3H9QA 4LCEA 4IDGA 3U62A 3I6IA 3L6OO 3BMQB 4Y67A 4I1IA 1UZLA 3ZWNA 5MGBA 1I32A 2VQ3A 4BO5A 2R6JA 2XPCA 4EEZA 1CF2O 1MLDA 2IZZA 1P77A 1W73A 3WGQA 2AE2A 1HDGO 1X7DA 3JD3A 2HMUA 1X1EA 3ZNOA 3OEYA 4IGEA 3K9QO 3M2TA 4BVAA 4TROA 3KYDA 1CQJA 1E77A 1KY4A 3EW7A 5JCJD 2AEJA 4R5MA 3AFMA 1U3WA 4RZIA 1G0OA 3HE3A 2O7SA 3H2ZA 3WGOA 3RC1A 1JW9B 2DC1A 4Y6PA 4DUPA 2X22A 3ROKA 3FR7A 4D7AA 4RJTA 1UR5A 5JAZA 3MJVA 5EMHA 3D3WB 3NGLA 1E3EA 2ZB7A 3MEQA 4NI5A 4YR9A 5ER6A 2GSDA 3RWBA 5T6BA 3JYNA 1O95A 3D4PA 2EEZA 4ZHSA 3KO8A 3CEAA 2OO5A 3SVTA 2C7VA 3D5QA 1KETA 3PQEA 4MP8A 4S1VA 3OIFA 2Q1WA 4CMJA 4XYEA 1GEEA 1P33A 4FGWA 1JVSA 3G0OA 4YAIA 4XQCA 1PTJA 3F47A 5EL0A 3WTBA 4YJDA 5IZCC 3AOEC 1Z74A 4BNVA 3AW9A 4UVGA 5DP1A 3ZV4A 4W7HA 4YQZA 4EZBA 4PLZA 3PLRA 4IINA 4TWRA 3ASVA 3RU7A 3KETA 3GF4A 3L77A 3DZGA 5B4VA 1W0CA 3JQ6A 4BO2A 5DT9A 1A27A 1MG5A 4GQAA 2CF6A 4M86A 1LDEA 3Q2KA 2E49A 3WSWA 3I4FA 5JC1A 4MO2A 1DAPA 1ADFA 1K89A 1XR3A 4RF5A 2O23A 1Y8RA 3BAZA 2BGMA 4R4JA 1TT5A 4D79A 2O3TA 2OGUA 5L4NA 3GGPA 2X4GA 1FDTA 4YAJA 1NVTA 4I08A 1VSUA 5JY6A 2X8LA 2TMDA 2WDZA 4GMGA 4CLOA 3GC6A 4BO7A 1T2EA 4YPOA 4IBOA 4YAKA 3GMDA 2EHDA 2NSDA 3CZMA 1N8KA 2VYVD 3GHHA 3QVWA 2NQTA 2PD6A 4DMMA 3ZWOA 1WMBA 4LMPA 9LDTA 1HE4A 2VHYA 1KVTA 3L0DA 1FF9A 2XOXA 1EK6A 5THQA 1B7GO 4R54A 3O8QA 4WLUA 5L3ZA 3DZBA 3V1UA 3WIDA 3SLGA 2B37A 2C20A 4HADA 1EE2A 1N9GB 4FOSA 4DXHA 1AN9A 3UVEA 5EQDA 4CODB 3MCVA 5F1OA 1NXQA 3GN1A 4BNTA 4I5GA 4ZJUA 1NQAO 1Y7TA 1CERA 4FCCA 4MJLA 4NBWA 4NPCA 1IPEA 5G0UA 2WE8A 3JV7A 1QXSA 1BW9B 4N5NA 5IN5A 3VPSA 5K6AA 1R66A 1H9AA 1QV6A 4MVJA 1EZ4A 4R1NA 1QR6A 1LDMA 2FR0A 5JO0A 1A5ZA 2VNAA 4GMFA 1BXGA 3GPDG 1B15A 2DPHA 2GNAA 2VWGA 4Y8VA 1YB1A 3NDJA 4L4RA 4WCFC 4RPGA 2C0CA 1XQ1A 4UUOA 4PG8A 1F8GA 2ZB8A 2P5UA 3GR6A 1YBVA 1N92A 4D0SA 1I2CA 1FDSA 2NUAA 1QLJA 5KJFA 1ISJA 3GGGA 1GD1O 3NT4A 3NT5A 4PZDA 1R4MB 3JQ9C 4B79A 4CUKA 3FD8A 4NH4A 2JD2A 5JSFA 1ZK4A 3GLQA 1C3VA 4RPLA 3EGOA 1JQBA 2Z5LA 5JMWA 3OSUA 3OJEA 2DT5A 4Z9YA 1WVGA 1YQXA 2GR9A 4WEOA 1PR9A 5GMOA 4KOAA 1A4IA 4FFNA 1Z82A 4KQWA 3ZHXA 3NUGA 3Q6IA 2G5CA 4FFLA 4EEXA 3V1YA 5IDWA 2XXJA 4GGOA 1BXZA 5JY1A 4CMHA 4CMKA 3VHRA 4TRNA 3QQPA 2QG4A 4YJFA 1B3BA 3N74A 3S2EA 1TT5B 3PQFA 2UVDA 3FPLA 3U4CA 2DFDA 2EJVA 3ETDA 1UP6A 1UXGA 2GYYA 2HK8A 1AHIA 2HJRA 3GDFA 1H6BA 4EI2A 1CRWG 4IDDA 2PR2A 3OP4A 3RBVA 1BDBA 2VZ8A 4OH1A 3TL2A 1WNTA 1KIFA 3OJFA 1ZK3A 4GVXA 3F9IA 3JYQA 4FS3A 3DHEA 1LC0A 3UCXA 1XELA 2JD1A 1DFGA 3B70A 5I7FA 3VPGA 4HX5A 2EW8A 3VZPA 3T7CA 4R68A 5CDSA 4ND1A 1TEHA 3W8DA 4XDZA 2AG5A 4RLHA 4MVJD 1CETA 5CAEA 3T7EA 7ADHA 2J3JA 3N7UA 2JHFA 3DAGA 4UVIA 4XB1A 5KJCA 1WAMA 2Q46A 3PHGA 1Y8QA 4J1NA 4RPHA 1PJ2A 1YDEA 2X86A 3FCOA 2VZ9A 3TNLA 3U09A 1LU9A 3BYZA 4M1QA 2LDXA 4MDHA 3GPIA 1YRLA 4RV9A 3C3XA 3VAZA 3O9ZA 4BMVA 2RAFA 2ZIZA 4IXTA 2AQ8A 1XKQA 2YFQA 3FNGA 4BO9A 1T2FA 2NLOA 1ZK2A 1QMGA 3WGIA 3EHEA 4GLLA 4WE3A 1VJ0A 4FR5A 4FFRA 5L7WA 3ETGA 4JK3A 1YH3A 3GUCA 5J23A 2PZKA 1T25A 2X5JO 4Q3AA 1HSZA 1U28A 4ZA2A 3GRPA 4QO8A 3CPSA 2NVUB 3WMXA 3F46A 4TKMA 1PR3A 2JAHA 3A06A 1C1XB 4CR6A 1UZNA 4GAEA 4FOOA 2O2YA 3IJPA 1RYDA 4IMPA 1T26A 3ANLA 3JQGB 3WQQA 5JBIA 3OH8A 2DUWA 2PTGA 4XQEA 2Q1SA 5KOIA 3VZRA 1HEUA 4J7XA 3GVPA 2BKAA 1CIVA 4PLWA 4ZQBA 1LRKA 1NPYA 2O7QA 4HFNA 4XQ9A 3S2GA 1FDWA 3RUIA 5CFZA 2GN6A 4EJMA 1HLPA 3PGJA 3QWFA 2X9NA 2E82A 2ZB3A 3WWYA 4XIYA 1E7SA 5I8ZA 1YJ8A 2DM6A 2Y66A 2J5RA 4YTEA 3WGHA 1PQPA 3ADOA 5F5NA 1GUYA 2CNBA 2IXBA 4JJIA 1OAAA 4YCAA 2YZ7A 3ZHYA 1XG5A 1FK8A 3TDKA 1EMDA 1QRRA 2JCVA 1XGKA 2CDAA 3KYBA 3PFWO 4FBGA 4I5EA 1R15A 1PGNA 5JAMA 1HYGA 2VWQA 5A9SB 2YV1A 4NK5A 4NJMA 5I7VA 4FB5A 4D3DA 5B4UA 4FPXA 4M49A 3TFQA 1PQUA 1YO6A 1JVBA 3BMCA 3C85A 4K1LA 3ZHBA 1ZBQA 2NU7A 5COAA 5KVVA 4KMSA 4KWHA 1Z45A 8LDHA 1BRMA 2ZCUA 2ZCVA 2PLAA 5C7IO 3MJCA 3PZBA 4IDAA 2PZMA 1YKFA 5CEFA 4R16A 1U3TA 1E1LA 5B37A 2Q2VA 4ND4A 2OORA 5HS4A 2W98A 4HXYA 5JS6A 1X0XA 2W2LA 3R3SA 4NFSA 1YQGA 3DBRB 3WS7A 4EUHA 1EFKA 4NBVA 4BV9A 5IN4A 3COSA 1P45A 2GCGA 3HWRA 3HN2A 3I9KA 3JQ7A 3ST7A 3KM0A 3ENKA 1S7CA 4GL4A 4E5YA 1E3JA 5I9NA 4RF3A 3ICCA 3INRA 3V5NA 5L95A 4B7UA 3G79A 4RVGA 4Q3DA 4QFCA 2UDPA 1KBZA 2R00C 1DPGA 3I23A 4MP3A 4WLVA 1K6XA 4L76A 3AUUA 4O6VA 1JA9A 3ZWBA 4D44A 1DIHA 5HM8A 1NPTO 1ZK0A 2AQHA 1HDCA 1Q2XA 4ZN6A 1SNYA 2WWRA 1ZVMA 1YXMA 4ALNA 2D5CA 2W2KA 2CFCA 3WYCA 4DLAA 5ICMA 1J6UA 2GZ3A 3ZU5A 4B4WA 3VPXA 4AJEA 4F6LA 4E32A 4J4HA 1IY8A 1UAYA 3HQ4O 2GRAA 1KC1A 3PHJA 1Q1NA 1NAIA 5IJZA 3W8EA 4U0KA 2IYPA 4PZCA 3C7DB 3EAGA 5K1SA 3PDJA 1P0CA 3B20A 3E1KA 1P1FA 1QORA 3VKUA 4AJ4A 4CQMD 5B4TA 1EFLA 1NQTA 2DU8A 4UEOA 2J6IA 2I9PA 4BO4A 3TOXA 2GGSA 4AL4A 3EUWA 4QEDA 1E3WB 3DBLA 5GY7A 2G0TA 1WDKA 2VTEA 3GOHA 4CV0A 2D1YA 1EUZA 4FIZA 3G49A 1X7GA 4ZGWA 1U5AA 5KTKA 1AGNA 3GFGA 4NU5A 1IZ0A 2EG9A 3WQRA 1GPDG 2W2LD 4OOFA 2FPGA 4QXMA 1VKOA 4N7RA 1PSDA 2EW2A 1V6AA 4F46A 4QUKA 2BI7A 2EIHA 1BSVA 1XWFA 2Y1EA 1BW9A 2PZLA 2IDZA 1DDOA 2C54A 4DYDA 4AICA 5I9LA 1U3UA 3NTOA 1WZIA 1DLJA 1DC6A 4YT4A 1YB5A 3W4IA 4ALLA 3NRCA 4A27A 4P4GA 4HP8A 3WJAA 4Z9FA 1PZGA 4WLNA 5A5EA 1U2DA 3AJRA 4CUZA 3H7AA 1E3SA 3TZKA 3U4IA 1F06A 4IS2A 5L7TA 1LEHA 3JQFC 3ETEA 3HHPA 2DTDA 5C7OO 1U3VA 4BB5A 3C24A 5BNTA 4E30A 1UDAA 3A28A 4FFOA 2OOSA 3JTMA 2PA3A 1MP0A 1EEHA 2BLLA 3HG7A 3K96A 3MJEA 3U3XA 4TVOA 2Q45A 1SO8A 4RF4A 2NV6A 3ITDA 4NJOA 4IJKA 1EVIA 5KVSA 2Y0EA 4RLSA 4ALJA 4AJOA 1DRVA 1B8VA 3UW3A 2P4QA 1AXGA 2JAPA 3RUFA 2VHWA 4JGBA 2ZJ0A 2Q4BA 4ITUA 1NNUA 1ONNA 4YVFA 2WD7A 2OBYA 1OBFO 1K6JA 3H6KA 3TRIA 4GI2A 5F5LA 5HA5A 4IGFA 3RUAA 1NX6A 3WGYA 1PJCA 1P1IA 1GTMA 1KS9A 2OHXA 1LUAA 2PV7A 4OKNA 2HKIA 1T24A 1GEGA 3QA9A 4NFHA 3UFXA 3S8MA 1Y9EA 2PKQP 3KUXA 4ZRNA 3P7MA 3WLEA 2O3RA 5ENDA 4NFYA 5IDXA 3T4XA 4JX8A 4XR9A 5AVOA 2DFVA 2XXBA 3AK4A 4L4SA 3P19A 3CMCO 4G2NA 4XDYA 1LRJA 4UUMA 3ADPA 4CL3A 5TT1A 4BO1A 1RM0A 1EDOA 1GADO 4DVJA 3ZWPA 1QYCA 1XA0A 4B3IA 3OJOA 3LT4A 5COBA 2YFHA 3CSDA 4XRGA 1C0PA 4OSOA 3V2HA 3SJ7A 3WDSA 1X7HA 3F5QA 4DL9A 1H6AA 3QHAA 2AMFA 2I67A 4ZU3A 3QE3A 4FC6A 3DHYA 5GZ3A 2FN7A 4RPJA 1E0DA 1FJHA 4IJWA 2GZ1A 4J7CA 5MDHA 3ZV3A 1LSSA 3MWEB 4XYBA 1DAOA 2LDBA 4BNKA 2D3TA 2Q1TA 2DBRA 2UUOA 4RO0A 1B26A 3WQSB 2TMGA 2H5LA 3EMKA 3LK7A 1R0LA 1NPDA 3RUHA 1F12A 4XYGA 1D7OA 4GX0A 4E5MA 3GZNA 1C1XA 5TX7A 1G1AA 1YB4A 3LQFA 4MIOA 4R69A 3D7LA 4ROSA 1Z73A 3EK2A 4FDAA 1GPJA 4HBGA 4IDBA 2PH5A 3PRJA 1NHGA 3WG9A 1YVEI 5ILOA 1I0ZA 2YV2A 3NTRA 4WCFA 5G4LA 3RASA 3P5SA 4B7CA 4D45A 1RM4A 1SBYA 2IEBA 3RUCA 1MFPA 1WXDA 2HMVA 3BZUA 4MKZA 4OXNA 4A2CA 1DRWA 3QWAA 2X6TA 4OGWA 1NYTA 1PS8A 4ZQEA 3VTZA 4XRRA 4PG7A 2PWZA 2J5QA 2VWHA 2NVWA 1IYZA 3K92A 4NU6A 2RH4A 3DZKA 3WBBA 2JFGA 4DPKA 3GNSA 2O4UX 2C2XA 4YBZA 4AJIA 4DRYA 5T8KA 2EXXA 5AXBA 3C8MA 3ZN2A 5CEJA 4E5PA 4YYZA 3GZNB 2BF7A 3E48A 2HK7A 5DCWA 4E4YA 4O59O 3U4DA 3KYCA 2DVMA 4Z0PA 4XD2A 3DOCA 3INGA 2AEFA 1X14A 1H9BA 1DC5A 1G6KA 3QVSA 1EK5A 2POQX 2UUPA 5IDYA 3PHIA 3L4BA 4Y6SA 5BQFA 1PZEA 1GQQA 2ZQYA 4DTIA 4BO0A 5G0SA 3ROMA 3K5PA 4O0LA 2JKVA 3H5AA 4FSHA 2VRCA 5CHEA 4BKUA 1QP8A 1B0AA 3M6IA 2OUIA 1NQ5A 4DQUA 2OL4A 1R37A 1T2DA 4IS3A 1F14A 3W6ZA 1HRDA 3OA0A 2P4HX 2QYTA 3TPCA 4BB6A 4ID9A 1ZXBA 3JD1A 4F45A 3NV9A 3U49A 2D5AA 3GH3A 5G2OA 4HFMA 4WK6A 1RJWA 2AQKA 3ZWMA 1A7KA 4I9UA 4JP2A 3GDGA 5DNAA 3RUDA 3VTFA 3WYEA 3LZ6A 4E2XA 1VJ1A 3H9EO 4DA9A 2WEKA 1HDOA 5JCJA 4E5KA 1LLQA 5BT9A 4RZHA 1N1GA 5H83A 1U4OA 3AFNA 1GYQA 2A9FA 2J8ZA 4HNGA 4WLEA 3C7CB 4H7PA 3GEDA 4NG5A 5CDUA 4YQYA 2Q49A 5KJ6A 5ADHA 1BVRA 1GYPA 1BVUA 4J1TA 2CF5A 1JKIA 1GZ6A 1LDGA 3AI3A 4A73A 2NVBA 4BNHA 1I8TA 3BMNB 2IYOA 3JD4A 1H93A 2WYWA 1L7DA 4BO6A 3JD2A 3OIDA 4QX6A 2VOEA 1WDMA 1PJ3A 2IRWA 4RDIA 2FP4A 2VHXA 3IS3A 2HAEA 1PJBA 3JQAA 3R3JA 3ZH2A 4CMGA 5EJ2A 3WGZA 4AJKA 4PLVA 3DMTC 1XDWA 1TXGA 4LSMA 3IL2A 2EP5A 4RDHA 1BG6A 4F6CA 5A9TA 4CQMA 4MVJG 4ESOA 4BGIA 2Y93A 1PGOA 4L73A 4LRTB 3GNQA 1ORRA 3PYXA 2BI8A 2ZATA 3E8XA 1ZW1A 2IXAA 4ILKA 2Y99A 3O03A 4BNLA 4JLWA 2DBZA 2E48A 2JD0A 3KVOA 4DWVA 3K6JA 3SBOA 1EQUA 3IJRA 2E37A 1KVQA 5L45A 2HMWA 3TN7A 3KV3O 1LDBA 4E0BA 4GGPA 2QRJA 1PS9A 2PD3A 4YRAA 1DXYA 4RGBA 1DIGA 4MVJF 1IL0A 5KNLA 3EZLA 4PG5A 1U7TA 3DONA 3FRJA 4UUPA 1H5QA 4ND2A 3KSZO 3ZZNA 2ZTLA 4ONEA 3E18A 5FEUA 3SC6A 4BKRA 4D3FA 5IXYA 3B1JA 2UYYA 3AUSA 4BNWA 4YWJA 1T4DA 2HUNA 4NQZA 4HFJA 3VDRA 3JQ7B 4KDFA 1A72A 2EKPA 5T67A 1ZCJA 3FTNA 3CIFA 3RKRA 3FBGA 2Y1GA 4CR7A 1ENOA 4ALIA 3L9WA 3UF0A 2FHSA 1EDZA 3CZRA 2P68A 1DO8A 1S6YA 3E6AA 3IOYA 5A05A 3S1LA 4OXKA 3ZGYA 3BMQA 3MTJA 3NDRA 2OBNA 3PIDA 3JQ9A 1I2BA 4XJTA 5G0WA 3IQDB 4D43A 1PJ4A 2V6FA 2AW5A 5F3RA 1U5CA 2FMUA 3ORFA 5BSEA 4JN6B 1ZMTA 3PHHA 3LC1O 4HY3A 3PK0A 1QKIA 3H65A 4NJMB 1OI7A 2DPGA 4EITA 5H82A 1V9LA 2PGJA 1K3TA 2Q2WA 1BWSA 3OMLA 2E6UX 2EP7A 3WGGA 1U8XX 4CM4A 3KHUA 4KTTE 4JNKA 2BH9A 4U6QA 4RPKA 2HLPA 1B16A 1KERA 5K6AC 4M8SA 2WD7B 3NT2A 4L0QA 1R12A 3F3SA 2VYNA 1LX6A 3TWOA 1PWXA 5T57A 1LQUA 1M76A 3O38A 1I3NA 3U9LA 4WLFA 2C82A 2X58A 3RAJA 5A3JA 3NX4A 4YRDA 1Q7CA 1ADBA 1NR1A 3JQAD 3DOOA 5AXCA 3GVXA 1I3MA 4YT5A 5A9SA 5IDQA 1GU7A 3TL3A 4Z3KA 3FNHA 2GERA 1FMCA 3ZHZA 4J6FA 5JE8A 1H6DA 4CLEA 1HE3A 1SB9A 2ZK7A 3U4HA 1YBAA 3ZDFA 4CLRA 5BNFA 3JSAA 4OQYA 5EINA 1NVMB 1IOLA 3I52A 3W8FA 5U9CA 4G81A 1HL3A 5T64A 2GASA 2F00A 2PZJA 4CM3A 1F0YA 3UGKA 3H2SA 3SLKA 2QZZA 1XCBA 4UVHA 4YRBA 3GEMA 2GDZA 2FSSA 3HDHA 4J2OA 3KLPX 2VTDA 4J4BA 4ND5A 4HV4A 3EDMA 4IIVA 4RVDA 5FYDA 4CMIB 5JC8A 2PFGA 4XR4A 5DOVA 4NBRA 4CM8B 3IP3A 3ONEA 4PVDA 1ZZEA 2SCUA 5A9RA 4KP7A 3F6YA 3WICA 3E9QA 3FF4A 3PWZA 1EVJA 3P2YA 5TT0A 3WGTA 1J49A 3GQVA 4L74A 2ZYAA 4L4XA 4R9SA 5T8KC 2H6EA 2YHUA 3ZWVA 3ZWYA 1J5PA 3D4NA 3ZNQA 5BSGA 5IZCA 2Q50A 1PWZA 1MA0A 3IIEA 3GEGA 3R0IA 1XYGA 1E3WA 1ZH8A 5GZ1A 1R16A 2V7PA 3OQ6A 2CD9A 1PJLA 1LSJA 1LDNA 3DXFA 4J1SA 2GO1A 1U2GA 4TKLA 4D0RA 1TI7A 5KIAA 1DIBA 4GSKA 4YJHB 4IDFA 4OYRA 3CKYA 2H1SA 4R1UA 2O2SA 3OJ0A 4P4NA 2G76A 1VL6A 1WW8A 2NTNA 4J9VA 2Y67A 3QW2A 5JO9A 1VC2A 2RIRA 3HZZA 4HKTA 5IFLA 2C5EA 2YW9A 4J49A 3QSGA 4MVJH 3FHLA 4J4TA 2Y1FA 4AG3A 1K2WA 1DC3A 3HDJA 1P1KA 3KXDA 3GFBA 3A14A 4X54A 5I7EA 3FWZA 3BHJA 4Z6KA 3FNEA 3IUSA 1DJQA 1PEDA 1HF3A 4CQMB 4R01A 1YDWA 1A7AA 3V2UA 4AFNA 4EYEA 4I5FA 1JWBB 2P5YA 1PIWA 4QFDA 4CL8A 4XZ3A 3Q3CA 1N2SA 2Y05A 3X2EA 5LC1A 5K9ZA 1LQTA 3OQ1A 2Q3EA 3UN1A 3IAHA 4BGUA 3OA2A 1ZSVA 4IPTA 4CV2A 4ZVVA 2B4TO 5HS6A 5CPFA 4ZQGA 4CM6A 3PI7A 3ICPA 2OFPA 3WJ7A 4O63O 2B5WA 3I9MA 2VCYA 3K2BA 1AHHA 4JCOA 4CMEC 5B12A 3GAFA 5TNXA 2WJPA 4E12A 4TSKA 1E6EA 1WZEA 4MIEA 3TFOA 2HQ1A 4JIGA 5TRTA 2JCXA 4RVSA 3EVTA 1E7QA 1Q0LA 3D0OA 5A06A 1RWBA 1NWCA 1LTHR 5BSHA 3E5RA 5L7YA 4CPDA 1RM3A 2O4CA 2Y0CA 4Q3BA 4XJSA 3DWFA 2I3GA 1TT7A 5A04A 1NTOA 3UCEA 4PLHA 3OIGA 4CR8A 1WPQA 2GF2A 2YDYA 3C7AA 4II3A 4J90A 2PD4A 3B6ZA 1MXFA 1QG6A 1LXCA 5G4KB 2AXQA 4ZQFA 5DP2A 3ZU2A 3FI9A 3GDOA 4R1TA 3G17A 4Z9XA 4CM9D 4EUEA 2Y0DA 5ES3A 1V0JA 3RFXA 4MVJP 1ISGA 4O5OA 4NK4A 2H9IA 3ZI0A 4DIBA 1R4MA 3LSYA 4GBJA 4E31A 3GAZA 5JAQA 4KTVE 5C7LO 1ZXLA 1I30A 1NVGA 1JAXA 3JYPA 4OIMA 3LDHA 5A3VA 4XB2A 1DEHA 5TJHA 3IKVA 3K2EA 4WPGA 1GV1A 1M6WA 4J2HA 1SZJG 1QYXA 1PJSA 4AJHA 1UXHA 3DR3A 3FSRA 4WNIA 2QW8A 5JDCA 1E1NA 1HT0A 1LI4A 4TRRA 1TA4A 2B4RO 4OL9A 5BR7A 1Y1PA 5TS3A 3JQFA 2DTEA 1TVEA 3G1TA 1UUFA 1KVRA 1P9LA 4Q3CA 2XF8A 1HETA 4DYVA 1NFFA 1C0KA 5C3MA 4P8RA 3JCZA 1MUUA 1RYEA 3MTGA 5CP8A 4CM5A 3AUTA 4IQ0A 1JKFA 2J3HA 1MB4A 3PIIA 4JP3A 4U0JA 1GFSA 2Z1MA 3IUPA 3JYOA 3E82A 3L4BC 4TQGA 1CYDA 2WYUA 7MDHA 1ZIDA 3O8QB 4LK3A 4WEQA 2GLXA 3ZCXA 4BNZA 5DF1A 2W8ZA 4MIYA 1D8AA 3CE6A 3H9UA 5FI5A 4DC1A 1DFHA 5KJEA 1CWUA 5EQFA 4WECA 1MG0A 2X9VA 1GYRA 3AI1A 1ENZA 5CPBA 1MV8A 4GWGA 2CMDA 4M87A 3AM4A 4BL5A 2BGLA 4TZKA 2EKLA 2Q4EA 2FPIA 3ENNA 3GG9A 1Z7BA 3NAQA 5TIIA 1P3DA 2F1KA 2JFHA 4R41A 1LA2A 1BTOA 4CM7A 4PGFA 3ZU3A 4IQGA 3AY3A 2NU9A 5HRUA 2Q2QA 1DSSG 4DBVO 5JAIA 4KWIA 4EJ0A 4PN3A 4FC7A 3HFSA 2P91A 4NBUA 3HADA 1IHYA 1SC6A 1C1DB 1VE9A 3SJUA 1ULSA 1V35A 2ZTUA 2AHRA 2VT2A 3ULKA 2RH8A 4XWYA 1OFGA 3UKOA 3IP1A 1GZ4A 3DFZA 4TRMA 2EGGA 1U9JA 1ZNQO 4IZIA 3VH3A 1HXHA 4FJ1A 1XIVA 1HDRA 3WR5A 1R6DA 3LT0A 4WJZA 3UAGA 4YXFA 3K73O 1VKNA 2X23A 4JBGA 4P38A 4DIFA 4BGVA 4RCVA 5EN4A 3HB5X 1FDUA 4H3VA 4BV8A 1QLHA 3L6DA 1YJQA 1P1HA 2WTBA 3JQ8A 3BIOA 4B4UA 2J3IA 1GY8A 2FPPA 1L7EA 1LJ8A 4OM8A 4UUNA 3VVCA 2B83A 4PVCA 4J9UE 2PY6A 4OSPA 3WTCA 4OMUA 1YL6A 2ZTVA 4XA8A 1IPFA 5C37A 1E7MA 5L4SA 1EBFA 4E21A 3KEOA 1DB3A 1P44A 1HWYA 2BFAA 1O0SA 4YAEA 1O89A 1R4NB 4N18A 1EBUA 4J7UA 3PDUA 2EJWA 1AE1A 2BRUA 2GN4A 3O4RA 4GX1A 1N7HA 1IB6A 3C1TA 2G1UA 3F1LA 1VSVA 4Q9NA 3DAPA 1YGYA 2VRCD 1HDXA 4NZ9A 1ULUA 2O3UA 2D0IA 4IUYA 3QVOA 3WWZA 5CEEA 4PCVA 1U1IA 4A7PA 4Q39A 3GG2A 4JXKA 1OZAA 4PZEA 1GZ3A 5G0VA 4CV1A 2UAGA 4G65A 3MJTA 2YYYA 1E1MA 1E7WA 1NFQA 4PG4A 2AA3A 3I3OA 4A03A 4QQRA 4R9RA 1B3RA 1XQ6A 2VOJA 1CDOA 4II2A 5JFOA 1F17A 4CLRB 4WKGA 4W9NA 3VPFA 3DHNA 4JBIA 3PYLA 1DOHA 3H8VA 4TVBA 4UEJA 3BHMA 3V1TC 1BGVA 4WUVA 3DMTA 1VL0A 3Q9UA 4S3MA 5THKA 3UUWA 1IULA 3K8ZA 1P0FA 4NHEA 2EWMA 2E4AA 4KUGA 3PJGA 1K0UA 3MOGA 1HZZA 1Y9AA 4BKQA 4BHTA 1Y8QB 3I6QA 3WFJA 4B8WA 1UZMA 5EERA 3ROQA 2FR1A 3JYLA 5FF9A 1ADGA 4GX2A 3CMMA 1ZEMA 3I4CA 4BNNA 3OHSX 1Y5MA 3ZWAA 4BIIA 1KEUA 2QRKA 1Y5RA 3ONDA 3AY7A 4Z3DA 1M75A 4W7IA 4CQLB 3O26A 5COQA 4UAGA 3WNQA 1I3KA 2YY7A 1X15A 2ILTA 2VUUA 2WE7A 3F4LA 3DZJA 3WX0A 1NAHA 2HJSA 1YE3A 4LVCA 1P31A 4LMRA 4IQ8A 2VNSA 3NJ8A 3RU9A 2IE0A 3ON5A 2VT3A 4QTZA 4K9DA 4M55A 1CQIA 3RC9A 1Y81A 5IAAA 3S55A 3B1KA 4EJ6A 4H15A 1GL3A 4CLXA 3M2PA 4CMBA 4FGSA 4EDFA 2D8AA 4XGNA 3JQEA 2DBVO 1V3VA 3KYCB 4IM7A 1ML3A 3LVFO 2WSBA 4P4LA 2NM0A 3PTZA 1B8UA 1ENYA 1A71A 4YJFB 3HUDA 3HDQA 1DIRA 2VUSA 2CVOA 3RBXA 4A0SA 2HRZA 4NNJA 2I5PO 1NQOA 4WGGA 3HN7A 4UVDA 5JPIA 3GHYA 1LDYA 4RVUA 4TMFA 4NMHA 1PJQA 3KEQA 3NGXA 2Y1CA 1A9YA 4GKBA 4CLDA 4B8ZA 3QIVA 4ZQHA 1JTVA 2JJYA 3WOHA 1ZJZA 2V6MA 4R5HA 1NM5A 4RORA 4CM9A 4CMEA 1GV0A 4CMAA 2BHLA 2YHIA 4Z0TA 4OQZA 3LLVA 2CZCA 5L40A 1EVYA 4OO3A 3HFGA 1LLCA 2YDXA 3NYWA 1ISHA 3VZQA 1ZJYA 3LYLA 3ZW8A 2OZPA 3AWDA 5AYVA 4BO8A 2FZEA 3R1IA 2VUTA 2HMTA 5DBGA 3DQPA 1LLDA 5I7SA 4DPMA 1Y8RB 2A4KA 4GVLA 1KVSA 1E7RA 3A4VA 2NTVA 1LSOA 3PHLA 1UP7A 3OJLA 5U1PA 2HMSA 3GT0A 3GVHA 4NBTA 1N7GA 2C59A 1Z75A 2I6TA 4LCJA 2X1HA 3G1UA 1PZFA 3DMYA 4ZICA 3PPIA 5BSFA 3GY0A 2V65A 3RFVA 2R00A 3BMOA 1X1TA 4XYMA 2GN9A 2CVZA 1IUKA 4I8XA 1RPNA 1U8FO 4DLBA 4U6SA 1HSOA 3H9GA 3QWIA 3DZIA 4HWKA 5JXWA 3ASUA 1YONA 4GX5A 4MINA 1QYDA 2P9CA 5G0TA 1NHWA 1YQDA 3T4EA 3LF1A 1UDBA 3DO5A 5DOZA 4B7XA 1DIAA 4FJ2A 4CV3A 3WXBA 3PJFA 3GRKA 4DMLA 1Q7BA 1MC4A 3KSUA 3RBZA 4BOYA 2AEMA 3ZW9A 4CUJA 2P2SA 3PVZA 4Y6RA 1MX3A 3FNFA 1E5LA 3H3JA 3FBTA 3UICA 1SAYA 2RHCA 4AJLA 3ZU4A 4R1SA 1LLUA 3DZHA 2O48X 4BGEA 5KVQA 5HWSA 3E9MA 5ENVA 3D1LA 3PYMA 4C7KA 1ZKMA 1YL7A 3OETA 3WMWA 2X0IA 1KVUA 1N9GA 3H9JA 2ZYDA 1M66A 3FR8A 4GLOA 5TJ9A 3I9LA 5FFFA 5IXSA 1HDZA 3H5NA 1I3LA 1TLTA 2B0JA 4JQCA 4K6CA 3VH2A 5ER9A 4QECA 3RC2A 4GKVA 4QSMA 2QZ9A 1HYEA 4CJXA 2CUKA 3Q1LA 4DREA 3VVBA 1GUZA 2RCYA 2PKRA 4MKRA 1E3IA 3E5MA 5KVCA 1I24A 1GQ2A 2I66A 4LW8A 3EC7A 4URFA 3X2FA 1DFIA 3KSDO 3EY4A 3NJ4A 2DUUA 3AI2A 5TSDA 4DQVA 4HFRA 4E5NA 5A1TA 1KYQA 1SEVA 3DBLB 4FN4A 5GZ6A 2Z1NA 4LSWA 3GZ4A 3FWNA 3DDNA 4YEDA 5F1KA 1UH5A 4IDCA 1YOVB 3WNVA 2FZWA 4DQXA 4MVJE 3V2GA 1PU2A 1WMAA 2D59A 2GD1O 4FW8A 4NIMA 5DCYA 4AJPA 4IXWA 1FXSA 2V6GA 2CY0A 3BTOA 2BMAA 3DBHB 3MWDB 4BNFA 1MGOA 5LDGA 2B4QA 2O3SA 4JROA 3ZWWA 3MOIA 5JDIC 2R2GA 4IIUA 4XEHA 4BS9A 1ID1A 2GPTA 5AQ1A 2W2KB 1BDMA 5CDGA 2VRBA 5ITVA 1JDJA 3NKLA 2Y1DA 3AY6A 1E3LA 1CEQA 4ZD6A 5JNLA 4FQ8A 5JDCC 4RF2A 4DGSA 3F1KA 3V8BA 1L1FA 1O6ZA 3CINA 3RROA 4BNUA 2VZ0A 4XKJA 2PK3A 3BMCB 3PWSA 1C0IA 1H0KA 1P74A 3BA1A 1P1RA 2OXIA 3PQDA 5IZ4A 1I33A 5JDIA 1ZSYA 3VDQA 4BNJA 4IZHA 4A10A 1LNQA 1V3UA 4EBFA 2Y1OA 4Q3EA 3M1LA 2A35A 5FI3A 2EF1A 1DLIA 2HRBA 2RHRA 3JD0A 1N1EA 3S2FA 4CMIA 4K26A 4YACA 3RSHA 1SCUA 3MJSA 1QYVA 4W9NC 1M6HA 5A5FA 1OOEA 4DPLA 1B2LA 3OICA 3TZ6A 4CM4B 4W82A 3QVTA 4U7WA 1H94A 4XGKA 3KLMX 4W6ZA 4N54A 1I2ZA 5KJ1A 1Q7GA 3RQSA 4D46A 1EE9A 1PL6A 1SMKA 3PFFA 3PEFA 3KTDA 4BNMA 3LU1A 1EQ2A 5ILGA 5DBIA 2CDCA 2ZQZA 3C1OA 3VOSA 3JQAB 3U5TA 2X0RA 2QHXA 2VN8A 2BFOA 4IY1A 1GCUA 3HNPA 4M54A 4YDRA 4DLLA 5F21A 4BNIA 2RBEA 6ADHA 4D3SA 1KEVA 1PQWA 4XX0A 3PZRA 3RC7A 3WLFA 3VZSA 4TZTA 2QX7A 2QYSA 1FDVA 1YWGO 3RUEA 1J4AA 2Q1UA 5JMPA 5TF4A 1CJCA 2DQ4A 4OAQA 4B4OA 3Q2IA 2O3QA 1ISIA 4RL6A 2WD8A 5DDIP 3RVDA 3DBRA 2D2IA 3NTQA 5JYDA 1SB8A 3E9NA 3SC4A 3DFUA 5JCXA 3OECA 1GUFA 2ZJ1A 1JN0A 1NWHA 4E2WA 2BD0A 3QJ5A 5TC4A 3ANMA 3OEWA 4RVHA 2C5AA 1WP4A 3PLNA 4I9NA 3AM3A 2PKQO 4OHUA 3P2OA 4WNCA 3RD5A 3UH1A 4F3YA 4GPD1 3DTTA 2CSUA 3Q11A 5L4LA 4Z0HO 2OP0A 4BQPA 1MFZA 2B35A 3AUAA 3KRTA 3BTVA 2JFFA 4MPDA 4OJNA 1SPXA 2BELA 4Y98A 3ZNPA 4XYLA 3QWHA 4R3NA 4M89A 1DC4A 5JYEA 4J0FA 2B69A 4BKOA 4YA6A 1H6CA 1VJTA 4B4VA 1WLYA 3OBBA 4EGFA 2UV8A 4UREA 3A9WA 5I8WA 1EUDA 4JBHA 4BMSA 3W4JA 4BMNA 2GZ2A 4BNXA 1A4UA 1EVZA 3KOUA 3BHIA 3ANNA 4PLFA 4YJHA 5AXAA 1Q0QA 3K30A 1YOVA 2VHVA 2VHZA 4W99A 4MP6A 5ICSA 1PGQA 4LGVA 2ET6A 2G82A 3OM9A 3QV1A 2ZTMA 1RM5A 3IC5A 1KC3A 1UXJA 3DBHA 3PJEA 4O1MA 1LC3A 5DN9A 1ZEJA 2I99A 5LCXA 4MVJI 1PX0A 1UDCA 3GVIA 3EZYA 4E33A 3QRWA 1QYWA 3AOGA 1YL5A 1KOLA 5I9MA 1E92A 1HE2A 1ZO8A 1HYHA 2GN8A 3DTYA 3S2IA 3ZV5A 1X0VA 3LLSA 5C5IA 1DBVO 3DL2A 4I5DA 3UCFA 4MKXA 4K28A 3NDIA 1X13A 3R6DA 2QRLA 2PGDA 1AUPA 1R4NA 1P1JA 2P9EA 1PZHA 1ZFNA 4QO7A 2AE1A 2P9GA 1PGJA 4XCVA 1DRUA 3VPHA 2YV3A 3L4SO 1XHLA 1WDLA 1K6IA 4ZRMA 2DBQA 3AU8A 2Q99A 3BMOB 3TZQA 1GQYA 1O9BA 1F8FA 3HJAA 3L6EA 4MVJM 5EESA 3ZNNA 2PNFA 1T1SA 3RFTA 2C7GA 4WLOA 4CLHA 2I65A 3BTSA 2BGKA 3D3WA 3M1AA 3UOGA 3E03A 5L53A 1RKXA 2D4AA 3W1VA 1I5RA 4RQUA 4KQXA 4XIJA 2NQ8A 2NU6A 1HKUA 3QY9A 1EUCA 4R51A 1QSGA 3AOEA 3JQBC 4OOEA 1UJMA 1UXIA 1VLLA 4L75A 2I3AA 2CDBA 2IEDA 2O50A 3ZWXA 1NFRA 3GK3A 3ROPA 3W6UA 3BMNA 1GDHA 4OXYA 3CTMA 2QQ5A 3QWBA 5CG2A 1ISFA 4WCDA 2PH3A 2JCYA 4LN1A 5KCZA 3OFSA 4IMRA 2BFPA 2EERA 4FJ0A 5CDTA 1QV7A 4U8GA 4AJ2A 1ADCA 5CG1A 3L07A 5KKAA 1K5HA 3GMSA 4KUHA 1NP3A 4D42A 4AJNA 5TGDA 4E2YA 2FWMX 9LDBA 2I76A 4L8VA 1XU7A 2HSDA 3INTA 2FR8A 3EYWA 6LDHA 4IJUA 2X9GA 3DEYX 3FPCA 3TSCA 2ZYGA 1B8PA 5EPOA 4J43A 1LBEA 2G17A 3DOJA 3MJ4A 3UHAA 4RVFA 4PG6A 1PL8A 4PIVA 3HSKA 5TQVA 3FTPA 1OMOA 3D4OA 3I9NA 5DCUA 1O94A 4DBZA 3KBOA 1HDYA 2EKQA 1O8CA 3RIHA 1D3AA 1VI2A 3LF2A 1JLLA 4MOWA 2NVUA 1C1DA 4UULA 4CM1A 4JJFA 3RKUA 3VC7A 2AG8A 3ONFA 2FSVA 2WM3A 1HE5A 3TF5A 3F4BA 4K6FA 1Y6JA 1B14A 1D1SA 1IHXA 1UXKA 2H63A 1E6WA 1VL8A 3C1AA 1G0NA 1BHSA 3GVCA 4HUJA 4PLPA 3I9OA 4QT0A 4WCFB 1T1RA 3WYBA 1I01A 2J5KA 5HTOA 4WASA 3IMFA 5EIOA 2ZKLA 1Z7EA 3AU9A 3H4VA 4FD3A 2W90A 4E2ZA 5K0ZA 3JQDA 3SEFA 1HLDA 2JHGA 3ITKA 3QVXA 4A5OA 1OC4A 4Q3NA 3TJRA 3Q0EA 2HU2A 2DKNA 4A26A 1ZSNA 4BQRA 4DIOA 1H2HA 1VM6A 5AOVA 4E13A 4IDEA 2NNLD 2FOIA 3KYDB 5A02A 1N5DA 1PS0A 2FRDA 3NEPX 3TZCA 5A03A 4LRSB 3KB6A 3CH6A 4PRKA 1ONOA 4ND3A 1MC5A 1XLTA 4YT8A 1SOWA 1OC2A 3WBFA 1XSEA 5B1YA 4E6PA 2Z95A 3TOZA 1JAYA 2NU8A 1R0SA 3JQCA 1NASA 1TB4A 4KDEA 2YQ5A 2DLDA 3PGXA 2PGLA 4HNHA 4YB8A 2DAPA 1V8BA 3STHA 5L51A 2Y68A 4GH5A 1ZK1A 2A94A 3RJ5A 4C7JA 1PGPA 2JL1A 1GAEO 3ABIA 4E3ZA 2XAAA 4YJGA 1ONPA 5U4QA 3BTUA 4PLGA 2YJZA 2X7HA 3GA0A 1IZ9A 1IE3A 1VPDA 3WSVA 1LRLA 2VWPA 1KY5A 1DJNA 2IODA 5IG2A 2OP1A 3DB2A 3DBVO 1SEPA 4KUEA 1BMDA 2V6BA 3WIEA 5DULA 1MXHA 2O3JA 3CUKA 3TQHA 1E7YA 3VH4A 3IKTA 2WYVA 5JLAA 2NTJA 2W4QA 3F5SA 5CDYA 2IZ1A 3H3FA 1HTBA 4BO3A 1DHTA 5H81A 4PFJA 2EGHA 5KWEA 1W8DA 5L9AA 4ALMA 1YS4A 2DTXA 1KEWA 2FY8A 4WOJA 2EV9A 1NR7A 1T2CA 1U4SA 5G4KA 4ALKA 3UXYA 4BKPA 2C07A 3JQBA 5KKCA 4J16A 3G3EA 4BNGA 2VYND 1M2WA 3OQBA 4AVYA 4J91A 2ZB4A 1XU9A 2NWQA 3B1FA 4LISA 3VKVA 2YHIB 3MZ0A 3U0BA 3WB9A 3JQ8B 3DC2A 3EVNA 3GGOA 4JJGA 3GNTA 4LVUA 3JQGA 4N5LA 4W4TA 1WWKA 2X5OA 3CXRA 3GUYA 5TLSA 1E1KA 3LT1A 3RI3A 2YQ4A 4H16A 3LT2A 4J1QA 3H5RA 2HO5A 3KZVA 2C29D 3Q9NA 3OF2A 3RJ9A 2AQIA 1I10A 5DZSA 3W4KA 1J0XO 1M67A 4GSLA 2X0NA 4XQGA 5IF3A 1A9ZA 4PRLA 2X5KO 2VYVA 3L9XA 5AXDA 4NDNE 2B36A 1KEPA 4J0EA 2C2YA 2YUTA 1DHRA 1R0KA 1AXEA 2OMEA 4CQLA 1GR0A 1C0LA 3DZFA 3PXXA 3DAFA 4EUFA 1ARZA 4CMCA 1GCOA 1PJTA 3BXXA 1UP4A 2HK9A 2B5VA 4GWKA 5HBRA 4AJJA 4CM8A 3ZWCA 4PLTA 4BUCA 4XGIA 4B3HA 3D3EA 1E6UA 4YAGA 4R3WA 3WFIA 4U5QA
chains in the Genus database with same CATH superfamily
1YBMA 5DH9A 4EVQA 1THMA 4MXDA 4RQTA 1UPTA 3FWYA 4G24A 3MMPA 4YT2A 4LVNA 1GILA 3U4MA 4BNDB 4TRJA 2JKYA 3KSAC 2TYSB 1IWOA 2EFHB 3FPBA 1IDN1 3MB8A 1F5NA 3A1NA 1QNFA 2QJWA 2YMLA 1KZ9A 1WMSA 2WFAA 2ZWMA 4U7PB 4HJXA 2C3OA 4NCAA 4MW6A 5AVQA 3ZXSA 1Q19A 1Z3CA 3AEUA 5AK3A 1J8DA 1JWAB 1WMDA 3BWEA 3N3AC 5CIWA 2W22A 3TZHA 1K0FA 4PQEA 4QUGA 4X6LA 1UPXA 2J87A 3MB5A 3I5MA 3PNPA 1TEZA 1ZHOA 4D41A 1JEJA 1Y37A 4LF4B 5HG0A 5ALXA 3SX2A 3KLBA 1QGOA 3D3NA 2X77A 4L9SA 5C52B 4Z3OA 5EUQB 3RSCA 4RJKA 1Q21A 3G0IA 3GRFA 4GOLD 1C14A 4LZNA 4AW9A 4QYSA 1XEAA 1FNSA 4N5MA 1Z6ZA 3Q0TA 3SSAA 3UC5A 3PEWA 2VPXA 1Z5OA 5EJ9A 4Z4CA 1JU9A 3LCCA 2FA9A 2RGYA 4PEVA 1VGVA 3EW9A 4DMUB 4EH1A 1R3UA 3PICA 3ZV6A 3MTIA 1FFXB 3P27A 5LDHA 1XVIA 2VXYA 4AJ1A 3I61A 1N4DA 3U1VA 1DAFA 1M54A 1H4SA 2ZSAA 1MJHA 1V47A 1NIJA 2QPTA 5TPZA 4L9RA 2DZDA 3K31A 3BF7A 3RCBA 3KKZA 3ONVA 2O6LA 5A4DA 2BFMA 3I6YA 4XUGB 4UDNA 5TPZD 5KNCH 5FWYA 2X0JA 3EPHA 3UGJA 2NO5A 2JEOA 5C32A 3LC2O 1S3SA 2YV5A 3BKWA 3GJSA 4ZYVA 3AUFA 2CKDA 4Q6BA 5AJUA 5DYWA 5IXJA 1W5AA 3I9JA 1G8JA 1XRLA 4QLAA 3RT9A 3J80A 3WV4A 1E2MA 3T9AA 2GUGA 2J3KA 3I1IA 4I9HA 2IU0A 3TR5A 4BLSA 3NIGB 1GU0A 2D06A 3NW9A 3R8CA 3LUCA 4HDAA 1U0HC 2I34A 2E0IA 1CULC 2GZAA 4OGGA 3BMQB 3DFMA 3LJKA 4KRGA 1Q2UA 2YS6A 4Y67A 3VMMA 4DRZA 4Z53A 1G2PA 5LYJF 3GO4A 2PSFA 3FVQA 1MVLA 1EAYA 2YOHA 2R6JA 4QRHA 4U1RA 4GRIA 1WCIB 5DTMA 3NLLA 2GAFA 1V5GA 2QMEA 5SYNA 5LQNA 1EX7A 2CLEB 4O1IA 1L5GB 4G6ZA 3ER8A 2JIQA 1K6MA 1P9OA 1U0GA 4Y7CA 3ZNOA 2Z57A 5BRNA 5HJ7A 3ZGLA 3K9QO 1CEEA 1MIHA 1S1MA 1YSCA 3M2TA 1SWWA 4ZOEA 3T3HA 4BVAA 3LA6A 1CQJA 1E77A 1YNOA 2MOKA 2OYSA 3SYLA 5JCJD 4R5MA 1G8KA 4Q19A 2C42A 2O7SA 3H2ZA 1QYRA 2EBHX 3I73A 3Q8XB 4LYGA 5KEIA 2WSMA 3EDCA 3OBIA 5HP4A 2HZ7A 4MRMA 5I7AA 1SG0A 4RJTA 1YZKA 2I7CA 4NCNA 1UR5A 2I2FA 1TM5E 4TLLB 1N33B 3D2BA 3NGLA 4K7JA 4RTPA 2UXCB 4YR9A 4NI5A 3ESBA 3QVGA 3FOWA 4JKYA 5T6BA 1O95A 3D4PA 4MJ3A 2IXFA 3KO8A 3MVEA 4ZHSA 1T15A 5A3RA 2C7VA 1EFDN 1KETA 5IAOA 5LB4A 4IIXA 4G37A 5DEOA 1UBKS 4F11A 4XYEA 2LE0A 1GEEA 1JVSA 4BMXA 2AOTB 2OCXA 3CIOA 3LUDA 4KQ6A 3F47A 3G7NA 5EL0A 3LL7A 3V80A 3AF0A 3WTBA 1TK2A 3FNBA 5CLIA 3AYXB 1JDVA 1DINA 2UZIR 3O9MA 3UV6A 3I5YA 2VTBA 1GSOA 5ELLA 3ZV4A 4W7HA 4YQZA 3HU3A 3ASVA 4HZUB 4TWRA 3TDMA 3GF4A 5HIIA 3U4GA 3KETA 1BYIA 4J07A 1V45E 4X1IB 2EBFX 4KPGA 4NYIQ 4BO2A 2FJUA 5KX5F 2G83A 3RYIB 1X8LA 3J7TA 2E49A 3VR6H 2F3QA 2JBAB 2WKWA 3DO8A 3EF3A 4QULA 1K89A 2JGLA 1XR3A 3OT1A 4B80A 5KOJB 2O23A 2DEUA 4JU8A 3QKSA 2BGMA 2PGXA 2CZGA 1ZIYA 1TT5A 3UBTA 4EPYA 1P3Y1 2VG8A 2O3TA 2OGUA 2OZLA 2JLWA 4X7MA 2G7MC 3GGPA 4L85A 2VXCA 3GWZA 4YAJA 1Y3BE 5JASA 3MRVA 4OP2A 2X8LA 2R68A 5JVDF 1VLHA 3BQMB 4E51A 5EP4A 5K0GA 4V0ME 5H4GA 5K8IA 5D7BA 3EPJA 4WXRA 4FHZA 4LTMA 3TDNA 1TYCA 1M3SA 3W6PA 3ZK7A 1NBIA 1N9KA 1T2EA 2FN3A 3DMFA 2F8SA 2WKSA 3OZIA 2BT4A 2B34A 2GJ9A 3GHHA 2XMDA 4IJ6A 4JY7A 2NQTA 4BY9E 4LI3X 1J21A 4MS1B 4MGHA 3INNA 4EJSC 5BOSB 1D4ZA 3D8HA 1T1JA 1DAKA 1RRFA 3E0QA 1FF9A 3TM5A 3RGWS 3VM6A 1B4DA 4BMDA 3O8QA 5BY2A 1CZLA 3DZBA 3WB2A 3WIDA 2P4EA 1YR6A 1ULBA 2E4YA 2GBIA 4RXTA 3RO7A 2FFBA 3Q7EA 3TLMA 5GQSA 2CYAA 1NXQA 4GQIA 4Y2YA 1J9EA 1MABA 2FPOA 3EF1A 3EUEA 3RYHA 4BNTA 4ZJUA 1NQAO 3AH8A 1CERA 4MJLA 4NPCA 3DLPX 2DRIA 5BVGA 1IPEA 1CY2A 1PYOA 4F21A 1V6SA 3NOQA 3FVWA 4ITRC 2PFKA 1W9MA 1ZM9A 4N5NA 1P6XA 3BGOS 1R66A 1D2CA 1I2MA 1QV6A 1C9KA 3UWPA 4B34A 4FYYA 2X8WA 4JMLA 4MVJA 1LDMA 3RVLA 4M22A 2WIFA 2MTBA 1N1MA 2XR1A 5JO0A 1KNXA 4GO1A 4YRSA 1U7PA 3GPDG 4GMHA 2P4UA 2VWGA 5LWHA 4GXRA 5JS7A 3EIXA 1YB1A 2DFLA 3NDJA 1BOFA 2MYPA 4R1MA 2MMGA 1Q74A 3MYYA 2WWXA 3D7KA 5AD1A 3NHUA 1X1RA 4GKJB 1F8GA 1BHJA 1U2SA 2P5UA 2QF7A 3KE8A 4KVFA 4JLJA 1YBVA 2QG6A 5DLEA 3THRA 1A8PA 3PHCA 1JFLA 4LJ6A 4H31A 3T5AA 1P81A 1R4MB 1U0NA 4NDAA 5FWDA 3HJNA 3TLGB 4B79A 4CUKA 3LUPA 1D1PA 1FLVA 5FPKA 4C1BA 4EHLA 2OILA 4J0CA 1D5WA 2XNHA 5JNTA 2DWPA 13PKA 3EQZA 1V5FA 3HZRA 3ZZUA 4HNAB 3GLHA 1SVMA 1A4RA 1ZK4A 2QAJA 4UQLA 3HDGA 4PAQA 4HRYA 2MHCA 4V1CB 2ZAMA 1TAUA 1GNQA 2JH8A 5K8LA 4LQLA 2GR9A 2Q8NA 1PYGA 2B7LA 3CLUC 3PR3A 5GMOA 4RD2A 4KOAA 1XRPA 1A4IA 4KYIB 1Z82A 3HKBA 2Q3BA 4K8RB 4BJ3A 4JELA 3N7AA 3OOSA 1WPRA 4QGAA 4XQ0A 3V4ZA 3WRXC 4WZBA 1NW4A 3FHJA 2W7TA 2EG5A 2PU7A 1YR8A 2OORC 4ES6A 3RYCA 2JVKA 3N74A 1TT5B 3PQFA 2H1FA 2JZOA 3U60B 1VSBA 1GXSB 2UVDA 3OX3A 4RJIA 1LK7A 4FSXA 3LOQA 1EK0A 1AU9A 2B78A 1UP6A 3ETDA 4GR5A 3VV2A 3ZGNA 2OXCA 1YI0A 1IN8A 4I8DA 2B1IA 4ETMA 3QFFA 1H6BA 2QUBA 2PEYA 4C1NA 3H9BA 3OP4A 1OFUA 3RBVA 4JJ7A 3OG9A 4B5LA 1U8EA 3OQNA 1VA4A 2P9HA 3OJFA 3CG0A 1ZK3A 5BSVA 4BP3A 1DZ3A 1TKCA 5AJHA 4IRXA 3JYQA 4FS3A 4DZTA 4YJ2A 3DHEA 2WNHA 3D8TA 3TQCA 3WQHA 1LC0A 3LVBA 2JB9A 2JD1A 4HQ6A 2I7DA 4NBKA 2FEMA 1DFGA 2XTZA 4LY0A 3T7TA 2H2IA 4HX5A 1OCEA 3T7AA 3VPGA 2AFIA 3T7CA 4NXNB 4ND1A 1Z0ZA 1KORA 5B1SA 4W5JA 3DB1A 3O84A 4LQDA 3P9NA 5FOQA 1VGRA 5J2UF 3CUSA 4S1PA 2Q5QA 1OWMA 4V0NA 1SOUA 1CETA 4PIMA 1CJSA 3T7EA 2A9VA 4JXJA 1AY0A 2BEKA 5I9IA 1J9GA 4Z1OA 1WAMA 2BMVA 2Q46A 3OTWA 5IF9A 1N2EA 4QJBA 3BXHA 3H18A 3OTIA 1XI2A 1EFVA 2FGKA 4DLNA 4UOEA 2M2IA 3DSRA 3T12A 2VZ9A 3DMHA 1RXYA 2DYKA 4KIFA 3TNLA 2GFHA 3P32A 2LDXA 3W2TA 4CU5A 4RV9A 3C3XA 1ST2A 1UBMS 1L4NA 1NDUA 4YQEA 4BMVA 4UUBA 3IQEA 3K9GA 1E2KA 4LZLA 2FMXA 4JQZA 3RW9A 5J4HA 5K8JB 4IXTA 4KO3S 4IHJA 4EL0A 2AQ8A 1IVSA 3WLNA 1XKQA 1S2NA 4YLYA 4Z7OB 2VDQB 4KXQA 1LBIA 1IJFA 1T2FA 3TKYA 4YO8A 2NLOA 1ZK2A 1O03A 4OXRA 1QMGA 4F5DA 2XGJA 3WGIA 4DWWA 4UTRA 1P3JA 1T5TA 3A7DA 4H6XA 4WE3A 3TIGA 5L7WA 4FFRA 3UHJA 3DLBA 3ETGA 2Q5FA 5HCNA 3PCRB 4YRJA 3A3PA 2JFNA 3D0RA 4IMJB 4IYJA 2ZIXB 3GL9A 1Z2AA 1AUOA 4DQKA 3LG2A 4HAIA 1O9HA 1H0HA 1T25A 4ZDIA 3AXTA 3UY4A 4MLZA 1BYUA 2HCJB 3VGPA 1YTUA 1U28A 3F5FA 2WSSA 4ZA2A 2NVOA 4INOA 1J90A 4TYYA 3AF3A 4EHBA 3CWQA 4KE7A 4P0PB 4TKMA 1PR3A 3IEIA 1MJGA 2WM8A 3T1NA 4J0KA 3VC3A 2ZT5A 4XUCA 1UBGA 3R3HA 1C1XB 1UZNA 2OSBA 4GAEA 1O5TA 4KSBA 4FOOA 4LX8A 3RVBA 3OFVA 3HL0A 5E7MA 3LECA 1CUEA 4V3BA 1RYDA 4IMPA 3JQGB 1OFTA 1H5UA 2AH5A 5JBIA 3ENZA 5CD1A 4FT2A 2C7BA 2PTGA 5HFNA 1DQRA 5I5GA 3AP2A 3N1UA 5F7ZA 3VZRA 1HEUA 2II6A 4XM0A 3EG5A 4ISCA 2VQEB 2PSDA 1BS2A 2V7EA 1A95A 1MCZA 3EXHB 4PLWA 4UFOA 2GXQA 2VT6A 2Q1YA 4I9FA 3WMEA 2I4RA 1FRZA 2K6GA 4Q12A 4XQ9A 1IZ8A 2A30A 2CMFA 2PS9A 3WBKA 6Q21A 5KWVA 1V26A 1UMBB 1QPZA 2JHAA 4ZTZB 2MYNA 3DWEX 1PW7A 1X42A 2ZB3A 3QIAA 1JIIA 3WWYA 1E7SA 2B9EA 1RHUA 3KC2A 4TSRA 3AXSA 4YTEA 2N47A 5GM1A 1FJGB 1Q3KA 5H9WA 3ADOA 2YFKA 5F5NA 1GUYA 1RKVA 1GL6A 4WV3A 1FK8A 2AJ8A 1XGKA 2CDAA 2K4MA 3KYBA 4JDPA 3L1UA 5JSZA 4KO1S 5C35A 3KT3A 2ECKA 3RS8A 5JAMA 1DAMA 3BXPA 3D6NB 3PC8A 2O8BB 2R2AA 2VWQA 3FUWA 2QZ4A 1T5OA 5A9SB 4NK5A 3KJQA 1V8PA 1SUIA 3QEKA 1UWVA 2MSLA 4D3DA 5HXAA 2YKGA 4CTOA 3TFQA 3C85A 3K9HA 3BMCA 4G8DA 4DV2B 2QIPA 3DA8A 1ZBQA 3IESA 1TYDE 3WE7A 2ZS7A 1EM6A 3L0SA 3B1WA 3GPCA 1FMJA 1IXRC 1VG0B 3ORYA 4QREA 5AVZA 3B6MA 3H2HA 5EHIA 1N3IA 3F5MA 4FMDB 5K6RA 3PZBA 4IDAA 5CEFA 3P9YA 5JMOA 3E9CA 4REQB 1VTKA 3REGA 1U3TA 1E1LA 1YS6A 4U2DA 5JSZB 3F7MA 4LFCB 2YJ6A 4R2XA 4O2AB 3RLIA 5HS4A 3LQKA 1G2IA 2BDEA 2XTJA 3HPRA 1GPBA 4FWTA 4Q0MA 4FSDA 5EIXA 4AIRA 1CU1A 5JJIA 1ORTA 4YMUA 5LU8A 4ED9A 3BD6A 4PCAA 3U6BA 3IEUA 5HFAA 4KO2S 4ND4A 3JQ7A 1M2OB 3ENQA 3O4FA 5K1ZA 2AIRA 5BSUA 3JAMA 5ILQA 1RYZA 1S7CA 4GL4A 1E3JA 4UKDA 5KPDA 4N47A 4AQDA 1CUDA 2VLBA 3AUJB 1RWPA 1QM5A 4LI0A 2OLEA 2ZRQA 4O4IF 4UHBA 4QDUA 1E1QD 4OLFA 1HDIA 5FBQB 3G79A 1I7LA 4QWWA 1W8IA 1L5NA 4QFCA 2I22A 4GPTA 3RIYA 1I80A 2XX3A 1KBZA 2GTPA 4EKIA 3IB3A 1L5YA 1DPGA 1U0FA 3I23A 1JR3A 2QD1A 2VTKA 3VR3A 3U1TA 3AF1A 1ZRNA 4L76A 1SBZA 1V4VA 2P30A 3IODA 5BSTA 5FULA 4D44A 1RQXA 5A3QA 1WUJS 1ZK0A 3M4JA 1E60A 4DANA 2AQHA 1ILEA 1HDCA 3GJ8A 5TV2A 4B6FA 1CS0B 3R3WA 5M29A 1SNYA 3OCWA 4N5HX 2M9MA 3U56A 2CXNA 4ALNA 1F2VA 2CFCA 3O8LA 4WCFB 4UCFA 5EUBA 4L72A 2PIDA 3WYCA 4U2CA 2X3FA 3ZU5A 2PDAA 5BRAA 1PUIA 1S8AA 1NGSA 3ICWA 5AKZA 2WY2D 3VPXA 2C83A 2DPLA 1UAYA 2I4LA 4NOMA 1Y80A 3MUFA 4WX2B 1Q1NA 2QROA 1SXJC 4EFKA 3W8EA 4DM4A 4WXMA 2HLNA 5FHRA 3UHOA 1PT5A 2IYPA 3NNNA 3VO8A 3ACBA 3PRYA 1IFXA 3LLCA 4PZCA 5LBUA 3R5FA 4N12A 3R75A 4EGAA 4QDOA 4ENTA 3E1KA 4EARA 3ZGXA 4ARBA 1JDTA 1LZLA 1UIRA 1WB4A 2DU8A 2E1PA 2H29A 2YZNA 3QEOA 4Q1FA 2ABWA 3M89A 4UU0A 4AJEA 2E18A 1KZHA 3WGMA 2GGSA 1V48A 1WB5A 3Q4GA 3EUWA 4BAGA 4B2LA 4MHTA 4IVRA 3DBLA 5LYJA 2JFOA 2PSJA 1N5IA 1P0MA 4R2IA 3OX1A 4ENSA 1YFZA 3GOHA 2DHCA 2XOEA 5G1PA 4C06A 5A2QA 4CV0A 1VKJA 3KTOA 2KE5A 2I7TA 2X76A 4QM7A 1XO1A 4DM7A 4O3MA 5KTKA 2MU1A 1BWQA 5H9VA 4KXFB 1TTPB 1MQAA 3S70A 3DDZX 1RIFA 3G88A 5TGTA 5K4HA 3KQNA 1GITA 1CQZA 4K9NA 1P2DA 1L6RA 1L5QA 2CBGA 1MAUA 1PSDA 2YFYA 4JU9A 1GLNA 1RWKA 4F46A 2X4LA 3DT8A 3VQTA 2EIHA 1BSVA 3SYRA 1XWFA 1Z5NA 3BOSA 3KQMA 4PNHA 1BW9A 1W52X 4AICA 5AFSA 3RV4A 4UM9B 1WZIA 5JATA 1DC6A 2D1FA 4Y2PA 1YB5A 4JSTA 4ALLA 4A27A 4HP8A 4Z9FA 4DSNA 4L22A 5CLHA 2VDUE 4WLNA 3V00A 5A5EA 5LQUA 1FOEB 1ORIA 3K5IA 3H7AA 1K63A 3TZKA 4P86A 5JT1A 4CEIB 1F06A 4OPMA 3V6MA 1XBTA 2I4OA 5L7TA 1PT7A 4ATNA 1NJ1A 4DEYA 3ETEA 2DTDA 5H0IA 1FU7A 4LE2A 2RHDA 4XGRA 1ZM4A 3QXSA 1F9EA 2NXJA 4A16A 3L40A 4EI9A 4I81A 5DNWA 4EQ6A 1EWTA 1QE0A 4Q34A 3K96A 3MJEA 2Q45A 2DQYA 4RF4A 1QF9A 2NV6A 4KMRA 5ECGC 1YRYE 1HT2E 2GCNA 4IJKA 4M3NA 1OIWA 3I32A 1MT3A 3RVOA 1CB0A 2JHPA 1T4CA 4Z54A 2IKQA 3VRHA 4QTYA 3AVVA 3RVQA 2C9DA 3FVTA 4DY6A 1CDEA 3MSCA 1LH0A 3AT1A 4JBNA 5IC5A 4JGBA 2ZUVA 1UADA 1C8BA 2ZJ0A 3B7WA 1N8SA 2Q4BA 4ITUA 4MPTA 4QJ4A 2V3CC 2FPLA 1XRNA 2P1DA 2ZANA 1IOZA 1WZCA 3TRIA 5HPYB 5B7QA 4GI2A 4RZ2A 5HA5A 5A7HA 4IGFA 1C3JA 3RUAA 4MW4A 4CN8A 1M2VB 1NJ6A 2G25A 5H4HA 1JEYA 2XE4A 4KQIA 2OHXA 1LUAA 4OKNA 4KXNA 3VR4A 3PR1A 5DTIA 1GEGA 1YR7A 1HM5A 2FG6C 2CFOA 3AJ8A 1D7AA 5AK5A 1A04A 4MEAA 2H51A 3RVKA 2HGZA 3TSYA 5J4LA 2VEOA 1Q0SA 4ISBA 2PZFA 4O1HA 4ZRNA 1PNTA 3FRIA 3WLEA 4MUNA 5ENDA 2PUFA 1IWPB 1PSZA 3MG9A 4JX8A 4XR9A 1OA0A 2ERCA 3A3OA 3W4KA 1VIMA 1WABA 2XXBA 3OZXA 3P19A 4G2NA 2VCEA 1NI4B 5M3BA 1J39A 1OBOA 3O92A 4MWGA 2AJDA 5B55A 3AM1A 1LRJA 3FYSA 3PEUA 4UUMA 4CL3A 3MM4A 4DMFA 2V7QD 3IMGA 5E8JA 1DOZA 1M5TA 4MQBA 1PFGA 2G4CA 3K8OE 2ODNA 4B3IA 2L19A 2PT5A 2QTVB 2PWYA 3OTGA 2QTMA 4OXQA 2QPOA 3HBLA 5EXXA 4B3JA 1UEXC 3WDSA 1MF7A 4UHFA 3KT0A 5KYYA 3L8GA 1VHQA 3LHKA 3JAWB 4URWR 4ZU3A 4QYWA 3CGGA 3EVDA 5GZ3A 3E3LA 1RJ9B 1SUCA 3DG9A 4J76A 2HBYA 3KBBA 1E0DA 2C0PA 2G0AA 4IJWA 4G8CA 1NN0A 2D2VA 5D1HA 4KFCA 1E2BA 2JA1A 4UNSA 2CHQA 5FV7A 2KLHA 1T1IA 4XYBA 2FOLA 2QQ0A 3WGKA 3KQHA 4QVGA 1GTL1 3T0IA 1RDFA 1FFWA 2B1QA 2FVXA 5JSUA 2BKUA 5DSTA 2TMGA 2Z30A 5ALYA 3VC2A 2Z2YA 4GF5A 4WXPA 2ODTX 3RUHA 4E5MA 1D7OA 4GX0A 3RM3A 4C76A 4ER5A 2IITA 5BR8B 2R47A 3EF0A 4YRZA 4K9OA 3PIRA 2RK6A 5K5EA 3LH5A 4MIOA 4R69A 2V54A 3C3EA 4MI3A 3AI7A 3TQFA 2NUTB 2WJJA 2IUYA 3VHXB 4O29A 2QLNA 4RIIA 1PG5A 3PRJA 4DRXA 1NHGA 4C9BA 1H2RS 1KMMA 3PU6A 1I0ZA 4D6YA 7REQB 3GUHA 3NTRA 3IVRA 3PUWA 2H8KA 4YJ3A 4D45A 2QXTA 4B3BA 3ND7A 4HVTA 2O0KA 4A2CA 1BXRB 1UBNA 2R84A 3CN7A 5KNDH 3QWAA 1JDZA 1E5VA 4OGWA 3VYVA 4QPPA 1PYDA 4Z4QA 3G2PA 4PG7A 1JHYA 5HQ3A 4KX3A 2IC5A 1KZ6A 1OV4A 1P5FA 3GP3A 1XRMA 4HB0A 4BN4A 3DZKA 2ZJZA 1TUBA 3B8EA 5HZMA 4DRYA 4URVR 2C2XA 4AJIA 4RTNA 1ULTA 4OHRA 3WIVA 2EXXA 2HCRA 1YK0A 4IAOA 3C8MA 2E4XA 5FI0B 3C16C 3B12A 1KJQA 1PBTA 2V7UA 4BQQA 5LWQA 1Y5LA 3HVJA 3NUZA 5EXPA 1XVTA 5A0TA 1EM8A 1SC3A 1TJPB 4OI1A 3TSZA 4AB1A 1F48A 3C5WP 3H86A 4ZFNA 4R6WA 4Z0PA 3DOCA 3AX6A 2CWWA 2YXLA 1EE1A 2XGMA 3B51X 2EKBA 2QE6A 4WBNF 5HF5A 1H9BA 1AS3A 5CX1B 1G6KA 3TIIA 2RB5A 3BD9A 1XPOA 2R97A 5EQJB 5IDYA 4R8SA 3MGBA 3PHIA 2DOKA 2REXB 3PXAA 3A4NA 4H4CA 5FTWA 4K0RA 1PZEA 1XLVA 4KVGA 4F72A 1KTVA 4FHDA 4I4IA 1XNJA 5G0SA 1R0CA 3ROMA 4O0LA 1IBSA 3GRVA 5C4IA 3H5AA 4FSHA 4EUKA 4XVQA 2A3NA 4F8EA 1N6LA 1CY6A 1QVRA 1TRKA 3IT3A 4PF1A 4MAMA 1RKUA 2NZWA 3HC7A 3NP7A 5I7OA 3W6ZA 3F6BX 5I3ZA 3I0NA 3IUQA 2QYTA 1C9EA 3AFIA 2CGEA 3WSTA 3COVA 4FKZA 4F45A 3NV9A 4QXOA 3EZXA 1P19A 3OOHA 4Y9TA 3U49A 3FGPA 2ENWA 2YXBA 1RJWA 2JDIA 2HXGA 2OLKA 2ZJ3A 2PGIA 2CW5A 1RKQA 3GDGA 3S5UA 1AV6A 1VJ1A 5EEHA 1ABBA 1KY3A 3EEQA 2B5OA 2MCFA 3ZPXA 1PVDA 1LLQA 4U7HA 4KB5A 2QNIA 3ELWA 5H83A 4FZRA 4L8FA 5JS1A 2VBGA 3AFNA 2B8TA 4HNGA 2WWVD 3EZNA 3K3PA 2QYOA 3ESAA 4WLEA 2Q3MA 3V4FA 3GEDA 4H6WA 1JR3D 4QAQA 2XOKD 1JA0A 5KJ6A 1KKMA 4QTTB 1BVRA 3A9VA 3N70A 4H1TA 4HLCA 4J1TA 4RK6A 1XTKA 4XTRA 2OO5C 4CQNA 1GGKA 1FLAA 2J41A 2GAAA 1XTQA 3BRSA 2WYWA 1L7DA 4I14A 1YT5A 5BV2P 4POAA 1SD2A 4LOIA 2I9KA 2E21A 2VOEA 3DH0A 5EIBC 3E5NA 2VHXA 3F67A 4X7PA 2CVHA 2W8BA 3JQAA 3MBKA 4HGZA 3LFHA 2AI1A 2JK1A 3TMKA 4DT1A 1JZQA 1E4EA 4RFSA 2AG0A 3RFFA 5CH8A 5EPUA 1Z33A 2PRYA 3RUPA 4BE7B 4DADA 2XD9A 3UMMA 3B3AA 2XUZA 3IBSA 4OUDA 1ELOA 1I4EB 1V8OA 1C7JA 4AC9A 1KBOA 1QFZA 3T1OA 4X60A 3HYLA 5HYVA 3CZ9A 5F4BA 4OMDA 2Y93A 5ED4A 1U1DA 2YVKA 2ZVQX 4LRTB 1D4AA 3GNQA 4YMHA 2F2TA 4OHKA 1D2MA 2PMWB 2AWOA 3C97A 3PYXA 2O59A 4KLAA 2GM5A 1A96A 1RRMA 3NKFA 2Y99A 3FPJA 3EAQA 4JLWA 3ZYZA 4EHDA 1EGMB 2PNJA 4G1FA 4DWVA 1GARA 4BP1A 1JIUA 3QPVA 3K6JA 2PZGA 1EQUA 3IJRA 4MROA 1MN6A 2FQWA 5H16A 1KVQA 1EBBA 3EXFB 1ESCA 1RCTE 3HKEA 2HMWA 2NZJA 3KV3O 3RYFB 3TN7A 1LDBA 3ZCRA 3AR7A 2V6IA 2XMSA 2O7RA 4LGCA 3T1HB 4WBNB 1ZI9A 2ZJBA 1KSHA 1OFVA 3I5UA 3KSMA 4GZLA 3VPAA 3ZHSA 1Z28A 4FEEA 3LSTA 4X8MA 4XH9B 2YOGA 2NOAA 2IUUA 3OX2A 1SHKA 3AUYA 1DXYA 1W88A 1JHDA 2CXPA 3VI4B 4YRAA 5FJIA 4OHZA 4MVJF 4WZAE 5H68A 3HYTA 1KO5A 3EZLA 4PG5A 1ECGA 3PDCA 3TX2A 3ODGA 4UMFA 4A91A 5G40A 3FRJA 1KQPA 4RD3A 4AS2A 1H5QA 3MIZA 4M7PA 2ZTLA 2D4HA 3E18A 2B82A 3WYAA 5IXYA 1ZYUA 3PHBE 3ZZ1A 2H2GA 5CM2Z 2V58A 5EJ7A 1NP7A 3M5PA 2HUNA 5AVUA 5KSWB 4MARA 3ILHA 3HKBB 3VDRA 3ZKWA 2JLRA 5FUQA 4KVZA 4MYDA 1A72A 1PWYE 1V6CA 2HT6A 2P9JA 3OQHA 3FBGA 5K01A 4JEMA 2ZI4A 3AEKA 3HL4A 5TQ2B 3LD9A 3TD9A 1XMXA 2DLCX 2XDAA 1J06A 4FYXA 3NH9A 1ZMXA 5BN3A 1S6YA 3GJ5A 1C9MA 5LNK6 1ESEA 1HFJA 4GPIB 5EJAA 3ICVA 3ZE7A 3TRDA 2N1MA 5AJTA 3BJIC 2NXCA 3DT9A 3JQ9A 4IIDA 4TT3D 2M98A 3IQDB 4XJTA 4HSEA 1Y34E 5G0WA 3R41A 1P72A 5F3RA 2FMUA 3A1EA 3TYXA 4Z2AA 4QASA 2WTUA 3UJAA 2Q3HA 1NJ5A 3E22B 3JALB 3ER9A 1T2UA 3LC1O 2C4NA 5FWXA 4ZV9A 4HY3A 3PK0A 4MIKA 4BJ6A 1QKIA 3RTEA 3LTNC 1JNYA 1OREA 1KMHA 4ZXPA 4PNZA 3B36A 2BEUA 1K3TA 1SM4A 1XAIA 2FTKE 3I01M 1PJ8A 4JBWA 5EP1A 5K51A 4GICA 4ODIA 4KPFC 3UFXB 1GOTA 3WA6A 3OEHD 5AM2A 1AS2A 1D2NA 1GNRA 3ZE9A 3B82A 3WGGA 1G5FA 1U8XX 4CM4A 4KTTE 4JNKA 2BH9A 3DD5A 4MV1A 3GLFE 4I4CA 1OI2A 1B16A 4MUBA 5ADVA 4Q9JA 4DLKA 4EMSA 4BUZA 4KEAA 2B6NA 2WD7B 1QE5A 3IR5A 4LXQA 4YCDA 1B8OA 3E9ZA 3NXSA 4HH0A 4NZOA 5C1DA 1GVNB 3QPUA 4Y0AA 3UTCA 1M76A 2C4KA 3A9UA 3O38A 3R7DA 3FFXA 4OHBA 1S9DA 4GW3A 4WLFA 1CR4A 2ICAA 3RSLA 4D26A 1JJ7A 1R0WA 3JVDA 1Q7CA 1WJGA 2G1KA 3RBAA 4HX2A 2JAXA 1H1DA 3DOOA 1M9NA 2N42A 1K7YA 2RHHA 5CB8A 3GVXA 3C3CA 3ECCA 4I1OA 3TQQA 5IDQA 2ZVDA 1QVWA 3CNLA 4WY5A 3A1SA 1FVOA 4H3HB 1PHPA 4GHWA 3FKSA 5HRCA 3DNPA 2G8NA 4CLEA 1H6DA 2VJKA 2BKVA 4C7OB 1SB9A 2GVDC 2X0EA 1XD8A 1YBAA 2XD4A 2ZEJA 4EB3A 4CG1A 2AN4A 5BNFA 1ZM3A 3VZCA 2IZ5A 5KSOA 3UXMA 3GEBA 3DXYA 5U9CA 4LJKA 2I1WA 3BXZA 4YDSA 3SSOA 3W77A 3K0KA 3A4MA 4B74A 3ZD6A 2F00A 1NSYA 3LXMA 1F0YA 2JJ1A 4W5OA 2YJNA 5DHAA 4F8JA 3ABZA 1BEUB 1ZUIA 3MT9A 3KKEA 2RGDA 3KAPA 3M1YA 1Z9BA 1RC8A 4BVGA 3NPAA 4J2OA 4BN5A 2EZ9A 5EZ5A 3L1JA 4YCJA 2H06A 5CGZA 1GGEA 2J3DA 4JUBA 4NCXA 3TTVA 5DOVA 5D2CA 4CM8B 4EY8A 1N9ZA 1QBKC 4N6OA 4QUDA 4G67A 2CNKA 1PKEA 4KP7A 5EHGA 3E9QA 3JAKB 3M4XA 2YWJA 4ZOAA 1BMTA 5TT0A 3NM6B 3QMWA 3DKVA 1M34A 2NO1A 1PJZA 2BI4A 3GQVA 3DD1A 2ZYAA 4XVUA 1Y3CE 3RARA 1R0ZA 4F2GA 5AMXA 2PV0A 3ZWYA 1E63A 2YRWA 2Q50A 3T1QA 1ZC4A 1PTJC 1YBHA 3GEGA 3R0IA 1H05A 4NKRA 1C3OA 4DLWA 1R16A 1Y7LA 4Q3LA 1PJLA 4B7ZA 4TKLA 2XYVA 5GONB 2VHJA 4D0RA 2JGJA 1TI7A 4M1KA 3ZCTA 4EG8A 4OYLA 2X7XA 1J0EA 4IDFA 2A1TS 4OYRA 4V2UA 2H1SA 5AKHA 3BWDD 3R6TA 3TR6A 1Y9DA 4NPHA 2ZAIA 3F9RA 4P4NA 1P2FA 1RTTA 1WW8A 3R3XA 1VC2A 2RIRA 1ZVQA 3AEZA 5K8UA 3AKZA 1SUSA 1SBCA 2C5BA 2IUFA 2W83A 2FN9A 2R8XA 3K8QA 4EI8A 3RNLA 3B6IA 5AICA 2YW9A 3VR5D 2G6BA 5JYEA 3JZIA 4RWZA 4P5PA 5CT8A 1C8LA 1N5KA 3RIMA 3UT5A 1MJFA 4X5OA 5AWFC 3HDJA 2AG1A 3S1AB 5L6MB 5EJ6A 3KAJA 1ZD3A 3BHJA 1VMDA 3RS2A 5C1OA 3VO9A 1CEXA 1V4NA 1HEIA 4JMPA 4MB2A 5LA6B 1Q0UA 2C5FA 4PZLA 2Y1XA 1OYWA 2V55B 1T0JB 3V4RA 1YDWA 4G5QA 1GGNA 2H5JA 3ZI4A 1UQTA 3FHTA 1RADA 2PO5A 2VSYA 3CWCA 3LP8A 1TLLA 4FMCF 4I5FA 4LDRA 3UNXA 1DKUA 4U39A 3WKEA 2CLSA 2GK7A 5K2MA 4A2WA 2MSWA 3I8OA 2Y05A 1MDFA 2EAUA 3P2KA 1MTOA 4TWBA 3AR2A 5K9ZA 5I4BA 3OA2A 3CUEF 3UK2A 1YHYA 1DG3A 1TF5A 2AFVA 2P90A 2QX8A 3O1HB 2WHRA 3RG2A 1J5XA 3PI7A 4MEJA 5JSHA 4KYTA 4L5CA 5K8VA 3K94A 4JCOA 1J1UA 3JWJA 4CMEC 2X14A 1MH9A 2WIAA 2WJPA 3L04A 3P4YA 1XB2A 3EQ9A 1EH5A 1WZEA 2C5LA 3GARA 3HRKA 3RS5A 4JJEA 3WK6A 5IKMA 1A69A 3A1CA 1XD2A 2NO6A 3DOUA 1S2IA 4IXMA 4R84A 2JIMA 3W9YA 1QDEA 2PE5A 1Q0LA 2AF3C 2DHEA 4I36A 4MKZA 4MUMA 2IS1A 2QD2A 1NX9A 1SUFA 3ZVMA 2IHKA 5K0BA 4GBGA 3E5RA 1F7UA 1AB6A 1I4WA 2NV2B 1Z6GA 3PL1A 3U44B 1KR5A 2AZDA 2FKAA 3SZMA 3GQBA 2DY1A 2IY7A 4HWPA 4OHXA 3UAYA 1E0AA 2OQRA 8OHMA 3UCEA 4M0FA 1J0BA 2FUG6 4OATA 4ZVLA 2C7RA 4J90A 4DCJA 1J99A 1ZINA 2H1LA 4RZUA 2PD4A 1JHQA 1MXFA 2C9CA 3EXEB 1LXCA 3NBAA 4ZQFA 1JMKC 4DIEA 3ZU2A 2NT4A 2A5LA 2QLLA 1XZFA 1XK6A 1DWUA 3RIGA 4EUEA 3HCOA 1PR0A 3EISA 4P08A 3O74A 4WL0A 5K4GA 3RFXA 3NZEA 3A2KA 4RC9A 1EK1A 2YJ4A 3AILA 5KQPA 3NIFB 4U9IS 2JFPA 1ZRHA 4NK4A 2G67A 3N2LA 2YZGA 1R4MA 3ZI0A 2H4WA 3LSYA 4Q82A 4CCWA 5M04A 3U19A 1EIZA 2J7PA 3PA8A 3NM5A 5C7LO 1ZXLA 1SHLA 3FGNA 4PYJA 3EVBA 1LPSA 4XWGA 5A3VA 4CG0A 4EM6A 3VGJA 5IEBA 3G89A 3IKVA 4JYZA 3KPWA 2ZOSA 4H27A 5CCBA 2DF8A 4J2HA 1MB3A 3O93A 1D03A 2IV7A 2GSWA 2WHQA 4ZEOA 2ISQA 2OGSA 1IIRA 1M8KA 4LOHA 1PJSA 1U63A 1KEZA 2QW8A 1RIIA 1DG1G 3FKJA 4TSFA 3ROFA 1DBWA 2PAFA 3QYPA 4IV5A 4BN0A 5ALKA 3IAAA 5AUQA 2J0UA 5CUQA 4E5VA 2DTEA 1TVEA 4KAXA 4K03A 3B2QA 4W5WA 1TRHA 4ZJZA 1RQGA 1Y4UA 1R5OA 2XF8A 1HETA 4TV8F 4J0JA 2OKCA 1ECFA 3I9V1 2BSXA 3JATB 2MSCB 2PWBA 3JCZA 1KPIA 4JUDX 5CP8A 3AUTA 1U5BA 3CPJB 4MZXA 1SCBA 4PANA 1BS9A 2OHHA 3GYBA 3PIIA 4JP3A 1MH1A 2GD6A 3IHLA 4RKEA 1A7UA 1HMPA 3V7NA 1NJGA 2I4MA 1MPTA 3JYOA 3E82A 3HXLA 4QYXA 4AP9A 1GTZA 1R64A 1RHKA 2V96A 1ZIDA 3H1BA 4Q1AA 4IQFA 2G5PA 2DR0A 4JOQA 3SBEA 1JJVA 3ZCXA 5DF1A 2W8ZA 1SCDA 3NNDA 3GJZA 3H9UA 4AYWA 4DC1A 2W42A 4NULA 4YJ2B 1VLMA 2QVZX 2FGJA 4WECA 1CZUA 2J45A 1OLUB 3Q15C 3EMBA 4GI7A 1PLKA 1ENZA 5CPBA 4B47A 1GPMA 1DL5A 2Q29A 3HEBA 3L7CA 4Y0NA 4M0DA 2LBPA 1N36B 3SQXA 4TZKA 2OCBA 1YRBA 1WZNA 2PX3A 3LA8A 2QL6A 3N07A 4UHCA 1JSRA 3ENNA 4F2WA 4PX3A 3A9CA 3TCXB 4KMMA 3PRHA 4BDSA 5AVRA 1FFCA 2B2NA 1I2AA 3HVUA 3PUHA 4EFMA 2HCFA 4FUTA 4WKPA 1ZXXA 1NKSA 1DSSG 3FVRA 2H3HA 3JR3A 4G0YA 4KWIA 5FTKA 5A71A 3D3KA 3KQQA 1VHLA 4PN3A 4TTPA 3HFSA 4F2PA 3HADA 3GLGB 3MUOA 4R9UC 1NQVA 1PR2A 1RAGA 3SIPA 3W2EA 3DUWA 5PNTA 1USIA 3NKVA 1SU4A 5FR2A 4ON9A 2DQZA 1QIMA 3IP1A 1KRHA 2L17A 4Q3KA 2QRZA 4UM8B 4QSHA 3KXPA 1US8A 4OMFG 2XADA 2Z8YA 4GPAA 2C2OA 1YD7A 2CL7X 4KH0A 2MINA 1OI3A 1HXHA 4FJ1A 2GK3A 3IEVA 1HDRA 2W93A 1KYZA 1YQEA 3WR5A 1R6DA 4X20B 5I7HA 3HDTA 4YV2A 2FJPA 3WYDA 1DTWB 4YX9A 5D86A 1GDTA 3D8SA 4BGVA 4GOJA 4H3VA 1UFQA 1XZKA 2CE7A 2ZRNA 2IVZA 5MF6A 3WAJA 2ZG6A 1CC1S 2AK2A 1H4QA 2FX3A 2Y1KA 3MPOA 3U7IA 4OM8A 2CJFA 3KWLA 4JLVA 3VVCA 1FU4A 5IRCD 1UQUA 1P7YA 4K6KA 2WAXA 2PY6A 1NBMD 2JAOA 3DZ8A 1ZM2A 4XA8A 1LF0A 3DKKA 5C37A 4HLNA 3VAAA 5L4SA 4MTLA 1EBFA 5E2AA 3H5LA 1RPAA 5A02A 3U6KA 4EYQA 1C4XA 1P44A