5L4NA

Leishmania major pteridine reductase 1 (ptr1) in complex with compound 1
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
284
structure length
253
Chain Sequence
TVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Chroman-4-One Derivatives Targeting Pteridine Reductase 1 and Showing Anti-Parasitic Activity.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 95
structure length 253
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5l4nA00
4CMCA 5BQFA 1WW8A 2V6FA 5DBIA 5JAIA 3QVTA 4G65A 3WQRA 1UUFA 3C24A 1G6KA 5DNAA 1W8DA 1HDOA 1VSVA 3T7CA 3VZQA 1Y6JA 4ALNA 3ZU5A 3H4VA 4Y9DA 1E6UA 4BKRA 1JVBA 1U7TA 2HK8A 2J6IA 3IDSA 4Z0PA 1SO8A 3KZVA 4DPMA 4TVBA 3DR3A 3H9JA 4YACA 3VC7A 4BO1A 4BHTA 3A14A 4QO8A 4P8RA 1YQGA 5HBRA 1CDOA 2CF5A 4R1UA 1J0XO 4KUEA 3KYCA 3OH8A 4ZA2A 1NVTA 1E1NA 4NZ9A 1WPQA 1ZMOA 1U28A 1JKJA 4BQRA 3PHLA 5HS6A 2WYVA 3S2GA 3JQGA 3U62A 1T2FA 1BHSA 3TQHA 3PHGA 3NAQA 2GN9A 1NQAO 1N1EA 3DZBA 2DFVA 2VOJA 1YWGO 3GVCA 4WGGA 4BNVA 2JAHA 3JYPA 2O3TA 3DAGA 3UXYA 1UP7A 4R4JA 3LT0A 1Q0QA 4J7CA 3UUWA 2EGHA 1JWAB 1P77A 4KUHA 5AOVA 3B20A 1E3WA 2B69A 2CDAA 3IIEA 5DN9A 3PWZA 5I8ZA 3U09A 3DO5A 1Z75A 2G0TA 4IDBA 1PS9A 2Q50A 3TZKA 4TRNA 4EYEA 3MJ4A 1DC4A 3PHIA 5B12A 4AJEA 1TA4A 2ZB3A 1GZ6A 3CIFA 3N7UA 1JKFA 2FY8A 4XCVA 2O3SA 4BNTA 2ZATA 3WLEA 1DDOA 5CEEA 1H6CA 3DBRB 3KETA 1M6HA 3LDHA 2ET6A 1I2CA 5K6AA 5TSDA 2Z5LA 4PLHA 3WQQA 1H9BA 2PD6A 3S2FA 4WLOA 3PJEA 4FJ0A 4OXYA 3DBHB 2HUNA 1RYDA 2X6TA 3EMKA 3JQBC 3GGPA 3OJ0A 3HFGA 1PZFA 4OSOA 5TQVA 5CDUA 2X86A 1V8BA 1P1IA 4GMFA 4RQUA 2G1UA 5THQA 4J1QA 3PEFA 1N92A 4JBIA 4BNHA 2PA3A 2DLDA 1Y7TA 4BB5A 3DOOA 4E5NA 3ZWBA 4AJ1A 4ILKA 2X7HA 1G1AA 1DRVA 2I3GA 4XGKA 1YXMA 2UUOA 1LEHA 4PRLA 4JN6B 3G49A 5G4LA 1YKFA 4N5LA 1WWKA 2CY0A 3U3XA 2C82A 3QJ5A 4BNNA 1YH3A 4RZIA 3L9XA 3T7EA 1E3JA 5C7IO 5CPBA 1OI7A 1ISIA 4XGIA 1PGJA 3EY4A 4DLAA 4PVCA 2BGMA 4QTZA 5COAA 4YAIA 1AHIA 1PGNA 1UDCA 3F4LA 1GUZA 3FCOA 4LSWA 4BO0A 2ZB8A 5COQA 2PY6A 1LSOA 3EYWA 2C7VA 4BNWA 1MUUA 5J23A 2JCVA 2GPTA 3EAGA 3CINA 1E1LA 4J4TA 1HDRA 2AXQA 3C1TA 3KSUA 1LBEA 1UZNA 1DEHA 4MKZA 5JW6A 1FXSA 2Y05A 4HADA 2EKPA 2NTNA 6ADHA 5FEUA 1HSOA 2DUWA 3NT2A 1DSSG 2CSUA 2OHXA 2RBEA 1O95A 3GOHA 3TWOA 4MVJG 2G76A 3WBFA 3NTRA 4P38A 3M2TA 3E6AA 1DXYA 4E32A 4YJGA 5KKCA 3D4PA 3TFQA 3JQ9C 1TT5A 1KETA 3RUDA 3FBGA 1TLTA 2I99A 3U9LA 3PFWO 3G3EA 4QECA 1HYEA 5IAAA 2VRBA 3I6IA 2W90A 2ZTMA 3KEQA 4YB8A 2AE2A 5FI5A 5KOIA 1IY8A 1J6UA 2O7SA 5L4SA 4YDRA 3MEQA 2HCTA 3GMDA 2X4GA 2DTEA 4GVLA 5F5LA 3TOXA 3QA9A 3K96A 3RU9A 2BMAA 5ILOA 4EDFA 3BXXA 5BR7A 3PGXA 4AJJA 1HDYA 2CMDA 4RCVA 1O89A 1LDNA 4M8SA 3ZU2A 3AUSA 3ZCXA 1O9BA 4CV3A 3GAFA 4UREA 5KJ1A 4JROA 2JAPA 4PLZA 1BW9A 1WMBA 1OZAA 3JQ6A 3M1LA 1OOEA 3WGQA 2JHGA 4CMHA 3UCXA 2VT2A 4YRAA 4CM1A 1MA0A 2D59A 4JXKA 4WEQA 3OJOA 3EUWA 5I8WA 3SJ7A 3RUHA 4YPOA 3RUAA 4JP2A 2DM6A 1NASA 4EZBA 5EL0A 3R3SA 3KLPX 3QWFA 4F46A 3R1IA 2WDZA 1TI7A 3AOGA 5L3ZA 2F00A 2Y0DA 1KY5A 3RBZA 5A3JA 4CUKA 2VCYA 1BMDA 1HZJA 3PWKA 3SC6A 1E3LA 1NFQA 3Q2IA 3PYMA 1R0KA 1VL6A 5K0ZA 3SX2A 1LSUA 2FR1A 1P0FA 1Y81A 3RBVA 3RC7A 2J3KA 4TRMA 1RWBA 1ADFA 3M2PA 1E0DA 3ZWAA 3QVWA 1NQ5A 2JD1A 3V2UA 4JIGA 4RL6A 2ILTA 1ADBA 1HETA 2Y1FA 1C14A 1JVSA 4DC1A 4NDNE 3OBBA 5AXBA 4YJHB 5DOZA 4GBJA 3U4HA 2YV1A 2BLLA 2JCXA 5DBGA 2AQKA 1DFHA 2GR9A 4B3IA 1I5RA 4MP3A 4GGOA 5KTKA 2VWHA 3NUGA 1F12A 3I9MA 1EUDA 4FFPA 1HKUA 1HZZA 3QWAA 1BXZA 4FGWA 2WD7B 4GH5A 1F14A 3H8VA 4ESOA 1CQIA 3UH1A 4TSKA 1GV0A 2GO1A 4AFNA 1GTMA 3PTZA 4HNGA 5A5EA 7ADHA 3GDFA 4DUPA 3LZ6A 4GKBA 2DVMA 2BGLA 2RIRA 1R6DA 1R4MB 4A0SA 1HDZA 1KVTA 3MWDB 3WWYA 4JJFA 5B4VA 4KOAA 1UAGA 2JFHA 4UVIA 1PGPA 1P33A 4Y6SA 1AUPA 4ID9A 3WTBA 2P9EA 4CLEA 3P19A 3IKTA 1B2LA 4NBRA 5DOVA 1LUAA 2X58A 1XR3A 2HMSA 4CMKA 4DMLA 3BMQA 3OJEA 1SB9A 1JDJA 1EFKA 1I3MA 1PWXA 1CQJA 2BKAA 1B3RA 2Q4BA 3I9KA 4J0FA 4KQWA 1EBUA 2BGKA 4RF5A 1H2BA 1QKIA 3JD4A 3NJ8A 3DQPA 4CM4B 4XKJA 2WE7A 3E5RA 4WUVA 1D1SA 1T2AA 3ITDA 4Q39A 2X5KO 2IXAA 3ITKA 4HFJA 3U4DA 1ZK0A 1SOVA 4XIYA 3JQ7B 4JJIA 4BMVA 5ICMA 5DCWA 3C8MA 1XLTA 4AJIA 1WDKA 3PGJA 4CQMD 4J9VA 1GV1A 2AQHA 1P1KA 1JTVA 1GR0A 2NTJA 1M66A 3DBLA 4CM8B 5FYDA 3GNQA 1FDVA 3IJRA 3KXDA 3ZWCA 2FPIA 4IMPA 4E0BA 1V3VA 3ZV6A 3KBOA 4BNKA 4BGVA 2EW2A 3DMTA 3OQ6A 4XX0A 2C0CA 2VTDA 3WYBA 1W73A 4IXWA 5IDWA 2DUUA 3OFSA 3OA2A 2VYND 1DRUA 3H9GA 3RUFA 2I3AA 2UYYA 3HFSA 4PLFA 3E1KA 4E2WA 4BKQA 2X1HA 4C7KA 5A05A 1K2WA 1YJQA 4RV9A 3IC5A 4B7CA 4J90A 4BO7A 2OBNA 5EQDA 5TNXA 3HB5X 3R3JA 2EXXA 4DVJA 1YS4A 4U6QA 3I9OA 4YRBA 5JCXA 4RQTA 2GD1O 1A72A 1B8UA 4XQEA 3W1VA 4CQLA 5B4UA 2C5AA 5A3VA 4IDAA 3WBBA 2EV9A 3CZRA 4OJNA 4D3SA 2QG4A 2VN8A 2GNAA 2IDZA 3ETDA 3FI9A 1I3NA 1HDCA 4IZIA 2PZMA 3LC2O 4TRJA 3U49A 1PS0A 3K2EA 4JCOA 1HTBA 1YB1A 2O2YA 2PZKA 1ZJYA 1EDZA 1VJTA 4GX5A 5L4NA 3ZNNA 2JCYA 2VUTA 2O3UA 4AJPA 1UDBA 2Y1GA 3F6YA 2C54A 3DHNA 3JD0A 3BTVA 4BO5A 2VRCD 3KEOA 1DIGA 4JBGA 4I8XA 1GL3A 3FF4A 4W6ZA 3D3EA 1VRWA 4MP6A 1BXGA 1E7MA 4BKOA 3A1NA 5AXDA 2O7QA 2WTBA 2H5LA 4RLHA 4C4OA 1E6WA 4CLRA 3NKLA 1IZ0A 3PRJA 2FSSA 4FOSA 4DYDA 1EK6A 4ALLA 5A9SA 5JBIA 5L53A 3ANMA 1WVGA 4DGSA 3E9NA 2VTEA 3NGLA 4WEOA 5H83A 1WDLA 4IGFA 3ZH2A 2AA3A 1OBFO 2EJVA 1BDMA 2B0JA 4D0RA 3OETA 1E3WB 5U1PA 4DQXA 3L07A 1ULUA 4L75A 5JYEA 1LC0A 5CDGA 3I52A 2WM3A 2W2LA 1NR7A 3ZHZA 4O6VA 3W8EA 3BMOA 4GLLA 2X0RA 5T67A 1K0UA 1QYCA 5CAEA 3UHAA 3W4JA 2NM0A 3PZRA 3DXFA 4UVDA 1EZ4A 4LGVA 4XJTA 4YQYA 3ZV5A 1DOHA 5TGDA 3BMNA 1RM5A 3ZWOA 2X9NA 4PG6A 3DZJA 1NQOA 3WSVA 2E37A 4W7IA 5TJ9A 3KSDO 4OAQA 4MVJE 1JAYA 2P4HX 4CM9D 1V3TA 3I9LA 3OJLA 2B4QA 2DQ4A 5JE8A 2R00C 2NACA 1T26A 3ICPA 3RROA 4FCCA 2O3JA 5JXWA 4U0KA 3NGXA 3B70A 3I4FA 4IGEA 1H0KA 4CUJA 1M76A 2YHIB 1C1DB 2AMFA 3EZYA 1U9JA 2VYNA 2GSDA 4PG7A 1LU9A 3X2EA 1EEHA 3AI1A 1Q1NA 4CUZA 1HE4A 3OQBA 3TL2A 2VYVD 3WFJA 3DMTC 3IJPA 3QW2A 4D41A 4DBVO 3ONFA 4UEJA 3NTOA 4QEDA 4ZHSA 3MJTA 4I1IA 1E7SA 4H7PA 2GCGA 2H63A 1GCUA 3L6OO 1KOLA 1BSVA 4AICA 1LQUA 1R12A 4WPGA 1PR9A 4NHEA 1LLCA 3INGA 1NFRA 4D45A 2OUIA 5KJFA 1ZEMA 3IKVA 2O3QA 3M6IA 3OA0A 4GL4A 4FN4A 5G0VA 1ZUD1 4J9UE 3VPGA 1LQTA 5C7LO 3ZWXA 4B7XA 4JX8A 4QQRA 3MTJA 1FF9A 1Y8RB 4BNXA 3U0BA 4YJFA 3OIFA 1PEDA 4MP8A 1PSDA 4GGPA 4BNLA 4BO2A 1ZBQA 4DQUA 4ZJUA 5JCJA 3TDKA 2RCYA 5KJCA 4Q3BA 2C20A 4L74A 1QYVA 2VHWA 4K6FA 4GX2A 1X1TA 3LLSA 2Y68A 3GZ4A 5F1PA 4BO8A 1TT5B 2AW5A 3PJDA 3DZFA 3NT4A 2F1KA 1ULSA 4W4TA 4FDAA 1HDXA 3DAFA 4Q3CA 5G0WA 1A9ZA 3I83A 4RPKA 1NR1A 2DU8A 4MKXA 4RPHA 5K6AC 2CZCA 3D1LA 3STHA 4GKVA 1NHGA 1L7EA 2PZJA 3P7MA 2RHCA 3WQSB 1BWSA 1PJ3A 2Y0CA 2Y1OA 5A5FA 1C3VA 3S1LA 4E2XA 1NQTA 2C29D 3ZU3A 3PXXA 4MVJP 1CERA 2X23A 1BVRA 4CLDA 4P4NA 5JS6A 3MOIA 2QW8A 2VT3A 4HFNA 1YGYA 3D3WA 3O26A 4BNIA 2ZJ0A 2RAFA 2NQ8A 1J5PA 1N9GB 4PLPA 1MFPA 1BTOA 5GZ6A 5F3RA 3SC4A 1X14A 2WYUA 4Z0TA 4RF3A 2SCUA 4YQZA 4PIVA 3RI3A 1PU2A 3VH4A 3FTNA 4A2CA 4CMAA 1I30A 4XDZA 3JQ8A 3UCEA 3KB6A 3C7DB 4A5OA 1N1GA 3I6QA 3ICCA 2E49A 4RJTA 3K30A 4PGFA 4DIOA 5JFOA 3JV7A 2PWZA 1DRWA 5TJHA 2J5RA 3ZNPA 5JDIC 1OC2A 1IUKA 1LDEA 1ISMA 2JJYA 3PP8A 4OHUA 1J4AA 3GF4A 4O59O 4HXYA 1NWHA 1GY8A 2AHRA 4HKTA 5ITWA 2VUUA 2YQ5A 4MOWA 2HMWA 4K28A 4B3HA 3R6DA 4I08A 3VH2A 1AN9A 4CV0A 1ZKMA 4XJSA 1Y1PA 2VZ8A 1EFLA 4CM9A 3QVSA 3EVTA 1MFZA 2FPGA 1F0YA 4LVUA 2NVUB 2Q1TA 1XWFA 2O3RA 3JQAA 4R3NA 3ASUA 3AM5A 1B3BA 1KEPA 2B4RO 2J3IA 2GDZA 4OQYA 1DC6A 3HDHA 1MXFA 4OO3A 4E4YA 3GVXA 4D3DA 3PYXA 1PQPA 3GC6A 3VOSA 1ZSVA 3PPIA 3FTPA 1R0SA 5JO9A 1YL7A 2CDBA 2RH4A 4RPLA 2B5WA 2HSDA 3JD2A 3TPCA 3DL2A 4CLOB 2GZ3A 3N74A 4A27A 1H93A 4HWKA 3OF2A 3QV1A 4P4LA 3BAZA 1NAIA 2WE8A 1EUZA 5JO0A 3I5MA 1WDMA 5AXCA 1LJ8A 5CFZA 2Q2QA 1PJTA 2O48X 4J4HA 1E92A 2IODA 4NNJA 1QORA 2PGDA 5IXSA 5DBFA 3L4SO 1HE5A 4D7AA 3BHIA 5A06A 2DTXA 4NK5A 1RYEA 3WWZA 1GYRA 3JQEA 4FQ8A 2R2GA 1GQYA 1ISJA 2HLPA 4R1TA 2VHVA 5CG2A 3PJGA 4FFRA 4MKRA 1M2WA 4EJ0A 4BO9A 3PQEA 4YAGA 5FF9A 4YXFA 2DPGA 5T57A 3BTSA 1ZK4A 4R41A 3ULKA 3B6ZA 2I9PA 4KP7A 1LLQA 4BQPA 2FMUA 4NI5A 4F6CA 1T2EA 1E3EA 1DC5A 1Y5RA 4N5MA 3Q9UA 1KVRA 4ND5A 4IDCA 4PLCA 3DONA 4MVJF 3ZHYA 4PLGA 4IQ8A 3WGZA 1T4DA 5CPFA 4JGBA 3RFTA 3VKUA 4JP3A 5TX7A 5DZSA 1UXJA 3ROMA 2NVUA 3H5NA 4R3WA 4GI2A 4XYMA 3RD5A 5JNLA 2A92A 3OQ1A 4K6CA 5T6BA 1P1HA 4U8GA 4CQMB 5HS4A 3L6EA 3JYNA 3GUCA 1C0LA 3QWIA 4J7XA 4D44A 1GZ4A 3F5QA 3E03A 1I10A 4FJ1A 1UP4A 4LRTB 4OYRA 1D8AA 3T4XA 5B37A 3VTZA 5LCXA 3HWRA 5H82A 3S8MA 2J5QA 1HE2A 3ZWPA 4J2OA 3WG9A 1KVQA 5IN5A 3VDRA 2X22A 2EG9A 4BUCA 4YAJA 4N5NA 4R1SA 4I5EA 3OHSX 5AXAA 3FNEA 4YYZA 4J91A 2H9IA 5JLAA 4WE3A 1C1XB 3JYQA 5EESA 5G0TA 1DIBA 1HF3A 1FDWA 4FIZA 2AQIA 2JD2A 3A4VA 4HV4A 3GR6A 3ZW9A 4ZQHA 2J3HA 4UAGA 1NFFA 2H1SA 1DJQA 5DP2A 4BKUA 1T25A 2D3TA 4DREA 5JCJD 3CMMA 1QYXA 3D3WB 1JLLA 4CV1A 5KIAA 3WR5A 5L7WA 1LI4A 2UVDA 4ZRNA 4A10A 4CR7A 5A9SB 1HYGA 2W2LD 4E12A 1D4FA 4FFNA 4D0SA 1I01A 1UR5A 3G17A 4W82A 1B16A 1Z7BA 3QQPA 1RM4A 3VPSA 1S7CA 3AUTA 3CMCO 4FW8A 1ENYA 1YOVB 4KDEA 3H9UA 3TL3A 3E9QA 2P9GA 2WMDA 1Y9EA 3ZV4A 2TMDA 3AFMA 4EEXA 1PJLA 1SAYA 3SLKA 4CM5A 1A4IA 3U5TA 2PFGA 4OKIA 4FPXA 1PJBA 2DTDA 1V9LA 3FHLA 2CNBA 2NUAA 2Y99A 4FFLA 5TC4A 4B8ZA 1LTHR 1DPGA 2ZJ1A 5EJ2A 3DWFA 2VNAA 5GY7A 4CL3A 3NRCA 2Z95A 3MCVA 4CPDA 4NFSA 3OP4A 2NU6A 3W6ZA 1T1SA 1GPJA 4CR8A 4PZEA 4JNKA 3ZZNA 4RPJA 5TS3A 2OZPA 1XGKA 1DAOA 3SLGA 1F17A 3DDNA 3INRA 3OECA 4RVHA 1MB4A 3NDJA 4TZKA 4WNCA 4Z9YA 2YHIA 4I9HA 3ZNQA 3JYLA 5CG1A 1FJHA 4U5QA 3W4KA 1F8FA 1X0XA 3LQFA 4IJVA 3IQDB 4NU5A 4DLBA 2I5PO 4K9DA 4A73A 4J3FA 5A04A 5I7EA 3KVOA 1U4SA 5I7SA 1D3AA 2Y1CA 4HUJA 3DBVO 1XQ6A 1HDGO 4GPD1 1E5LA 4Q3DA 4KWHA 4WLFA 4B7UA 3JQ7A 2QRLA 1DHRA 3CH6A 3FNFA 3CPSA 5U9CA 4IS3A 1C1DA 4E2YA 4R16A 3DZKA 5KCZA 1UXIA 4E33A 5I7VA 3MJEA 4S3MA 1U1IA 2PH3A 4TRRA 4E3ZA 1B14A 3PZBA 4BIIA 5JC8A 5DCYA 3E82A 4NU6A 2FRDA 3PQDA 4W99A 1IULA 3ADPA 1P9LA 1XDWA 1WZIA 3H2SA 1ZK3A 1AE1A 2AEJA 4N7RA 3VDQA 2QQ5A 3JSAA 3UICA 1KVUA 3AU8A 2GRAA 4Q3EA 3RCBA 4IINA 2DT5A 5F1KA 1GEEA 1NYTA 3CEAA 4YAEA 3ASVA 3A28A 1Z7EA 2DBRA 4EITA 5G4KA 2NV6A 4PZDA 3TSCA 1GYPA 4NQZA 1UXGA 3HB4X 1DHTA 1BXKA 2TMGA 4OM8A 1NWCA 4Z9FA 2YW9A 1FK8A 1HL3A 2FN7A 4KMSA 1GUFA 4Y8VA 3I3OA 3FBTA 4ZQBA 5JDIA 4AJNA 2YHUA 3PHHA 3ROQA 5H81A 3DOCA 4B4VA 2E48A 4OH1A 3SVTA 4J4BA 2D2IA 1U7HA 3V5NA 4A7PA 3IOYA 3DZGA 4I9UA 1QLJA 4URFA 4GX0A 2Q1WA 3D64A 5HRUA 4D46A 4CLRB 1RM3A 1R15A 4YJHA 3G0OA 2Q45A 4HX5A 1DIAA 2VOEA 2O23A 1H6BA 2C07A 4R54A 4YWJA 3LLVA 4EBFA 4Z9XA 4H15A 1X1EA 2O4CA 3PDUA 2VWPA 2RH8A 2D5CA 4IUYA 1C0PA 1K6JA 1B26A 3JQAD 3W8DA 3HJAA 2NVBA 3UW3A 4CQMA 1ZK2A 3GVIA 4WCFA 2B35A 4FD3A 3GFBA 4FC7A 3L4BC 3WGTA 5KVVA 4E2ZA 2Q1SA 1P74A 2HRZA 1H9AA 2YUTA 4B8WA 4Z3DA 5BNTA 1SNYA 1E7WA 1MX3A 1ML3A 1ONPA 4CMJA 4XYLA 3KYDB 4B4OA 1LSSA 1UZMA 1R4NB 3VVBA 5CDTA 2PGJA 4JJGA 2W4QA 1GADO 3KLMX 3S2IA 4JBHA 1SEPA 4MVJA 4CODB 2QZZA 1Z6ZA 4ALJA 3OM9A 4XRGA 3UOGA 3KSZO 1R66A 3SEFA 1YQDA 1F06A 3LT2A 1EDOA 3FR8A 4RZHA 5DCUA 5IG2A 1RJWA 1E7RA 2P2SA 4JQCA 5JAZA 4BOYA 1QSGA 1U2GA 5TLSA 3V1TC 2W8ZA 2NNLD 1MC5A 2GASA 2O2SA 2EJWA 2I76A 5JMPA 3VH1A 4CM8A 1YOVA 1I3LA 1GUYA 3FWNA 1Q7CA 3BMQB 4XIJA 1YB4A 2YDXA 3JQCA 5IJZA 3ZN2A 4O63O 1KVSA 3WJAA 4EJ6A 1XG5A 1DIHA 1W6UA 4BB6A 3MJVA 4BO3A 5C7OO 3GUYA 5CEFA 3KM0A 3IUSA 1UXHA 3VPXA 3UCFA 1ZK1A 1ISFA 2P5UA 3NV9A 5A02A 2OBYA 2JL1A 4ZD6A 5I9LA 1SCUA 4TQGA 2XAAA 4FBGA 4FR5A 3S2EA 4NBVA 3W4IA 3WTCA 4DA9A 1MP0A 5EERA 4Q9NA 1FDSA 5A03A 4LISA 3WFIA 2J8ZA 4D43A 1YBAA 3HQ4O 1JU9A 1IL0A 4FGSA 1YBMA 4TZTA 4DRYA 4INAA 3KRTA 2GUGA 3EGOA 5AYVA 3VVCA 3WS7A 3HZZA 1QMGA 1R0LA 2VHXA 1YE3A 4RDIA 4B3JA 5JDCC 5T8KA 1LDGA 3PFFA 3JQDA 1PJSA 3QSGA 1NPYA 1ZJZA 1VJ1A 3N58A 4GQAA 4LSMA 1NX6A 1P0CA 4R5MA 2X9VA 4PG8A 1ZZEA 3H5AA 3JQAB 4M86A 3ZI0A 1YVEI 3GGGA 3PIIA 4OXKA 5C5IA 2JHFA 1OFGA 1O5IA 1E3SA 2EW8A 5ER9A 1O6ZA 1CF2O 1F8GA 4XYEA 1YQXA 1P1RA 1BXGB 2QIOA 5L95A 4EI2A 1T2CA 3RC2A 5IXYA 1E6EA 1G0NA 2R00A 4CLXA 2AEMA 4G5HA 4RVSA 4AJHA 4XYBA 1SB8A 3AY7A 2HRBA 5KKAA 4FC6A 3RU7A 1LRKA 4AJ4A 3Q9NA 4DC0A 4NJOA 4BNGA 3I4CA 4XDYA 2EGGA 4NFYA 3DTYA 1QV7A 4OOFA 3MZ0A 3HG7A 3O8QB 4M54A 3FNGA 2NU9A 1NHWA 3G1UA 1OMOA 4L8VA 4R01A 4ZQEA 4DMMA 5C37A 5I9NA 3H3JA 1X7DA 3HNPA 1BVUA 2B37A 2HDHA 2QRKA 1N7HA 4IIUA 5EQFA 3GN2A 3ZWNA 1NVGA 3Q11A 2CD9A 4YRDA 4ZRMA 3FD8A 4Y6RA 1CYDA 3VZRA 2PH5A 2GN4A 4IM7A 5T64A 4RGBA 3VPFA 3H6KA 3SJUA 1CEQA 1M67A 3DBRA 4J1TA 1YDEA 4LCJA 1PQUA 3NYWA 3GLQA 4WLVA 5ILGA 3COSA 3LC1O 1O94A 5IFLA 4M55A 1U3TA 1NVMB 5HM8A 4ND1A 4CMIB 1PR3A 5L7TA 1IHXA 1V6AA 2A9FA 2ZKLA 4O0LA 4ROSA 3VZPA 1DLIA 3K73O 3FSRA 3HUDA 1K6XA 3A9WA 1ZSNA 3RWBA 3GVHA 3RASA 1IB6A 3D7LA 5JAMA 3H2ZA 4UEOA 3ROPA 3GVPA 3UFXA 1IE3A 1Q0LA 4LMPA 5IDQA 4J16A 4IQ0A 2HO5A 3IP3A 4OSPA 4DIFA 4RLSA 5CP8A 1O8CA 3H7AA 1R16A 2P5YA 1A9YA 3TJRA 3BHMA 4D79A 4CMBA 4PZCA 4RF2A 5GMOA 1IPFA 3V1YA 4TKLA 4XRRA 1QRRA 1X0VA 3OEWA 1CJCA 5JPIA 5F21A 2GLXA 3PJFA 5A9TA 1A71A 3IS3A 1WZEA 2ZB4A 3QLJA 4GWKA 2G82A 4NBTA 4YJFB 4I5GA 1A7KA 4RVDA 3RIHA 4BGEA 3MTGA 4AG3A 3V8BA 1EK5A 4W7HA 1V0JA 1KYQA 3GHHA 1KC1A 4DYVA 1N8KA 1XU9A 2EHDA 2BELA 3F5SA 1DFIA 1EMDA 1QYWA 1ZO8A 2QYTA 4IXTA 4OL9A 5GZ1A 4XYGA 5EN4A 5CDYA 1C0KA 3V1UA 3CTMA 3GG9A 4QUKA 2ZYDA 4U7WA 3ZHBA 1U3WA 1AGNA 4L9RA 1N5DA 3TOZA 1RM0A 2B5VA 4MINA 4TROA 4XB1A 1EUCA 1HWYA 4OGWA 3GHYA 4HFRA 4J49A 4TMFA 5IN4A 4DTIA 2E4AA 2IEDA 4TKMA 1PZHA 1U2DA 1UAYA 3GQVA 2DPHA 3HDJA 3FRJA 1Q0HA 4QO7A 2ZTLA 5KVSA 4UUPA 1LNQA 1U8FO 2C2XA 4YA6A 5T5QA 5A4DA 4ZQGA 2IEBA 3RUEA 3DFUA 1ZH8A 1ORRA 4I9NA 1VI2A 4IZHA 3ZNOA 4E13A 1CIVA 3L77A 5L4LA 3BA1A 3KUXA 4MVJM 5IDYA 3OMLA 3F1LA 1P31A 2EP7A 4ALIA 3V2HA 1LRLA 4NIMA 3Q3CA 3IUPA 3UF0A 1E1MA 3PYLA 4ALKA 4ALMA 2EP5A 2CF6A 4E6PA 4XR9A 2AG5A 3BMNB 1Y9AA 1BG6A 2D8AA 3I1JA 3O03A 1XELA 2GZ2A 2HJRA 3KV3O 4GX1A 3QY9A 3HN2A 2GZ1A 2EERA 3NX4A 1K89A 4KUGA 4O5OA 4CR6A 1P44A 3DBHA 5KNLA 1X13A 3BMOB 4E5YA 1XKQA 3H65A 4BKPA 1UDAA 2I65A 3W8FA 1NAHA 4XD2A 4J6FA 2OOSA 3HADA 4MPDA 1EBFA 3SBOA 4RPGA 2DAPA 3AK4A 4NR0A 5MDHA 3WXBA 1ADCA 4BMNA 2HK9A 3WX0A 3V2GA 4L4RA 3QWHA 4MDHA 1Z73A 3X2FA 5TRTA 4BNUA 2WWRA 1VE9A 3DFZA 1XSEA 3EK2A 4NH4A 2GGSA 1GFSA 1H94A 1YONA 3NTQA 1UJMA 4AJOA 3UGKA 3GDGA 1MG0A 3UN1A 1P45A 2PKQP 1LRJA 5L45A 4RF4A 1D1TA 2HU2A 4GLOA 2POQX 5LDGA 4BS9A 1EE2A 3M1AA 4OKNA 1YJ8A 3EZLA 1GYQA 1T2DA 3EHEA 4HY3A 4JK3A 1ISHA 2W2KB 4DQVA 4LRSB 4IS2A 3EW7A 1ENOA 1LDYA 4YJGB 1K5HA 4L0QA 3ONEA 1JW9B 3IL2A 2DKNA 5MGBA 1EQUA 4CLOA 1NP3A 3KYCB 3LK7A 4L76A 3O38A 2CDCA 3LF1A 1I24A 4AJ2A 3Q6IA 3WB9A 3NEPX 3Q0EA 5BSEA 1ARZA 5KWEA 4Q3AA 2CVZA 4OQZA 4R68A 3RBXA 1HE3A 3I23A 5THKA 2A35A 4R9RA 3GGOA 4CMIA 2YQ4A 4OMUA 1QXSA 3LC7O 3GPDG 2E82A 2Y1EA 4IDDA 4NG5A 3OSUA 3O4RA 4MJLA 2C59A 1VKOA 4IDEA 4PLTA 2AG8A 2BI8A 5IZ4A 3RKUA 9LDTA 3P2OA 4R5HA 2IE0A 5HA5A 1E7YA 1SMKA 4BV8A 4WCDA 5TT1A 3KYDA 3PI7A 2GF2A 4FFMA 3KO8A 4FB5A 2AQ8A 4WOJA 4J1NA 2AEFA 2HK7A 2IRWA 4IY1A 4F6LA 3HE3A 2V65A 4CM6A 3B1FA 2OP1A 4IQGA 2J5KA 3MJCA 5ADHA 3BHJA 1LLDA 3F46A 3DB2A 3O8QA 3E5MA 3ETEA 4YVFA 1JA9A 4DXHA 3TZHA 3LSYA 2IZ1A 3D5TA 3RSHA 3RQSA 1E7QA 5F1OA 4PCVA 5ENVA 2DC1A 2WJPA 1I8TA 1WXDA 2JFFA 4CLHA 3D0OA 3QIVA 1K3TA 4B4UA 1DBVO 1I33A 2D5AA 3DZIA 4I5FA 3B1JA 1N9GA 5EINA 5FI3A 1VL8A 3DOJA 1ZNQO 3GEGA 4PLVA 1ZVMA 1GDHA 4NJMB 2VUSA 3FN4A 4EUEA 4OOEA 3F9IA 4KZPA 4MIOA 1GEGA 3WOHA 1R4MA 3SXPA 3KHUA 3CKYA 2HKIA 3BTOA 2BFPA 2HMTA 2QZ9A 3C85A 1ZMTA 3L4BA 4E30A 1ZFNA 3H5RA 3WGHA 1WMAA 2I66A 2Q2VA 4HNHA 3CE6A 4R1NA 1PL7A 1X7GA 1JKIA 3DTTA 1VM6A 3FNHA 4PRKA 2P4QA 3QE3A 4BL5A 2VZ9A 4DLLA 2V7PA 2JFGA 5JYDA 2DBQA 3MOGA 4J7UA 1U5CA 4KTVE 4E21A 4ZU3A 3AOEC 3JQGB 1KEWA 4Z6KA 2X0IA 1HYHA 4CMEA 3CSDA 4R69A 4WLEA 2EEZA 2ZYGA 1XIVA 2ZCUA 1CWUA 4J0EA 4P4GA 4CMEC 1T1RA 5GZ3A 2C7GA 3ZWWA 3QHAA 3C1AA 3ZHXA 1PS8A 4XEHA 3NT5A 1TT7A 2CVOA 1ONOA 1YRLA 3H9EO 4BO6A 5JSFA 3F1KA 3VH3A 1I0ZA 2Y93A 4GWGA 2FHSA 4RVGA 3C7CB 5TT0A 1XEAA 3PWSA 3UKOA 1MG5A 4EUFA 1LDBA 2NWQA 4UEKA 3GZNB 4FFOA 3WIEA 4B4WA 1JQBA 3E9MA 1PJ2A 2QX7A 1CRWG 4BMSA 3AM4A 1KERA 2PZLA 3PQFA 2XXJA 1UZLA 4NBWA 3BMCA 1AXGA 2X8LA 2NU7A 1R4NA 4BNYA 3TFOA 1XA0A 3WGYA 4DPLA 4O1MA 1B8VA 1Z74A 4Q3NA 3HSKA 3GPIA 5IZCC 4PN3A 3VZSA 4A03A 1DB3A 4J43A 4HBGA 4Z0HO 3TZ6A 1GCOA 1L7DA 4NPCA 3GH3A 4E31A 2NQTA 4NFHA 4CV2A 3VTFA 4M1QA 5ER6A 1M75A 4WCFB 1WNTA 2ZCVA 4P22A 2O50A 4QFDA 1B7GO 1PJCA 3GK3A 3P2YA 3K2BA 4H3VA 3U4IA 1X7HA 3AUAA 4GSLA 4K1LA 4N18A 4ZN6A 1LC3A 4EW6A 3ADOA 1KEUA 1Q2XA 2GERA 2YY7A 4FSHA 2ZYAA 4M89A 3WNVA 3QVXA 4AL4A 3HDYA 1A5ZA 5KJ6A 1GQQA 2BH9A 3WICA 1PQWA 3KTDA 5T8KC 2P9CA 5JDCA 4F3YA 4I5DA 1ZW1A 3VHRA 1SOWA 1ZXBA 3MWEB 2W2KA 3BIOA 3RAJA 3B1KA 1GAEO 1Y8QB 4KDFA 1G0OA 1TVEA 3INTA 4G2NA 2BHLA 1ADGA 2GN8A 5JC1A 2Y1DA 4QSMA 3PIDA 2YFQA 2EKQA 2Q49A 1PJ4A 2D1YA 4FS3A 2AE1A 2XOXA 4L4XA 4TVOA 1AHHA 3ZWYA 4Z3KA 4QX6A 5ITVA 2ZB7A 3LF2A 3TF5A 2ZK7A 3K6JA 2BI7A 1MV8A 2FSVA 1LX6A 1P1JA 3C3XA 3QP9A 1HT0A 4OXNA 5A9RA 5IDXA 4IPTA 1PX0A 2YDYA 3WIDA 4KQXA 3W6UA 3G1TA 2PTGA 3GMSA 4TWRA 4IBOA 2PD3A 4WJZA 2P91A 1MC4A 4WCFC 3K31A 2DFDA 5DP1A 4YTEA 3U4CA 4YCAA 2HQ1A 3NDIA 1GU7A 3L6DA 4NBUA 1LXCA 2B83A 1LDMA 2I6TA 3AI2A 2B36A 2PR2A 5CEJA 4DWVA 4WLNA 4N54A 1SPXA 1NPTO 2BFMA 2UAGA 4AJLA 4BVAA 4RO0A 1EE9A 3CXRA 4GAEA 3ROKA 3E48A 4L4SA 3ZW8A 4YBZA 4WK6A 2FWMX 3WGGA 3JQ8B 1V3UA 2BD0A 2B4TO 1N2SA 3GNTA 2VHZA 3ORFA 4PG5A 3WSWA 1J49A 1ZXLA 4E5PA 1UP6A 1VL0A 4ND3A 1KY4A 5B1YA 3JQBA 1VC2A 5L40A 5JY1A 3ONDA 2ZQZA 3RKRA 4X54A 4Y98A 1KIFA 4YT2A 2OO5A 1D7OA 3AY6A 1KC3A 2ZIZA 4DPKA 4LW8A 4PLYA 5L9AA 1EVJA 2IZ0A 2IYPA 4EUHA 3ZGYA 2C5EA 2PNFA 2PV7A 3D4OA 1W0CA 2JD0A 4RORA 2UDPA 4MIYA 4BNZA 2ZTVA 1FDTA 2VNSA 3LYLA 4BGUA 3F3SA 3GNSA 2CVQA 1E1KA 3G79A 5KJEA 1ISGA 2HAEA 3I9JA 5TF4A 1WAMA 3GA0A 4YJDA 4Y6PA 4II3A 3DMYA 3VAZA 3EC7A 3DC2A 1BW9B 2DBVO 1JN0A 2A94A 4QXMA 5BSFA 4LN1A 4BO4A 4UUNA 3PVZA 3WLFA 2GN6A 4IIVA 4RVUA 5ENDA 4CM4A 1QV6A 3GRPA 3AI3A 5COBA 1BRMA 4NMHA 1S6YA 1C0IA 4GVXA 5BNFA 4UVHA 5JMWA 2XXBA 4ONEA 1ZCJA 4R51A 3E18A 1YO6A 1E3IA 3L0DA 4YEDA 5HTOA 4XB2A 2HMUA 1SBYA 3RUCA 5CHEA 5A1TA 2HJSA 3C1OA 3FPCA 1U3VA 3TZCA 2DBZA 4W9NC 5TIIA 3QWBA 3TN7A 1QP8A 1DC3A 3RFXA 4CL8A 4UVEA 3LT4A 5ICSA 2Q1UA 1WP4A 2EKLA 1AXEA 4UUOA 4BGIA 3EVNA 4ITUA 5KVCA 1OC4A 2YV2A 3UAGA 3LU1A 2NADA 1PTJA 5DT9A 3DHYA 1MXHA 3GY0A 3T4EA 4OIMA 1HSZA 1A4UA 1IPEA 1ZIDA 1TXGA 5EPOA 3AM3A 3GT0A 3BYZA 4NK4A 5I9MA 4EGFA 4YT4A 5JY6A 5BT9A 3QRWA 1IHYA 1LSJA 2Z1MA 3I9NA 2X0JA 3GRKA 4CM3A 5BNIA 4ZQFA 8ADHA 1PGQA 1XYGA 4IJKA 1EVYA 4JLWA 3GFGA 1Q7BA 5EMHA 4U0JA 2OXIA 3PLNA 3RFVA 3RJ5A 4MVJH 4WASA 3K5PA 4WKGA 1HEUA 3FPLA 5G0UA 4GMGA 3A06A 3DHEA 2WSBA 4UVGA 1U8XX 4ZVVA 2ZQYA 3H3FA 2IXBA 1XHLA 1DIRA 2VYVA 2HMVA 1V35A 3E8XA 4K26A 3RJ9A 1KS9A 2Y67A 1SC6A 2PLAA 3HN7A 2PD4A 4IDFA 2G17A 3AJRA 3QVOA 8LDHA 3AW9A 4KTTE 3C7AA 4FOOA 2NSDA 1WLYA 1L1FA 5AQ1A 3IMFA 4ND2A 1EQ2A 2Q99A 4MVJD 1PZGA 4QT0A 4L73A 1BDBA 4MIEA 3R0IA 1Y5MA 1KEVA 1NPDA 2IYOA 4EEZA 1FMCA 1U3UA 2Q4EA 2E6UX 1UXKA 3ANLA 1PJQA 3AOEA 1N7GA 3MJSA 1VKNA 2H6EA 4FJ2A 1LA2A 3AFNA 4D42A 1KBZA 1T24A 1YL5A 2FZEA 4U6SA 3VKVA 3K92A 2YZ7A 1I2ZA 4DIBA 3ZU4A 2UV8A 1QG6A 5FWNA 1IYZA 4XZ3A 4ZGWA 1NM5A 1Y8QA 4M87A 3GEMA 2G5CA 1MLDA 4YR9A 3AU9A 4AJKA 1JWBB 3GDOA 4UUMA 4CMGA 1B8PA 2X0NA 5ES3A 2NLOA 2UUPA 3OIGA 4XQCA 1R37A 2QYSA 1HXHA 3KOUA 5BSGA 2YV3A 3JD1A 1PL6A 1PIWA 1VJ0A 1GZ3A 2QHXA 4IMRA 3LVFO 2JKVA 1M6WA 3OIDA 3ENNA 3KYBA 2W98A 3EDMA 1DJNA 2OL4A 3PLRA 4UULA 3ZDFA 1TEHA 2EIHA 4PVDA 3NJ4A 1Z82A 1ID1A 3TZQA 5C3MA 1NNUA 4CJXA 4ND4A 4B79A 2PKQO 3CZMA 2P68A 4IDGA 4XQ9A 4RDHA 2Z1NA 4D3FA 3HDQA 3JTMA 2BF7A 3WYEA 1PL8A 3Q2KA 3IP1A 2VRCA 4PG4A 2PGLA 5KVQA 2OGUA 4XR4A 3K9QO 2X9GA 4LVCA 3WGIA 2PKRA 4CM7A 1ONNA 5FFFA 1EVZA 1YBVA 4YAKA 2FP4A 5CDSA 3JQ9A 2O4UX 4MVJI 4WECA 7MDHA 5JAQA 1MGOA 1X15A 3HHPA 4Y67A 1GQ2A 4MO2A 1SEVA 2OP0A 3AY3A 2C2YA 3IAHA 3WMXA 1NTOA 3PK0A 3GZNA 5G2OA 5LC1A 4ZICA 1YB5A 1O0SA 1XU7A 3PDJA 4DL9A 4KWIA 5LDHA 2Q2WA 4G81A 3D4NA 1I32A 1BGVA 2D0IA 4GSKA 3TNLA 1PGOA 3DZHA 1U4OA 2WEKA 3DEYX 5L51A 1VSUA 4RVFA 3P5SA 3ENKA 4BNJA 3K8ZA 2WD8A 1E5QA 4R9SA 2FR8A 2VWQA 3UVEA 2NVWA 1ENPA 4M49A 4F45A 2J3JA 3JYOA 1EVIA 4IJWA 4BV9A 3WYCA 3RVDA 4C7JA 1I2BA 4AVYA 4LCEA 1NXQA 5IF3A 1U5AA 2Q46A 2CFCA 1H5QA 5K9ZA 4YT5A 1T4BA 2XF8A 4XQGA 1H6DA 2EF1A 3BTUA 1I3KA 1HLPA 3JQFA 2V6MA 3JCZA 4WNIA 3S55A 2OFPA 2VZ0A 1RPNA 4XWYA 1A27A 3LT1A 3ETGA 3JQFC 3ST7A 3L9WA 1DAPA 1W4ZA 1IOLA 2VHYA 4II2A 2IZZA 1DFGA 2VQ3A 1HLDA 1Q7GA 1QLHA 5B4TA 3CUKA 3OEYA 1K6IA 3PHJA 4WLUA 3O9ZA 2OMEA 4WOKA 3WGOA 2V6BA 1JAXA 5G4KB 2WYWA 2NTVA 3WMWA 1I36A 1CETA 3OJFA 3RC9A 5DULA 5U4QA 3WJ7A 3RUIA 3ZWVA 1ZEJA 4NJMA 1LLUA 3RC1A 3GAZA 5EIOA 3ZV3A 2X5JO 2XPCA 1VPDA 1SZJG 2YFHA 2GYYA 3ZWMA 2FPPA 3Q1LA 2I67A 4S1VA 2VWGA 5AVOA 2WD7A 1ENZA 3DAPA 3F4BA 2Q3EA 1XCBA 1Z45A 3H9QA 2Y0EA 1DO8A 2LDBA 3GG2A 4BNMA 2YYYA 1C1XA 3AUUA 3FR7A 3NDRA 3ON5A 4J1SA 2Y66A 4XGNA 3GEDA 1B0AA 4YT8A 2D4AA 5BSHA 2OORA 3AWDA 5F5NA 1NBOA 2X5OA 2FOIA 1H6AA 2RHRA 4E5KA 5DF1A 4XA8A 1IZ9A 1P3DA 4HP8A 1GPDG 3GN1A 3ABIA 4CQLB 2CUKA 2V6GA 4LMRA 2A4KA 5G0SA 2FZWA 1H2HA 2PK3A 1ZSYA 1B15A 1Y8RA 3OICA 5IZCA 2FR0A 1QYDA 4J2HA 5HWSA 1PZEA 1UH5A 2BFAA 4LK3A 4IJUA 2QRJA 2YJZA 3TRIA 1OAAA 2EWMA 1DLJA 1HRDA 1RKXA 4QFCA 1P1FA 2BRUA 1FDUA 1PWZA 1E77A 1QR6A 1YL6A 4A26A 1GD1O 4DBZA 3JD3A 3D5QA 5I7FA 2ZTUA 4EJMA 3VPHA 3WNQA 2BFOA 3DBLB 6LDHA 4HFMA 5DDIP 1VLLA 1A7AA 4PFJA 3BMCB 3F47A 3BZUA 4W9NA 1TB4A 3ANNA 4PLWA 2NU8A 4BNFA 3WDSA 4H16A 1XQ1A 1YDWA 9LDBA 3FWZA 2LDXA 5L7YA 2R6JA 4E5MA
chains in the Genus database with same CATH superfamily
1U3FA 3V7YA 1EFAA 1WW8A 4BJ3A 4C4AA 3GA5A 5CA0F 2I6GA 4HDMA 1SCKA 2GWHA 3CZQA 3R4CA 4KSYA 3T7CA 3LGAA 1Y6JA 3DT9A 3K0FA 1WPXA 2IELA 3ZU5A 5K1ZA 3H4VA 5C1OA 2CVPA 3LCUA 1JIUA 2FPXA 1JVBA 2VCHA 2UVQA 2Q5CA 2YHSA 5K3FA 3KZ1E 2OHJA 3IDSA 5JI3E 3B52X 5KS2A 3ODGA 1CUJA 1T43A 3KZVA 4HCJA 2C84A 5KB3A 4B32A 4AY6A 1XAHA 3H9JA 2M9MA 2PMBA 1XNJA 1D2HA 5B58C 4QPDA 4BO1A 4P8RA 1YQGA 3N75A 3DOUA 4XFKA 4URYR 4KUEA 4KNYA 3OH8A 2OZKA 4NZ9A 5LKAA 3ESXA 4KQ1A 3ZY3A 1JKJA 4WV3A 1Y3AA 4ZVKA 5KKNB 3HBMA 3OWHA 3OZSA 3PHGA 4PPFA 3NAQA 3TCXB 1ZJ4A 2PGNA 4I4NA 4D56A 4EKGA 2RC5A 1J1UA 1J8VA 1Q21A 2G67A 4J76A 2VT6A 4JKYA 2JHPA 4WZBA 4KCGA 4F12A 2HQRA 3PBKA 3DAGA 4QYWA 4ZYYA 3UXYA 5LJLA 1SU6A 2V4MA 4X90A 1T36A 4YMWA 3I8OA 3WDMA 2EGHA 1JWAB 3HABA 5AOVA 2REQA 1CS4C 1K66A 1W76A 4OI0A 3B20A 3FUVA 3LIPA 4PNPA 2PXAA 2PTHA 3R2JA 3U09A 2G0TA 2HNKA 4X92A 2XYQA 3PGKA 1WB4A 5C0OE 3FMGA 1IHPA 3E7XA 3PHIA 4LA4A 4RXTA 5FXMA 2VSXA 1A8PA 4A0FA 1JH9A 3IQEA 3SIXA 5DXFA 1GZ6A 4ZO6A 4O2BB 4Q4AB 4B73A 1IONA 4PTYA 2ZATA 4COKA 1G59A 2VXYA 3DJFA 3IVRA 3WK4A 5JT1A 1FTWA 1EA7A 1XZPA 2JASA 2WWTA 1P8JA 1CQXA 1H9BA 9GPBA 4OHVA 1WG8A 1BQ3A 3G2PA 1FMTA 4OXYA 3UY4A 3FHTA 3SVZA 1E8DA 4HRVA 3EMKA 3JQBC 5HIMA 2AKEA 1SKYE 1PZFA 2CNNA 5TQVA 4EKIA 5FBWB 5AT1A 1K27A 2HZBA 2ZYUX 4J1QA 4QICA 1DCKA 1I80A 1N92A 2IJGX 4QATA 3W05A 1DADA 2ZP1A 2PA3A 3MJDA 3RHSA 3TR0A 1AS0A 3JZAA 2YWDA 3UMRA 3LTEA 4HAOA 3A70A 4NWIA 3U7JA 3R8FA 2VP3A 3LUBA 4TUYA 1G1AA 1DRVA 3T1TA 1L7AA 1CUHA 2I3GA 2HGZA 2ZAMA 1W36C 5KI6A 1FUEA 1TYEB 2WKRA 3KELA 4FHZA 1QP7A 4O4LB 3PCXA 3QE4A 3HB1A 4FKMA 3O84A 1YKFA 4KXWA 3ZCVA 1B73A 2P35A 4KZKA 5DIZA 4IKPA 1UF9A 4LVNA 3RSFA 1DAEA 2P41A 5I51A 3TAXA 1R50A 2XCLA 2XVXA 5JSHA 4C4XA 1ISIA 2QMQA 3DL0A 3EY4A 4XGIA 4CTKA 5LP1A 5JRZA 4IGIA 4WBXC 1CQPA 5COAA 1XDUA 4YAIA 3AKCA 1UDCA 1NW9B 3EISA 2PS1A 1JEQB 3ZG6A 2P79A 1RWOA 4TYQA 2C1XA 2ZB8A 4O02B 1J99A 5EWMB 3WWCA 5L3SB 4MQUA 1LSOA 2O2IA 3KVNA 3EYWA 3BRSA 4ITVA 5DX8A 3QX3A 3KT0A 1ZNWA 2FAXA 3N1UA 1MUUA 4PPYA 3OIYA 5K99A 5J23A 1Q77A 2RAVA 2JLZA 2FOXA 4OQ4A 3FIJA 1G5HA 2WG0A 1XBTA 3A3NA 3FUWA 3Q15C 1BDJA 4I3GA 3KSUA 3DFIA 2CXRA 3MINA 1DEHA 2IP2A 3L0CA 1ND5A 4MI1A 4MKZA 2FUEA 2FN8A 1CHDA 4AKEA 3FMOB 1NVVQ 4L8LA 3MS2A 1ZVJA 2C9YA 3DEZA 2XHZA 4HDRA 4L51A 2AR0A 3P9ZA 4KH1A 5JEEA 1KO5A 1XPRA 4NXMB 1Q3TA 5EYPB 1VIDA 3COWA 3WBFA 2FWPA 2JLRA 4F6RA 1I3OA 4DB4A 4P38A 5IEJA 5H3CA 3E6AA 1KQNA 4KX3A 4LMBA 4YJGA 5ALVA 2X13A 3D4PA 1MCZA 4QGGA 1TT5A 4A0RA 1KETA 1Q91A 1W47A 4EVRA 2YZMA 4K2HA 3FH0A 5JQGA 3G3EA 4NHOA 3TTYA 1LFDB 1HYEA 1W85B 2FMFA 2XOKA 3K8YA 3QTLA 3OKAA 2C9MA 1MOZA 4O29A 1IY8A 4C7BA 1J6UA 1GAWA 1TQ8A 1P81A 1P4JA 2O7SA 2PIAA 2C77A 2ONZA 1AQLA 4X8MA 3R7SA 2FQXA 3GD5A 3ZIAD 5L4SA 3CT6A 4ZKEA 1USIA 2X4GA 2DTEA 3LO5A 4GVLA 4N0QA 2H1LA 3QA9A 1CRZA 2LXNA 3BZBA 4MKIA 2O8CB 1XJ5A 4K81B 4GHWA 1EM6A 2MSWA 3LDAA 4PAWA 3B85A 2EX0A 4EO4A 5ILOA 3ACCA 1N9ZA 1QOZA 1WSBA 4BYGA 2KPOA 1LDNA 1MW8X 4YJ3A 4U2KA 4UOEA 2YXLA 3EVBA 1ZI8A 2QLFA 3BH7A 4XUGB 2JIBA 5FOUA 4UREA 3D81A 5I8PA 3EXG2 1EPUA 2JAPA 2WIBA 1OZAA 3ZVLA 3F78A 3JQ6A 3WGQA 4BE9A 3QLVA 3IKLA 2VT2A 3DXXA 5A7FA 3VX4A 4CM1A 1MA0A 4MW4A 2ACVA 4U9UA 1APBA 3EUWA 4FT4A 4Q16A 1XTIA 2BTQB 1EP3B 2OAP1 3MLEA 2Y3IA 1PDVA 3NWPA 3SJ7A 4YYEA 2X8BA 4E08A 3GBSA 2CLMB 3GIWA 4JLBA 1NASA 3SYKA 4BB9A 5D3MB 4KGDA 5EL0A 3FOCA 4ZPJA 2B2CA 3PC8A 5IW8A 4EMTA 1QH8B 4E5VA 3WBJA 3AOGA 1FXWA 2ZULA 3BKWA 4FZ3A 5DLDA 3A9VA 3ESAA 2RGUA 1JI0A 1ULTA 2P1ZA 2Q3LA 5D7NA 4CUKA 2VAVA 3OBIA 4IR7A 4F5EA 5FOXA 3C39A 1VZ3A 2VFAA 1KDRA 1KMHA 1U0RA 3PYMA 5C8DA 5K0ZA 1EEXB 3A7DA 3KEFA 3RC7A 3P94A 2J3KA 2WOOA 1HA3A 3M2PA 4DV0B 3QVWA 2I87A 3HYCA 3T99A 4D4KA 5BN3B 4RL6A 3D6HA 5IKXA 3LFTA 5TVGA 1Y33E 1HETA 3PXCX 4JZKA 2RIPA 2Y1FA 3UB4A 4DC1A 5JNSA 3A3YA 3AQIA 5HF5A 3VAYA 5KNDH 4NDNE 5DWDA 2FDXA 5DGXA 5AXBA 2CJPA 4RAOA 1Q84A 4GBJA 2PCLA 1T29A 3V4LA 4RDCA 2AG0A 4JXZA 5DBGA 2ZZNA 2AQKA 3P2IA 2ISCA 1HFWA 1XEXA 4QHTA 4LJKA 1G2PA 1MX1A 2CZGA 3I28A 2W4MA 4FILA 2PZAA 4EAQA 3NUGA 2EJUA 1U2GC 2VF2A 3JPYA 3L7JA 2GA8A 2ZPUA 1E66A 3KB1A 3M6LA 3E81A 2OA0A 1EUDA 4FFPA 4I81A 4BCDA 4BQEA 4LF6B 1AVTA 5L3VA 1HZZA 3VR6H 1KAQA 1WTCA 3TIIA 2M6KA 3VU3A 1T5LA 4FGWA 5BWLA 1UK6A 1AHPA 1T2VA 2QSZA 4MDEA 4MPRA 1CQIA 1TCAA 2NXJA 5DBHX 4CN9A 3UH1A 1NA5A 4MV8A 1HQCA 2GO1A 1GTMA 4AFNA 4QRIA 1P4RA 3I58A 3C8ZA 4HNGA 1ZUNB 4RLFA 7ADHA 1VP3A 1G21A 2WJ6A 3HO6A 5HIJA 4DUPA 4ER7A 2FSUA 4OB8A 5D84A 2OCLA 4Q18A 2RIRA 3V4FA 1HDZA 4INOA 4MRMB 1HBJA 3D4BA 4JJFA 2DGDA 1X7ZA 1AQIA 4M0LA 2W70A 3TM4A 2QTWB 4KOAA 5LU9A 4RK7A 3LDFA 1P33A 4CTJA 4XGRA 5K8UA 5I4IA 3FYHA 3WTBA 4DRZA 2RSLA 4PX3A 3UANA 4CLEA 1L6IA 1ST3A 2AI2A 3HKBA 5DOVA 1LUAA 4MS3B 3VI3B 3AT1A 2C9BA 3VOTA 1XWWA 2HMSA 3OCWA 5LMZA 2D0DA 2WWFA 1L3BA 4XXHA 5C5DA 4RFLA 1SVOA 2ORED 1PWXA 1LS6A 1ZQ1A 2IHVA 3I9KA 3MWGA 1E4EB 4DSZA 2WABA 5I4BA 5ITWA 2AYYA 4KGVA 4OHPA 2EARA 4YDSA 1EBUA 2B20A 4JENA 4EPRA 1YFJA 1J5EB 1H2BA 1Y6QA 2HV9A 4NZOA 3COPA 3I76A 3RAFC 4TLAA 3REFA 3OCYA 4CM4B 4RD2A 4U9IS 4F60A 2R4UA 2EQBA 3PUZA 3U61B 2X5KO 5B6PA 3ITKA 4HFJA 3H8SA 4LZPA 1ZK0A 4HAUA 4UQPA 3TQRA 5ARBA 3QKSA 4MRAA 2ZI5A 4PZYA 3TVTA 1CY1A 4AROA 4NMMA 3PGJA 1WB6A 2P78A 4QGHA 2AQHA 2FX3A 1ZOIA 2QBYA 5E6UB 4TS3A 3GLIE 1G21E 2NTEA 2YWFA 1L5KA 1K7CA 3WP0A 1JDVA 2BGRA 4UAVA 5BWNA 4IICA 3ND7A 1X42A 3ZWCA 1QQTA 2GKGA 4CKXA 4E0BA 4M0CA 3IFSA 1V16B 3B3GA 3JZDA 2EW2A 1K3UB 1H8ED 2IU3A 1V8FA 4XX0A 3WYBA 3ZI4A 1B0PA 2A30A 5I4KA 3ZYZA 1BC5A 2VYND 2G0NA 2FPGB 4YP7A 4PLFA 4ARIA 1C7ZA 4BKQA 2D54A 3RRYA 2IUSA 3OM0A 3MMSA 4NE2A 1NXSA 1YJQA 3MYRA 4RV9A 1A2OA 4EO9A 1U80A 1PF7E 5HSGA 3D6JA 5EQDA 5TNXA 2Z43A 3HB5X 2EXXA 1M2KA 1N0VC 3VUFA 1U8ZA 1QK5A 2PYIA 3OCCA 4PGMA 4RQTA 4XQEA 1JG1A 2PQ6A 1G20E 3IESA 1W52X 4JVLA 3PQ8A 1D04A 4J07A 4OJNA 4A0QA 2QG4A 1UBHS 2Q7DA 3WK5A 1XL1A 2QW0X 4Y18A 2OHFA 1U7OA 4A92A 1HTBA 2O2YA 4QJBA 5K4AA 3EXEA 4BMZA 3DG9A 5BP7A 3E1GA 5LB4A 3X1KA 2IF2A 4L6AA 3G2IA 5FOVA 4AJPA 3QQ5A 1JG4A 4ZEXA 2QXUA 2C54A 2V5VA 1OXKB 2ODAA 2XMZA 2YIDA 1C3EA 3TLZA 2NYUA 2FSHA 1E9AA 2GKOA 2PVPA 1DIGA 1EJ0A 4I8XA 4JBGA 4JHXA 1V4NA 4KQ9A 4RZUA 2Y2VA 4BQIA 3W5VA 4FHGA 1HX7A 4BKOA 1E7MA 2O8DA 2O7QA 1OLSA 1HH4A 2Q9BA 4RHFA 7AT1A 1AMUA 1E6WA 1WR8A 2QLMA 4XAQA 3BBPA 1WF3A 4CLRA 1IZ0A 3EFBA 1YHYA 2FSSA 3PRJA 4DYDA 5IT4A 3IPXA 4MMZB 4NBNA 5JBIA 5LLDA 4WFQA 2EJTA 2C4NA 4BNDB 4DGSA 3HZHA 5EE1A 3B9BA 1YDFA 3UHFA 1WDLA 4RV5A 3ZH2A 2EBUA 3C3EA 1OBFO 5U1PA 4F93B 3ZIAA 1VIVA 3A1CA 1CIPA 3E7FA 1AKWA 1M2VB 3ZH9B 3I52A 1GZSA 3H2GA 3ZHZA 4KN6A 1PQ4A 1TQ4A 5MN6A 3N2LA 2OO7A 4O6VA 5EWJB 2XVAA 2X0RA 3U3JA 1GNTA 3EOZA 4EHHA 1KEKA 3WGVA 2IOFA 4QPPA 2IYYA 2NM0A 3PZRA 4UVDA 5FNVB 2OVFA 4JI5B 1JB1A 2EBFX 5F7ZA 4HDCA 4D9IA 5F2EA 1T0JB 1BWPA 1IRXA 4NMLA 1M83A 4AY3A 5B2FA 5EHIA 4JT4A 2E4ZA 4KR9A 3ZWOA 3K72B 2W6PA 1E6MA 3TOVA 1VE3A 3SOZA 4UOZA 1U31A 1NQOA 2BL4A 2UYGA 3PF9A 4LDNA 5E0KB 3E05A 3KSDO 1Q1ZA 2EX1A 3KEMA 4DM4A 1R8JA 3UENA 3M81A 1GWNA 4BFCA 5H16A 1JAYA 3FSEA 4IQFA 3A4IA 1YKGA 3F8TA 2EZUA 3SHTA 3DDHA 2OFXA 3ESQA 2H2DA 2JCBA 4TS1A 2DMRA 5BN5A 5CTAA 5AKIA 2Z5FA 3LHSA 1T1GA 1F48A 2IXFA 2CL5A 4JMPA 1RZVA 4TKUB 1Y63A 2F64A 3ICPA 5K6RA 3ZDXB 2O3JA 1NT2A 2XRMA 3R6WA 4YMSA 2C9ZA 3H99A 3I12A 4IGEA 1N2CA 2JFBA 4YJ2B 1C1DB 1GFZA 4N3BA 4RH0A 3PC2A 2R6FA 1DE0A 4A91A 5BORA 3P9CA 5LD2C 4Q9LA 5DSTA 1KMCA 2H06A 4US1R 1EEHA 4S2UA 1QB8A 3LA8A 2HRDA 3RW9A 4CUZA 3WFJA 1J5XA 1SKAA 3TL2A 1GDTA 1QX4A 2F1IA 4MW0A 4KLRA 1CULC 2UVPB 4DBVO 1HPLA 1DG3A 2NU7B 4Q9AA 1QH0A 5J59A 4ZHSA 5TR9A 1E7SA 3ZY2A 2GCGA 4WFJA 2YJ4A 1N9KA 3H2JA 4GMHA 1KOLA 1Q1AA 1Z2EA 4QXOA 3VNSA 3WRVA 2HJVA 4AICA 3ZZ1A 4IEFB 4Q7QA 4WPGA 3Q7TA 4HWPA 1KYVA 2COEA 4NHEA 5DTJA 2FX5A 4D45A 5AOBA 2OUIA 4FT2A 2DE0X 3DVAA 3MLBA 4GL4A 1HQYE 2CKDA 2RARA 5K51A 4DV5B 3EMVA 5ESRA 3D6NB 3LO8A 4MW5A 1YGPA 2OCGA 1CJUC 1ZLXA 3MG9A 3N5CA 1LPAB 5DBOA 4JX8A 3PEEA 1FF9A 3O0DA 1Y8RB 4I1OA 4BNXA 4UMDA 3WMFA 1AB6A 3VNBA 5HZGA 5HXAA 2EBWA 1BO6A 1DG9A 3EMDA 4YI3A 4ZJUA 2XNHA 1XI2A 4RCYA 3T7JA 4L8YA 3UC5A 2XNSA 4AKHA 1NUHA 2FPRA 5CRIA 2C20A 1R6TA 3G6KA 4OA8A 2CYCA 1NSTA 3BE4A 3HLYA 4IHAA 2GJ4A 4JY7A 4L2IA 4L74A 4RJ2A 5EKXA 4K6FA 3OUZA 3B53X 3L5OA 5FWXA 4GX2A 1TGVA 4JMLA 2BVNA 2NZ8A 2LWIA 3LLSA 3ZK9A 3WWDA 3GZ4A 1TUGA 5F51A 4YRQA 3GPLA 1W4AA 4BAUA 1C2TA 2QTBA 3EODA 1RAAA 1XVIA 5T6MA 5IK2A 1YOBA 1Y7PA 2F1KA 2IV7A 4QARA 1A8QA 4FDAA 3IULA 4FCTA 3MELA 4HQLA 1RYZA 5AVJA 1WU8A 3C3AA 1BAPA 1KEZA 1WQ3A 3B78A 4MQFA 3FOAA 1NR1A 2DU8A 1NQVA 3KAJA 1M1NA 4MWCA 4RPKA 4RPHA 3T1OA 3DKIA 4EPXA 5K6AC 1AJEA 3W2EA 4GKVA 1L7EA 4XOUA 5FR1A 5AVUA 3LPMA 5AIBA 1XMPA 1BWSA 1F7UA 1ZVKA 1OA1A 2CKMA 2EFHB 1NQTA 2C29D 1ORDA 5KDLA 2BMFA 1J1IA 3PXXA 2HF8A 4YQEA 3P0RA 1MQ9A 3ZDZB 1QANA 2ZBVA 3MOIA 4YUWA 3OX2A 2WKPA 2R6AA 1LF5A 3FKJA 4NP6A 2WWGA 4GL2A 2M2IA 3A32A 4HAXA 5G41A 3UB3A 1BX0A 4FGZA 2PT7A 4QLAA 4Q1FA 4YP6A 1W87A 2RAFA 1J5PA 4TV9F 4A8JC 5CFRA 4YLYA 1MFPA 5BN4A 1BTOA 2O19A 3B3QA 4U7PB 5F3RA 4A8TA 1AUOA 3PS9A 3BDIA 1VYHA 3U80A 2E87A 5CT5A 2WT9A 4HNSA 1GKUB 2H0AA 5EXEA 2SCUA 3T5MA 3AF3A 2DPYA 2BGTA 3Q5DA 3M83A 3DDWA 4PIVA 4DLUA 1UKVY 5HMLA 3HEMA 5D5PA 4PCAA 4YJ2F 3U4QA 3PD7A 3G5LA 1RSZA 3HMQA 4K46A 3MTQA 3CVWA 1I30A 4M9RA 7GPBA 5CH3A 4A5OA 5LJIA 2IPNA 2EYUA 4UTZA 1Y7IA 2E49A 2IV2X 1P91A 1T1JA 4HQ6A 5IJAA 5CNJA 2O14A 3EC1A 2IH5A 3G6WA 1JIXA 3M6MD 2ATEA 3O4GA 5CIWA 2J5RA 3Q9SA 2BR3A 1OC2A 1SCBA 2JJYA 3H5VA 3K0CA 4OHUA 2PMDA 4GSYA 4YP9A 1J4AA 3LAWA 2OZLA 1YE5A 1NWHA 2AHRA 1DKLA 4HKTA 2C94A 2DLNA 3WLQA 1K08A 1EWVA 3CC8A 1XYYA 4TZ6A 1C0EA 3DKPA 3L49A 3WMRA 1BKYA 4B3HA 2PUVA 4WBSA 4CV0A 3AHEA 4HAYA 4BWVA 1CIJA 2BSAA 1BE1A 1XWIA 3BXPA 2WUWE 4OLBA 1Y1TA 4QQKA 4CM9A 4ZIRB 4C08A 3EVTA 4FYYA 3ZE8A 2HFJA 1UEIA 1X86B 2FPGA 2W37A 3A4MA 4MQ6A 2CHUA 5UKDA 5FNVF 2NVUB 4ZV7A 3SHVA 3U6KA 1G3RA 2OCYC 5GONB 4BKMA 1LF0A 2EDAA 3AM5A 3OE7D 4AF7A 1LTQA 1DUVG 3E9YA 1VL5A 5A62A 2O8BA 1JR3E 1KMNA 4MB2A 4K8OA 4C2AA 2Y6VA 3G8CA 3DCYA 1ZM2A 2ZRDA 3HBFA 1XOIA 2GJ9A 3GCWA 2OYCA 4E94A 2OV2A 4E4YA 3GVXA 1VXRA 5CVJA 2IUUA 1O4WA 4GRAA 1PQPA 4DLNA 4O08A 5F52A 2A9VA 2ZSDA 3LY7A 4B3XA 1GGHA 3IQIX 1DRKA 1ORVA 5D5HA 5EJGA 1OAOA 2WP0A 4KXMA 3KXIA 5AK3A 5JO9A 5L3RA 2CDBA 4AXBA 1KI9A 4RPLA 1QIGA 4B3SB 3TPCA 3DL2A 4CLOB 3BRCA 2WIAA 3N74A 5JZBA 2J30A 4A27A 1M5RA 3F3MA 1N78A 3QV1A 4XVUA 5CX4A 5EP3A 5JPCA 1LI5A 2NZVG 2WE8A 1W5FA 3I5MA 2RGGA 4N48A 1NZFA 2Q2QA 1PJTA 3EUAA 5F33A 3L04A 2AX3A 2X8JA 3AH8A 5NLLA 4J4HA 1JQLB 3P97A 3S99A 1E4EA 2IODA 4NNJA 4X24A 4FGJA 1QORA 1JHOA 1VJDA 3B7WA 4MV4A 5IXSA 1ORIA 1Z28A 1FBNA 1Q0SA 2OM6A 3NETA 4D7AA 4DW8A 3STVA 3VO2A 2Z3WA 5ITSA 1AQNA 3GDHA 2H0QA 2WLTA 4DCPA 2ATCA 2E21A 4I4LA 4MRSA 1N32B 4WESB 1Q5PA 4KN8A 4OP2A 4EATA 4R1TA 5GPBA 1QGUA 2NPIA 2ZSIA 4YMLA 1JWLA 3MD0A 5HUHA 4K0KB 1E2GA 1FYWA 2JGEA 3QEMB 1GUAA 3F5DA 4MKRA 1WX1A 3OJXA 5ALNA 1M2WA 1H0HA 4AKSA 3FVQA 3F49S 5EHNA 5FR2A 4DCGA 1JLLB 1IG0A 1T5DX 1XZ8A 3MCUA 1BD3A 3BTSA 2KYRA 1ZK4A 2JIRA 3AGQA 5EJEA 3ULKA 5I3CA 4DV7B 2JG3A 4Y6LA 3AR3A 2I9PA 3ESCA 2AW3A 1LLQA 1ZN8A 2J33A 3DVLA 3G0GA 4RFSA 3DGEC 4S2EA 1NLYA 3DDSA 3IHLA 1Z2NX 3OZRA 1Y5RA 4M1KA 3ACDA 1KVRA 4N5MA 5CK5A 4O4HF 2AL7A 3K20A 1JG3A 3TLGA 1T4DA 1P6QA 3TINA 4C3ZA 1CZOA 3AHGA 4JELA 4OK5A 4EHDA 2RGAA 2NYRA 4OHCA 4KHPB 2KJQA 1BYUA 1KBOA 2XODA 2HOQA 2Z58A 4RSHA 3RFTA 3RJZA 5CDFA 5BV8A 1EVLA 2ESRA 2WQ7A 1E98A 3VYTB 1D0SA 2CCJA 3IE0A 3W7AA 1VE5A 2Q21A 2XCQA 1BKSB 3UGTA 3G8BA 1P1HA 3NBAA 4JDPA 5AVRA 1YTUA 1JF8A 1Z8HA 2AOWA 2ZS8A 4D44A 1GZ4A 3F5QA 4X6XA 2AOVA 2QX4A 1A9OA 5ED0A 4FJ1A 3VHLB 3W2GA 4C7MA 3D8TA 1UP4A 1NIPA 5LXTA 4MVWA 4OYRA 1D8AA 2Q62A 3K5WA 4GI5A 4AAYA 3T4XA 3I2JA 1LPNA 5BSWA 1L4YA 4GP7A 4UC0A 5BN3A 4PYIA 1OH5A 1OFUA 2HIMA 4UNPA 2AVNA 3VSEA 4AIRA 4MTLA 3RG8A 2Q4DA 3ZDEA 1CVLA 2J5QA 4B87A 2C2ZA 5BW6B 3JAMA 3WG9A 2FCRA 1KFEB 2QRVB 4L3OA 1GZUA 3MTBA 3NM6B 1Z5WA 3LUDA 2PSHA 4YAJA 1EQAA 4N5NA 4FYIA 3DL7A 4M0DA 5E2AA 5JQWA 5BMVB 1Z06A 2CE2X 5AXAA 3FNEA 1EUQA 1QH8A 2PL1A 2J9RA 1CJVC 1M73E 4WE3A 2NUTA 2NT4A 5EESA 3EGWA 1HF3A 3KK0A 4E2FA 3OFNA 3WNCA 3Q3VA 3QVLA 3QJGA 3OE1A 2XW6A 4NPHA 2G6TA 4G1MB 2UZ0A 4G1CA 1NFFA 1H8HD 3I1FA 5AKJA 1DJQA 2OE2A 4TL7A 1I4LD 1A8HA 2JGJA 1IN1A 2H57A 2PHZA 2YH2A 2Z9DA 3QM1A 5DP2A 4BKUA 3M4JA 5AW2A 1KQGA 3EWSA 4LDAA 1RI4A 1SHZA 4F96A 2J0UB 2LKCA 3T06B 5KIAA 3OQNA 2VJMA 3ABSB 3O1LA 5L7WA 2UVDA 4A10A 4DLRA 5JCZA 4BQSA 2FLWA 4U6NA 3FOEC 2W6ZA 1S5PA 3R44A 4JGIA 3TDNA 3D3NA 2W2LD 4G0WA 5ALTA 5KAPA 1YULA 4E12A 4FFNA 5D8DA 1I01A 1YR9A 1B16A 3GRYA 5JD6A 3QQPA 2HPAA 3WGMA 4BEJA 1S7CA 2AHOA 4RABA 1TO6A 2OAEA 1USUA 3P9IA 4LQCA 4AU1A 2BFDB 4RFVA 1QIFA 1JQDA 1VDMA 1GPWB 3E9QA 4FHDA 1F1JA 2ECPA 4O2AF 1Y9EA 1ECGA 3CX8A 4JB0A 4G0PA 2RHWA 3ILXA 4EEXA 5IAOA 4CM5A 2XA2A 5F76A 4Z7NB 2PFGA 3OEED 2FEAA 3LVQE 5F9MA 2IYXA 3I01M 3NDPA 3RJMA 1FU8A 1PHRA 2DTDA 2P75A 1SVKA 2GNPA 3UAOA 2CNBA 4FFLA 3DV0B 4GD3Q 4B8ZA 5KTRA 1U0LA 2HPHA 2VNAA 4RACA 4G4SP 4KITB 3HA5A 1NN5A 4J0JA 2UVPA 4P4UA 2XWPA 2ZAIA 2ZUDA 3H86A 1WB5A 3W6ZA 1GLVA 1GPJA 2OM2A 2B1QA 4X93A 4WY8A 1UFOA 4FOTA 2X5XA 4Q7MB 2OCDA 1TLLA 5TS3A 2OZPA 1XGKA 1DAOA 3SLGA 3DDNA 2AD5A 4MW2A 1FNDA 1A1SA 3C5CA 3QXGA 4B40A 1I2MA 2W71A 3R3WA 2WHXA 3JSXA 3KUDA 3V42A 3RABA 1FPQA 2GO7A 5CG1A 3QU9A 4XLTA 4NU5A 3IQDB 2QNIA 4NRDA 3PNOA 1VHTA 3AFHA 4UW9A 4JEIA 5TGZA 1XCOA 3FWKA 1CDDA 1U1DA 2J45A 3KVOA 4O4JA 1D3AA 2JNWA 5HDQA 5T41A 4EX7A 3KYIB 2HH9A 4AZWA 3O4VA 2WWVD 3HB7A 4HUJA 5LNK1 2HQOA 3DBVO 3I5UA 2VEDA 3A37A 4FMPA 7ABPA 1F60A 2XF2A 3IEXA 4QBIA 3NTUA 1P0IA 1M1ZA 5AM0A 1T3TA 5HF6A 2FFHA 3DFFA 3DDUA 1AMNA 1RKVA 1T0HB 3CPSA 4LNUB 3DT6A 4C04A 3PUJA 3ILHA 1CZNA 2FGJA 2PSJA 1T8SA 1A96A 2WC1A 1E89A 3ESDA 3CQ9A 1TKCA 3BCUA 2YYAA 4PSKA 3GJYA 2P9YA 4YLEA 4YI5A 3KP1A 1O97C 4BGDA 5DCYA 4H6PA 4ZXFA 4W5TA 4BFSA 1O4VA 3E82A 4ZYLA 4PRZA 3A58B 2FRDA 3PQDA 1AKYA 2JFYA 4P5DA 1IULA 3GMTA 1S2OA 2CL6X 3TX6A 4A3SA 5JI2E 1XRPA 2OFWA 4GOMD 3ZOKA 2FPPB 2QKYA 1NMEA 3RYIB 3K0BA 3H2SA 1ZK3A 2EG5A 2AEJA 2OTCA 3NHLA 4OYYA 2QQ5A 2VH5R 3JSAA 3VDQA 4ZO4A 4BP1A 4J0CA 2Z6UA 4O4HB 1HG0A 1CB7A 1SM4A 4QYMA 1H3NA 1VDZA 1NUTA 4R2IA 5KNCD 2A67A 4WDQA 4UQOA 4IINA 3PV0A 1NYTA 4YAEA 2I3DA 4MAFA 4DADA 1PI3A 2DBRA 2IITA 3TSCA 9ABPA 1GYPA 2NZXA 4NQZA 2ZSAA 1NBEA 3G7NA 2RG7A 2TMGA 5JAOA 1Q2UA 1XN4A 4HNAB 1HL3A 1XLWA 3PUHA 5HNKA 2WTUA 4ZI7F 1VTKA 1O95D 1VB5A 3CZ5A 4EKDA 3VRHA 3LBFA 3I3OA 1JHDA 3FBTA 4ENTA 3M6AA 2ETVA 3D9QX 1BGWA 4B4VA 4OH1A 1NBWB 2WU4A 2D2IA 4RNDB 1DBSA 3RADC 1U98A 3PUKA 4KIUA 4ZVMA 4I9UA 1E59A 1FMLA 2WRZA 5D87A 5IS2A 2HR1A 3UBTA 1Z5VA 4UAUA 4M8KA 1QTRA 3NC0C 3CF2A 3EXEB 3JATA 1XZGA 3ETNA 1P5ZB 2RGCA 1YQQA 3GGDA 3GLUA 4PBTA 3HR8A 4X20B 1UBOS 4OVKA 3AXTA 4EY3A 1L2TA 1KZ1A 3AILA 1RM3A 3IAS6 5E8JA 4YMGA 2WT8A 1ZIPA 1DIAA 3D7KA 2VOEA 2HSWA 3TVDA 1ZJWA 1N2JA 2I2AA 4QXQA 5H4GA 1RLIA 3DZCA 4QNRA 3JRXA 3DPSA 4ZO8A 2J5BA 2LRHA 4Z9XA 2IDMA 3O4JA 1X1EA 2O4CA 2A9OA 2G1JA 3FNBA 4DUGD 5CB4F 1FFGA 3LMKA 1D2AA 3JQAD 1JILA 1X8JA 3LQQA 5TB5A 3REQB 2NVBA 3TLMA 2GEFA 1XN1A 3X1DA 4B43A 3GVIA 2ERXA 2EU8A 2O8BB 4FD3A 2Q9CA 1Z34A 5F4BA 2ZVQX 4L28A 3AONB 5K3EA 1GU0A 4A2WA 2PLWA 2Y4NA 1N0UA 5BSMA 5F73A 3HZOA 2JZCA 1FSZA 3CUTA 4TYPA 4B8WA 1NLZA 2YUTA 1SBIA 4R2LA 4GI7A 4Z3DA 4HEHA 4JLAA 5HZHA 3L18A 2P2ZA 5EE3A 1IMJA 4CMJA 2XXAB 4FW9A 3KYDB 2CFOA 4B4OA 3R23A 2ZJBA 5JCOC 2ZSEA 4BJ6A 1FNCA 4TL9A 4UEWA 4NVRA 3VVBA 4EGCB 4N5IX 5CDTA 3U7QB 2FZ4A 3KLMX 4ZP1A 3UJ8A 2BGIA 1Q57A 1RPZA 3QKSB 1Z6ZA 1BWQA 2P0EA 4FGKA 3OM9A 4XRGA 1EWRA 5IHPA 1R66A 1PD1A 1YQDA 1SUBA 3LT2A 3QE0A 4ZAFA 1EDOA 3I2IA 3FR8A 4ICIA 1I7DA 4NCBA 5IG2A 1QWSA 1YFZA 2ZR9A 4HYTA 3MWLA 1W1UA 2P2SA 2O5RA 4JQCA 4P86A 3W3AD 4CEIB 5EPEA 4H3HB 4HH3C 3SSOA 1AD2A 5JJCA 4NAHA 2A33A 3QLUA 1I2DA 4RYLA 2NU6B 2QTFA 3V1TC 1A88A 3ZPXA 1OV4A 2EJWA 4EG1A 2QLBA 3VH1A 4W5QA 4TWBA 4N0DA 4XIJA 1L5OA 4TLEA 3JQCA 2FPLA 4UHBA 4MUXA 4IHJA 3MTIA 3OTQA 4IDQA 1W6UA 4BB6A 3KR9A 3PC7A 3NPMA 1G8PA 1YFKA 1X8KA 2B4KA 3GUYA 4JA2A 4YNBA 1JSXA 2WSMA 4MRVA 2H1RA 5T4FA 1S8OA 3CBQA 1W2HA 1ESCA 3MK31 3NV9A 2RHTA 2DHCA 1N7JA 4G0OA 3UCFA 5A02A 4TV9B 2WHRA 5LWHA 1H0RA 3T94A 4ER5A 4TQGA 2XAAA 1W88A 4UMFA 1IY1A 4YV0A 3K0AA 1M6VA 2G9ZA 4G5FA 2LIVA 2XI4A 3U9SA 2FEOA 1WM1A 2NUPA 2UUCB 4DGQA 4Q9NA 3AR4A 4IOJA 1FDSA 5IBRA 1U6KA 5TQ0A 3RYCB 3ZI7A 2J8ZA 2ZITA 1KI1A 3HQ4O 1OHHD 4N0PA 1JU9A 1IL0A 1YBMA 2VF5X 5LBIA 2Q3MA 4V02A 4ABYA 4MWBA 3VVCA 1LVHA 3WS7A 1A9XA 1MU0A 1OX5A 4YROA 5K2OA 1YE3A 3V6MA 4H7IA 1NOKA 2Q3DA 4GQAA 3PFFA 3JQDA 2XSZD 3N58A 1FX0A 1L4HA 1NX6A 4R5MA 3QFRA 5DLYA 4QUEA 4BAGA 4KMRA 3ZI0A 1T9KA 2YTZA 2XKKA 5KQGA 4XVRA 4N6NA 1OFGA 4FN5A 1EVEA 5ER9A 1O6ZA 5DE3A 3X1YA 4ZDKA 2ZM5A 3OZVA 3VV3A 1CF2O 1DXOA 1JNYA 4XYEA 3M6WA 4XQ0A 1P1RA 4YCJA 5DLPA 5H68A 1BXGB 2AG1A 2QTNA 4MR7B 4TLLB 1XCJA 4CFZA 1RXVA 3RC2A 2O2XA 2HU5A 2HTFA 2R00A 2XIQA 3I8SA 4H17A 2WJWA 4EWLA 4JJAA 4V0KA 1DBIA 3AVTA 3BDVA 4XYBA 1SB8A 2I1QA 4KQGA 2QV7A 3AY7A 4MUEA 3U60B 2HRBA 2WJHA 3RU7A 1SKQA 2H1IA 2JFXA 5GM2A 3RHFA 4BVFA 1LRKA 2VQEB 5J9FA 4B71A 3LRTA 1V8OA 2RKOA 4NJOA 4XDYA 1ZN2A 3EEQA 4P7KA 2FUKA 4KKVA 3TJMA 4ZTZB 2IH2A 1B41A 2EGGA 3EZ6A 3QHPA 4IXNA 4K05A 4NFYA 3UXEA 3UAZA 1B23P 1D4ZA 2AG6A 3FNGA 4WBNF 1BCSA 3G1UA 5AR1A 3T54A 1N8TA 4KPGA 2NZ2A 4NCHA 3S70A 2OV4A 3TLXA 4YV7A 1E2NA 1MB0A 4J0KA 4F8YA 1MJGM 3ZGLA 3HNPA 3KPWA 3TW6A 3EMBA 1EI9A 2HDHA 3UG7A 1ZOPA 4MCHA 4OV6B 3NKVA 1S3IA 1GZ7A 4HGNA 3Q11A 4DR4B 5LA6A 3FD8A 4Y6RA 1CYDA 1Y9ZA 2FSVC 1NJSA 1U9YA 2F62A 4MWSA 3RS7A 1YQEA 5T64A 4RGBA 3VPFA 3H6KA 4EG5A 1GRVA 1CEQA 5IC5A 3DBRA 3AVVA 1L5SA 4OB7A 3TTWA 3PEWA 4J1TA 3UKJA 4LCJA 1PQUA 3KX2A 1TVKB 3C45A 3IT0A 4HSGA 1BS2A 2W2VA 4I36A 4IVNA 1O94A 5IFLA 2JI4A 3PFHA 4B85A 1NVMB 2PLFA 3C2QA 3NOQA 2QSUA 3H7IA 4B84A 1PR3A 5E6UA 1KDPA 2GDJA 3AFOA 2A0KA 3Q10A 1V6AA 4K8RB 3R5SA 4NDZA 1TJ4A 2GPAA 3BG5A 1G6HA 2O8CA 1L6RA 2C8JA 3T7RA 2YKGA 3TLYA 1K6XA 1Z5NA 3S7TA 3SZOA 4C4SA 3RWBA 1X2BA 4EA8A 3IQFA 2WFLB 2HI0A 3D7LA 5H9WA 3EZ7A 4H27A 3K5IA 3H2ZA 3AEZA 4LZZA 3EXIB 2FE4A 4NYMQ 2QTTA 2QG9A 2X41A 4XCXA 1W85A 2MINB 3K0HA 1CF4A 4GI3A 4TKVB 1UBUS 2QMOA 4OSPA 3IOCA 1M2OA 1P2VA 2DKFA 3DDZX 2V8BA 8AT1A 3D3KA 1Y42X 1WUHS 3H7AA 1YA4A 1MH9A 2UU9B 4UUBA 2JGNA 2P5YA 1NVBA 4IVQA 4OL0A 5G1OA 2QVYX 2P7IA 3TJRA 2FZGA 5KYWB 3L40A 4S04A 2O1WA 2WP8J 4HDRB 2C4VA 4LQ4A 3ROEA 4EFDA 3G0DA 3OEWA 1JR2A 3TB4A 1XMQB 3BH0A 1Z0ZA 1KSHA 4GWKA 2JEZA 3DE3X 4HTFB 1IN4A 1DAFA 4EO7A 5B7PA 4UOQA 4DMRA 3AF1A 1VBFA 4JBWA 3B1WA 3LP8A 5BVHA 4OGFA 3BOSA 1SHTX 2EKDA 3TECE 4AG3A 1R9GA 1Q74A 3V8BA 1EK5A 1V0JA 3AERB 3QTBA 3SMVA 5TGTA 5AW1A 5BR8B 1HFJA 3DKRA 3KHTA 3F5SA 4TT3D 3VPCA 1QYWA 2ECFA 1EMDA 3HACA 5K4GA 4IXTA 1KHTA 5EN4A 3R5JA 4F2WA 1WZUA 1I2AA 1X74A 5AHKA 5AOCA 2BUAA 3C15C 5FWAA 2V6JA 5CIYA 4QUKA 4U7WA 3UA4A 3ZHBA 1WXXA 4A8JA 5CA1F 3HJBA 1U3WA 5CW1A 2B5VA 2FLKA 2VJPA 4MINA 5TXGA 3UHOA 4M9XA 4RK5A 1EUCA 3N0WA 4ZAWA 4HFRA 4UQLA 5IN4A 4DTIA 2DWCA 4TKMA 2IBSA 2A3NA 3FCUB 3A4YA 3HDJA 4Q4HB 4G07A 2Q5QA 4QO7A 3LPLA 1B1CA 3KKLA 3F6EX 5KVSA 1N2BA 4UUPA 1IZYA 3G2NA 1ZQ9A 3LZCA 1TCUA 1UJBA 3ABOB 4UHEA 2AMJA 3HL4A 1AY0A 1W6RA 5BQPA 3ZTTA 2BM9A 4D0LB 3OY7A 2ISSD 1VI2A 1TUEA 2YIMA 4FYPA 4UTOA 1CIVA 3QF4B 3USES 1MEOA 3IBFA 3U4GA 3ZQ6A 3QUQA 5AK5A 1J21A 4N65A 3BF8A 2XMSA 3HA3A 1QRUA 1RQGA 3ZHVA 1U0FA 2WVHA 4M7WA 1P17A 4A6PA 4TSRA 2EP7A 5ALWA 3V2HA 1YQUA 3Q3CA 3IUPA 1XT6A 4L3WA 5AD1A 3AHHA 2GCPA 2P67A 1K06A 5AP9A