1BVHA

Solution structure of a low molecular weight protein tyrosine phosphatase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
157
structure length
157
Chain Sequence
AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACID PHOSPHATASE
publication title Solution structure of a low molecular weight protein tyrosine phosphatase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 21
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1994-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bvhA00
3S99A 4TMYA 4DADA 2R48A 5F64A 3JTEA 4Q6WA 4Y9TA 3LOPA 3R0JA 2CWDA 1TMYA 3ROTA 3CG0A 5IUNC 2W42A 3N0XA 2PJUA 2N9UA 3BILA 3C6QA 1PNRA 1YTUA 1DRKA 3T8YA 1ZESA 3RH0A 3RVNA 1FQWA 2HSGA 2HPHA 3KS9A 4QYMA 3I42A 3D02A 3QELB 1DCMA 1QMPA 3Q7TA 3KSMA 4RKQA 5CNKA 3DGEC 2DRIA 1Z13A 5FWYA 2FTKE 4S04A 5JNRA 5JS1A 1M2EA 3LKBA 1JLKA 2ZAYA 5IBQA 1I3CA 3KLNA 5KC9A 2LIVA 4MRMA 4HYEA 4ETMA 5TQ0A 1JFSA 1U2QA 2HQRA 1E6KA 3HXMA 4Z0NA 1QQBA 4EVRA 4Z4CA 1D1PA 1HEYA 5T3YA 4D6YA 4TLMB 5KQPA 4RXUA 4NCAA 4EYKA 4MR9A 2H3HA 3O2SB 4RY8A 4EGSA 5DKFA 4LE2A 1Z25A 3OQNA 2LUOA 2FEKA 1FSPA 1YIOA 2OENG 3CS3A 1RZRD 1USKA 5JS2A 2PL9A 3MMNA 3OQOA 1EWVA 4MQFA 1BVHA 3O1HB 2F8SA 3JPYA 4RK1A 4ZYLA 5FBHA 4ZMSA 1Z18A 3HM9A 3TB6A 1BA2A 1A2OA 1P2FA 2FMIA 2VYCA 3A10A 4G0MA 5B3JA 1YMUA 3QEMB 4WT7A 1QP0A 4CBVA 3L49A 2GWRA 4MS1B 4RV5A 5HM6A 2GI4A 1NXWA 4YWHA 5EWJB 2QW1A 1YMVA 2HQOA 1ABFA 3HV2A 3QX8A 1A0OA 3G1WA 1VKRA 2JB9A 2A9QA 2FLWA 1JDPA 4H3KB 1EWKA 2RJNA 4PYRA 1NXSA 3RVOA 5JNTA 1EWTA 3GBVA 2PUAA 1OXKB 5FWXB 1RXIA 3EULA 5HKOA 3BREA 1F51E 2QVGA 2R4QA 3HCWA 1DP4A 4TN5A 2IPLA 3QEMA 3KHTA 3OO0A 3RVMA 4XLTA 1BAPA 3HDGA 4MGEA 4N0PA 3VNBA 4G97A 2JVJA 5GOTA 2E4XA 4F3TA 4RK6A 4FE7A 3HJFA 1MB3A 2JBAA 1XHEA 2JBAB 4YR7A 4YP9A 4RXTA 3ROFA 2MSWA 4P1ZA 1YK0A 1TLFA 2JCGA 1VRVA 3JVDA 4W5TA 2VUIB 3FGZA 4DN6A 2L2QA 2V0NA 3QELA 5D2CA 4D6XA 4PICA 1KMIY 3H5WA 4QPJC 1ZN2A 5IUKC 5B3JC 4NCBA 5HQJA 1JWLA 3C3WA 2WJWA 2BGGA 1C0EA 2IPNA 1MVOA 2MYUA 3B2NA 3KCNA 4NICA 3T95A 5BRAA 3K9CA 3QLTA 2AYZA 3FDFA 1ZGGA 4RDCA 4G0ZA 1Z26A 1DC7A 1F4VA 4N0QA 3W9SA 4RZSA 3NNNA 4FE4A 3SNKA 5TQ2B 3C3KA 4OG2A 1U0SY 4MS4A 5DTEA 4KMRA 4G0QA 4RU1A 5TPZA 2QR3A 2PUFA 3E3MA 1PEYA 1YK1A 3HK2A 4OBBA 3LUKA 3M9XA 3GWGA 4WXEA 3C97A 1ZHHA 2NUBA 1P6UA 4NQRA 3IP6A 2E4VA 3HZHA 4PZ0A 5BQ3A 2FEWB 1ZGZA 1ZAYA 4E7OA 4JB0A 5EWMA 3O1IC 2JVIA 2ID7A 1TJYA 2QU7A 4KQ9A 4UHKA 3HS3A 1CHNA 1JDNA 4N47A 1W9HA 5CNMA 1DCKA 1ABEA 5KQLA 3G85A 2FLKA 1YS6A 3CG4A 3LMKA 3EODA 4EVSA 2NT4A 3O2JA 2NZVG 3JVIA 4G0PA 1ZITA 2ID9A 1PNTA 4Z4FA 2IPMA 2OQRA 5TE9A 1DG9A 1JF8A 2FW0A 5KQGA 3FFWA 3LFTA 2L18A 4QICA 3QK7A 1YVUA 1K66A 3N0RA 4RSMA 3O21A 2FEPA 1WETA 3HEBA 3DLBA 5JNVA 5I4CA 1ZH4A 2CHFA 4UHJA 3H1FA 1DBPA 3JY6A 4MS4B 2QV0A 4G0YA 7ABPA 3IP7A 1SD5A 2FXIA 1QNLA 2IYNA 3MA0A 2YHAA 1ZY2A 6CHYA 1A04A 3OM1A 1QPZA 3A0RB 3NBMA 2J48A 3RVSA 4MS3A 4Q7EA 4MS3B 4RS3A 3NNSA 2FN8A 4IGAA 4HNSA 1FFGA 1GLGA 3KJXA 1DRJA 2PUBA 5EWLB 4IRXA 4ZMRA 1IIBA 2NZUG 3UK0A 3Q7SA 4O1IA 5TQJA 1KRWA 3DGFC 1MAVA 5TPWB 1JYFA 4OATA 1SXGA 4RY0A 5FWYB 3N53A 3SY8A 3HSYA 4MLDA 1NATA 1QO0A 2LP4Y 3RVRA 2IDMA 3CU5A 4P98A 2NT3A 5JNUA 3UKJA 4RK4A 3H5IA 3UUGA 2FMKA 3KYIB 4G0XA 3NHMA 1U8TA 4EUKA 5BR1A 2WB4A 3A3KA 3BRQA 4KQCA 2WRZA 3CNBA 1D5WA 2LBPA 4YO7A 3GL9A 4F8JA 1NY5A 4HNRA 4LZLA 5IEJA 2CD7A 3LUGA 4JASB 4HNQA 1APBA 2PMCA 4MR9B 4KK4A 5IUJC 2L19A 3H6HA 2R47A 3KLOA 4YV7A 5EWMB 2HJ9A 4MR7A 4WZZA 1JHZA 3GRCA 1DZ3A 3RVJA 5IEBA 1P8AA 1NXOA 4XXHA 3MM4A 3DBIA 3CTPA 3IPCA 5HSGA 4ZPJA 2Q5CA 2PUCA 4YS6A 3M6MD 1QP7A 1XWWA 4LX8A 1ZDMA 1PEAA 4NV3A 4IF4A 5JNWA 3RVPA 2WY2D 3CFYA 1M2FA 1T34A 3OLYA 1M5UA 3TO5A 5TPWA 3LUCA 2FN9A 3C3MA 3ILYA 5DGCA 1CYEA 4RY9A 4W5QA 1GCAA 1TVMA 4RWEA 1DJMA 3OLWA 3CLKA 3KTOA 4W5OA 3LUHA 5IC5A 1RXEA 1LBHA 3LKVA 4WWHA 5TQ0B 2IOYA 1D4ZA 3Q9SA 1QQAA 4PEVA 2A9RA 1P6QA 3CKMA 5DLEA 3OMXA 2PUEA 3KYJB 3LUDA 3O74A 3CZCA 3FFTA 3CZ5A 3P9YA 4GNRA 4Z9AA 2KYRA 4KVFA 4KREA 1LBIA 3I5AA 1DC8A 5KQMA 5CHYA 1ISRA 3F6CA 4RK0A 4YGXB 4TLLB 3SAJA 5BRJA 4OLAA 4YLEA 2O20A 3BBLA 3HUUA 2QZJA 2JVKA 4H3HB 2PL1A 3CRNA 2ZWMA 2F8TA 5GQSA 5FWXA 1VLZA 3QEKA 2I6FA 3FFXA 3QX9A 4RKRA 2IPAB 3H1GA 5FBKA 1GUDA 2A9PA 4KV7A 4W5RA 1Z17A 4MRMB 2RJOA 3D8UA 1JFTA 3GYBA 3QLUC 1JX6A 3EQZA 4ETIA 1XHFA 1PHRA 3IDOA 4F06A 2GBPA 3N75A 2VUHB 1Z2DA 3TD9A 1J56A 1JFVA 2WJAA 3LUJA 1JBEA 1USGA 3HDVA 1QP4A 4JP1A 3URMA 1H9CA 3QLVC 1NXXA 5C5EA 3SG0A 3SM9A 1KRXA 3JPWA 3E61A 2M1ZA 1USIA 4MQFB 1AB5A 3RVKA 2GX6A 8ABPA 3IP9A 1SXHA 2E4WA 4LRQA 4Z4EA 1CEYA 4G0OA 1U04A 1RPJA 2QVCA 1Z16A 2B4AA 2JRLA 4Z99A 2PE5A 3F6PA 3MIZA 1RZRA 4M88A 3H5VA 1LJUA 2FKAA 3OM0A 4L85A 3O75A 5TQ2A 1VPWA 3JS5A 3GV0A 5ABPA 3DZDA 2M98A 1DBQA 4H60A 4EVQA 4PE5B 5KWSA 3QLUA 4MQEA 1C4WA 1D2AA 2GKGA 3HO1A 5IULC 3SQNA 4MYRA 2FVYA 3OLZA 2MSKA 3O1JC 2PLNA 1ZH2A 1EAYA 3H5LA 3KG2A 1E6MA 4XARA 1BDHA 3CHYA 4MS1A 1D1QA 4MR8A 2RGYA 1L5YA 1M5TA 4EYQA 2AYXA 3HVRA 1JYEA 2FQYA 2FSPA 4EYOA 2PKXA 3MYYA 3Q15C 4LE0A 4WUTA 1BDIA 4Z4GA 4KK3A 4IMIB 3VNAA 2E4ZA 3LUAA 2P9HA 3HUTA 3H5OA 4YCSA 1E2BA 4MAAA 1Z12A 2X7XA 1ZVVA 4E7PA 2PUDA 4W5NA 4EY3A 5TPZD 1K68A 3K4HA 3L6UA 3Q7RA 4Q6BA 4B09A 3GBPA 4IILA 4L4UA 3IP5A 1FFWA 2E4YA 4JOQA 4OTZA 2LPMA 1Z2EA 4JA2A 3T38A 3TX6A 1AB6A 3EGCA 4MLCA 5DCLA 3H5TA 2P4UA 2PUGA 1KGSA 3ILHA 5CNIA 1DBWA 4MR8B 1JL3A 4LDAA 5CNJA 1EFAA 2PAFA 5KI6A 4KNYA 1U2PA 4N03A 4FB4A 1NXPA 1QKKA 2QXYA 1SXIA 1MB0A 1S8NA 2HQBA 2B1JA 2VK2A 4GPAA 4MQEB 5IX8A 3O2QB 4LDZA 5JNSA 3FMVA 1W25A 1OXBB 3TMYA 5PNTA 3EAFA 2MYNA 3H1EA 1ISSA 2TMYA 2CHEA 1RNLA 2FQWA 3N6VA 5T7BA 4S05A 4KPYA 2MYTA 1YS7A 4O1HA 5KC8A 3M9WA 2RDMA 2JK1A 1DCFA 1QO0D 1GCGA 4O5AA 1FFSA 2MSLA 3MF4A 3OO1A 3T6KA 1NXTA 4EYGA 3LUFA 1LK0A 3GA5A 3N8IA 5ED4A 4D74A 4N41A 3OQMA 1E6LA 1GUBA 4RK5A 1Z15A 4OLBA 2FMFA 2E4UA 4DQDA 2MYPA 3OMWA 2FQXA 3F7NA 3H75A 3OLXA 1MIHA 2IKSA 4JAVC 3EQ2A 4MR7B 3F73A 3N0WA 1EHCA 1SRRA 3NNDA 2H0AA 1B00A 3A0UA 2FMHA 3EDCA 3RQIA 3I09A 6ABPA 4N76A 4YRZA 4XFKA 4Z4HA 3IPAA 4MPTA 2YHBA 2WWVD 4G86A 4KFCA 4ML3A 2A9OA 4Z9BA 3GT7A 3QLVA 4JB2A 3RVLA 5C5CA 4XAQA 1BDJA 4XASA 5EWJA 1NTRA 4IMJB 3Q41A 5E3JA 2WMYA 3MQ4A 3RVQA 4Z4IA 1UDRA 1URPA 4WXMA 4ZJPA 1TM2A 3I45A 4LE1A 9ABPA 3OLVA 3H6GA 2XDYA 4QYWA 5EWLA 1NXVA 3EJWA 2L17A 3BRSA 1Y1LA 2R25B 3DLHA 4F11A 1R8JA 1LJLA 2QSJA 3KKEA 4RXMA 1PUXA 4KZKA 4RK7A 3LTEA 4ETNA 1JH9A 4KRFA 4F12A 1L5ZA 3NHZA
chains in the Genus database with same CATH superfamily
3WHLA 5AVJA 3DW1X 2H6EA 3JTEA 1ZN7A 4RVFA 5C8VA 4DMCA 1QF9A 1GD1O 2BW0A 4ROTA 2B8EA 3MMPA 5B1DA 1ONNA 4ATNA 2AKAB 3BIJA 2J32A 5EP2A 4BE7B 1PJ8A 2PUHA 1ZI9A 9MHTA 5A3VA 1M1YA 1IZZA 2C0CA 2I2CA 2XGGA 3HC7A 4ONEA 5HS6A 1GZDA 5CNKA 2J3DA 3D02A 1ODJA 5CVVA 2NXWA 3HU1A 4EARA 4WBXC 4J8PA 4NBWA 3LXUX 4AURA 1WB9A 1ZK2A 4L0CA 3KJEA 5G1NA 4O6VA 3UV7A 1KJZA 2ONZA 3DVLA 1E9FA 3JATA 1HKUA 4N3NA 3HADA 4LZOA 2QVBA 5BW8A 3ADCA 1YE3A 3EGXA 3BK1A 4Q37A 4EJ2A 1UIRA 3GLKA 4HYEA 2IHUA 3U4DA 3THWA 1J0EA 1OUMA 4GMKA 1O3YA 4MUAA 4KLCA 2X7HA 4PAQA 4NCKA 2JG3A 3T1OA 2P75A 3U4AA 2HEGA 3BAZA 3QPWA 4TLMB 4TZKA 4X5OA 3HR4A 4ND5A 1O96A 3RTCA 1L6IA 2P6UA 3LZ6A 2FR1A 3ND9A 4FCWA 4CDNA 1NTOA 4OKSA 3AF6A 3AFNA 4L51A 1IQ0A 4FU0A 1KY3A 4C6HA 2ZGVA 3KOMA 3QYPA 1NR1A 1I36A 2XXBA 4KQFA 2LIPA 5HF8A 1EFHA 2OHJA 1N2OA 2JJQA 3HVIA 2HY7A 4LCBA 3BWMA 1GR0A 3TGLA 1Z18A 1Y81A 2GXSA 5CB0A 3WKDA 5CIYA 1E6UA 5D3MA 1TUBA 4N5MA 1G4HA 4L57A 3WZLA 3I61A 4GPBA 1N32B 4R6XA 3J80A 2WWYA 2Y99A 2EYQA 2ZSJA 1Z8HA 1XPOA 1ODIA 3AF0A 4HLCA 1V8DA 5HM6A 1D03A 2NZ2A 3GGJA 4XD7A 2AR7A 4HYQA 4XPIB 5HIKA 2QTZA 3S68A 1YBAA 3FZNA 4MAFA 4DUGD 1A0OA 2J5KA 2ZJ6A 1Y8AA 4JENA 1JYSA 3C70A 3TD2A 1PWXA 4WGGA 3WK8A 1J2EA 4UNIA 3DBHB 1EWTA 5K3DA 1KAMA 2OC4A 4N8DA 3TKAA 3OX2A 3NCHA 2G4CA 5D8DA 3T4XA 1I32A 3DLCA 4I9GA 5C18A 4RPIA 4XQCA 1UBUS 5AVXA 1U0FA 3HCWA 4G63A 1DAMA 4RFVA 1C3VA 3QEMA 4DOMA 4PANA 2FU5C 2V7GA 1P7VA 2J41A 2ZR9A 3KKNA 4G23A 1JIIA 5GJBA 4JVNA 2RHLA 3OE1A 4OB8A 4RVNA 4IFTA 4QDJA 1NC3A 1ONOA 4JYCA 1GQ2A 3DOOA 3CE9A 1DIOB 5JFTA 4BVBA 2GR9A 2QKYA 2JHAA 4ND4A 4U00A 4L1KA 4NCHA 1HUQA 2JIPA 3PENA 1FU4A 4G56A 2C4VA 4EJ0A 2XT6A 4QOIA 4M98A 3EPRA 4JQZA 4C7OB 4IGFA 3ABIA 2BZ1A 3ENQA 3WFJA 4WAUA 4XIGS 4MQ4A 5KOIA 4L9WA 4C0QC 2UZ3A 4KP7A 4KR6A 4HDMB 4EECA 1O0CA 3EISA 4TL7A 5ERYA 1NUAA 2IXBA 3WJ2A 5AUOB 1QDEA 3K9CA 4EYSA 4URVR 3TCKA 3LPMA 4M0FA 5K51A 1W0KA 1OTHA 4FT4A 3ZD8A 4EMUA 2JGAA 2UZ0A 1E5DA 3AEKA 3STWA 3TJMA 1JR3D 3ZU2A 4M9RA 1IN4A 3G1TA 2FUG6 4D41A 1ZK3A 2X9GA 3M6LA 2FUEA 1LI5A 4WOBA 1GNQA 4GFDA 4UZFA 2DLNA 3IS3A 5DHSA 3RS4A 4BFVA 4YUZA 2XF2A 3BN3A 4NATA 3SYMA 4MV7A 4QQNA 5IMBA 2EFGA 2C3YA 4J90A 1YUMA 2Q5JA 3O4RA 3EDQA 2EZUA 5A05A 4ARAA 1GXSA 2C9ZA 3FCAA 1ZNWA 4PZ0A 5ESWA 5FUYA 1XZCA 3KB1A 4J0JA 4U6NA 3UH1A 4AAYA 4E31A 1FDUA 4LI3X 1M9NA 2OP1A 4J29A 4WBNB 3FYUA 3JQ8B 3W6UA 1SJ9A 3IMGA 1R8XA 1YBHA 3WKBA 2ON6A 4DLVA 5AKKA 1G64A 2ZE6A 2HB6A 4KQ9A 4QO7A 1STOA 5EZYA 3QJ5A 4HEJA 4IOLA 1DKNA 5BV7A 3L7OA 1KI6A 2QZSA 3DYBA 3K9FC 4KREA 4I8IA 5FLYA 5L3ZA 1VJ0A 3PC7A 3AESA 1Z0FA 4YJ3F 3O2JA 1MENA 1TCBA 1D1TA 4LV5B 1SIUA 4DLNA 2VK1A 2PZ8A 4DSAA 2BD0A 1LFAA 1I7SB 3I9JA 4L15A 2ISCA 4AT1A 5IU6A 2DX7A 1YCDA 1WO8A 1X7XA 1JA1A 1M1NB 2EG5A 3PQ4A 4HL6A 4X1KA 4BRWA 5JQGA 2CWWA 2O1EA 1K66A 2AC7A 2VF8A 2GO1A 3O21A 4KQ2A 4BNHA 1W5FA 4BVHA 2WSSA 3OKCA 2AYYA 1DQYA 2FEOA 1EYZA 3JAKA 4BNUA 1T8WA 4C6TA 4FTWA 1HLGA 4V1CB 3GLIB 4R3NA 1GKUB 3GEBA 4NXNB 1L5VA 2GYUA 2HQSA 5CXXA 3M4NA 1L7EA 3ENWA 3LPAA 5EZQA 1FXWF 2CJFA 4I1UA 1KZ4A 4KQWA 3DOEA 1AZWA 1TEXA 4FYHA 5JALA 3IUEA 5E38A 1QV7A 3EAQA 5CFNA 1U0LA 2EGUA 3BSWA 1PZXA 5KOJB 4FOSA 2UU9B 1QGZA 2PWAA 5I8ZA 1RADA 1BIFA 2QL5A 2HZ7A 2QE7A 2VEOA 2VQ3A 3QENA 4IGAA 4BV2A 3MRXA 3K96A 2CUTA 2NV6A 3OLCX 1O77A 1JP7A 2A86A 3DO8A 3OJCA 4I50F 3UM9A 4LHWA 4EG6A 1M34E 1HE1C 2NTJA 3DV0A 3HJHA 1H2XA 1NBOA 1VP9A 3FM9A 3MB8A 3QXGA 5FA8A 3UXMA 4WBNA 1R5NA 1YJQA 1TO6A 2W4QA 3BWEA 2NP7A 1NOJA 1EIWA 1DQRA 3W78A 2B34A 4CU5A 2I99A 4L4ZA 2EQBA 3UPDA 2H1CA 2NPIA 3ST7A 1L4YA 1JQKA 1WSDA 2HV9A 3WTBA 1IY1A 3MT7A 3T5BA 2HHHB 2XD9A 3UKJA 3U19A 4P3OA 2JZCA 1T9KA 1J5EB 2UUOA 3OCWA 4MULA 2II6A 1XF9A 2YWGA 4HLUA 3BWBA 4W5WA 2WB4A 3N76A 1FSFA 5E9QA 2CE7A 2LRHA 2OZLA 2H8GA 3JASA 3THXA 1GRVA 2J9ZB 4XVCA 1T2NA 3ER6A 1RM4A 3CB4A 3DMPA 5JAUA 2OTCA 4YI5A 5IEJA 3QVWA 1CY6A 4HNQA 4CMHA 4PPGA 5K0LA 4KK4A 4RD3A 4EI9A 1E2NA 2ERCA 1E4VA 3T5DA 4DG9A 3JQAA 3O3OB 4LJ7A 2ZAGA 4UPVA 1R6VA 1R4ZA 1II9A 4GMXA 2G5TA 4J75A 1EP3B 2IPXA 3JALA 4LV6A 4MR7A 4A26A 1GKYA 4EFNA 2RJ3A 3RVJA 1CWUA 1TUIA 1L7QA 3KWJA 1JG7A 1W0CA 5GVRA 4IV0A 1S2MA 1PU2A 3T7IA 3BIOA 3M6MD 1OXVA 3Q11A 5TMBA 3EHDA 4X93A 4D02A 1VSUA 2FWMX 3ZHTA 3HU2A 1S9DA 2NU7B 3D4IA 3NH9A 1I2BA 4Q21A 2WK1A 2J6HA 1Z2OX 3QVTA 5K0TA 3GP5A 1M2FA 3NEPX 4AJLA 3I76A 2JGDA 3TLKA 3ODPA 2F1RA 3D43A 1XAHA 3TRJA 3RYFA 1JU4A 1GA6A 3BF8A 3VGJA 2FPSA 1O87A 1YVDA 2RHOA 3IEKA 2WABA 3U44A 4RY9A 1EQUA 4MYDA 4JKIA 4LMRA 1Y5NA 5DB4A 4E5MA 1CE8A 1V7PC 5JNLA 2HFJA 1DMRA 4OHWA 2AZXA 1S3SA 2UKDA 1U2DA 2Y1LA 3CV3A 4AJ1A 1QHHB 1WVIA 1ZKDA 3E5HA 5LA6B 4TKLA 4CHTA 4B4UA 1U7PA 2H0RA 2K5UA 4D96A 3OURA 5HR5A 2YHIA 5L3QA 1P1CA 4ZO6A 1JR6A 3OE7A 2XY4A 3VTKA 2VNAA 4Q7QA 3DV2A 4G1CA 4FFNA 1DC8A 3RRYA 4KQEA 5CHYA 2O2DA 4YP0A 3ZDXB 3OHPA 1O5OA 1U99A 1WHSA 4XVRA 1KI1A 1XTZA 4RK0A 3M7IA 3W06A 3SGLA 2B30A 3NWPA 3LJKA 3HCDA 4PYLA 3P0EA 5FL7D 4ZU6X 4WOJA 8OHMA 3ZBUA 4RXMA 2CY0A 4EUNA 5A62A 2QL7A 4U7TB 4NZPA 2CMHA 2GPBA 4XWTA 2MCFA 3GZNB 1OAOA 5EIBC 2JNWA 3R9XB 3SEQA 2DBRA 1R12A 4J3JA 1DEXA 2XI4A 3PQDA 1NJ1A 5DYYA 3AR6A 5FHQA 3SR3A 3QLUC 5HUJA 4EB8A 1H0KA 1M72A 1AMUA 2X0NA 3ENVA 4PLZA 5ALZA 3NYQA 5EPEA 4V0SA 3O91A 3ESXA 3MFQA 4N6NA 1JS1X 2GCPA 2AI1A 1R0WA 4CV2A 2R66A 4WE3A 1H9CA 1A9OA 1BRMA 3OUZA 1E6EA 3P0JA 1ZK4A 2FFJA 2H3EA 3KOWA 4H17A 5ECGC 5C2JB 3EA0A 3GLFA 3KB6A 3SG0A 4JR0A 3E61A 3OSUA 1T2AA 3INNA 2J09A 4MQFB 1SHJA 1MIOA 4ND6A 1QTQA 2JDID 4KQIA 1CEYA 3TG8A 3OJWA 4QTXA 1QV6A 4E5DA 3I8XA 3B51X 4JUFA 4EA7A 2B4AA 1NAIA 3L0ZA 3X1MA 1BHO1 2PE5A 4Y2XA 1ORDA 2A58A 2ZRAA 1GNLA 1C0PA 5AKLA 5LP6B 3K1YA 1DIRA 3DNPA 1C0LA 3KWMA 4WLOA 2PMBA 5K6AC 4UU1A 1VBFA 4YRBA 2CLEB 4CIAA 3DZDA 1CVLA 2IJGX 4HUQB 4PCLA 3UENA 4BZQA 1M2GA 3MJ4A 1NZFA 3SEAA 2DFLA 4LI0A 1A3CA 3DMGA 1XPUA 5FL3A 4M1MA 1BMFA 3THOA 5EJ9A 4MYRA 2FVYA 1QORA 2A5JA 4FINA 3Q72A 5J4HA 4BB5A 1RI5A 3MMZA 4UHDA 5DXJA 4HAOA 1Q0PA 1QHXA 1SXJB 3AEZA 2AXPA 1I7PA 4FNGA 1XNRB 4L07A 1XRRA 2AEMA 2G17A 4B3FX 2R5NA 1U1GA 2ZIAA 3DXFA 3FB1A 4EPWA 2JKYA 4G9GA 2CHVA 1E0SA 5JSQA 1ZM4A 2P69A 5KQSA 1PV4A 3O1LA 5F9HA 3RSCA 1MOZA 5I7FA 3OZ7A 2XDWA 1XQ6A 3B9PA 1C7FA 1NA5A 5FHRA 3KXLA 3CH5A 2JLBA 1I94B 2X7XA 1KC3A 4E7PA 3ERCA 4CIYA 4W1RA 2EP5A 3K1TA 1CULC 3NT4A 1E3JA 5KTSA 3U3XA 2Q1WA 5K8IA 2HIAA 4TLDA 2QZ9A 4TKZA 3B6IA 2PRYA 1M76A 1MAHA 5C8YA 5T3UA 4WBSA 2YWRA 5CW1A 2Y77A 3DCYA 4RQBA 3U7QB 2XJ4A 2FP4B 4NU0A 3GQVA 2WKRA 4CMIB 1KBZA 3H1BA 5CNJA 1UKBA 4F38A 1EFAA 4IVPA 4KNYA 3O4JA 3Q8KA 1C5KA 3I0NA 1IBMB 1ZN8A 2WF5A 1II8A 4IFBA 4I7EA 4MGKR 4MQLA 2FPPB 2ID4A 4YP5A 3VC1A 3IT2A 1BC5A 2WP8J 3D6AA 3NHLA 4LSZA 1ONSA 5J2TB 4L2IB 4HEQA 3LO8A 3IAXA 1XZAA 3SBEA 3WB1A 2O8VA 2PSSA 3CZQA 4ER6A 4AB1A 1J1UA 1X86B 2PX4A 1HK7A 1ID1A 3ASUA 5TB5A 3QKIA 4OYHA 2EXXA 1Y34E 2IYOA 1VJ5A 3IUQA 4QRIA 2O5EA 2VDUE 3FAKA 1KYXA 1XR3A 2FVXA 4ZHSA 1FUEA 3CLUC 5TGDA 4GGMX 2EZ9A 4NHOA 4UVEA 3KD2A 1XMPA 1VYTA 2YWHA 3M1YA 3JR7A 4FKMA 3FPFA 1MFZA 3FHLA 3FPCA 4MYUA 3UAWA 4YWJA 1S7CA 4M1KA 3G5AA 3SZGA 1LK0A 1L7NA 1U8CB 5AK4A 1C9NA 1LZKA 3I6ZA 4K26A 4OHRA 4QEDA 4X3OA 4FEYA 2C3MA 1PJCA 1OLUB 3K0FA 3K9BA 4HWOA 4WFJA 4OHCA 4X97A 2CXRA 2J6BA 2W2MA 2GUGA 2Q4OA 4NMWA 3TRDA 2GN9A 1ZM7A 3AONB 4BNMA 3FF1A 2DR2A 1ZA2A 2YYZA 1CF2O 2ZJ4A 5B5SA 4XVUA 2OHXA 5DNWA 1R0BA 2B8WA 1YZKA 1EFPA 3A0UA 2B61A 4FFWA 1KDRA 4GXNA 4K28A 3W6PA 5DPMA 1XU9A 4NS4A 4IWNA 2NSHA 1A5ZA 2BIFA 2VT6A 3PTAA 3I64A 4FD2A 1F8GA 1H2FA 2QM8A 3FNBA 2PRSA 2ZM6B 1KHTA 1FDVA 1FPQA 2NV2B 2RSLA 1C8BA 1OXUA 1PDWA 2A9OA 4FFSA 4JHXA 4F2DA 5BWOA 4ZU3A 5LZ8A 1OPXA 5FO1A 5LLTA 5DCWA 5BMVA 1MVNA 2POCA 5AQ1A 1ECJA 1MO4A 4OSEA 4HQLA 3K70B 3DHEA 1U2GC 2QM7A 1N2IA 1DWPA 1SU8A 4HNAB 4PGMA 2PUJA 4RMHA 1JB9A 4WXMA 5TEWA 1V8FA 3OF5A 2J9XB 1G8GA 3GC6A 2EIHA 3K6SA 3MWLA 3JD3A 5EWLA 1ML4A 4Q1VA 4BVGA 1ZNQO 2DKOA 9GPBA 2R25B 3AEXA 1QLJA 1SHZA 2NO7A 4RDIA 5DEIA 3UJ8A 1I6LA 2G4LA 5IS2A 2CEAA 1QRRA 1PWEA 4YMWA 1A9ZA 1S2NA 4EFLA 1G66A 1WNFA 1LBSA 2GLXA 5G4KA 2OO5A 5IVIA 3RSQA 1I2DA 3Q8LA 3I05A 2R48A 2NUPA 2HMYB 1QZUA 4H7PA 4NG5A 4NOMA 5ALLA 3NM4A 4ZOAA 4KG7A 3JQ7A 4G5HA 4I4IA 4AZ0B 4D42A 2QBYA 3N0XA 2CBZA 1BFDA 3BWDD 3EAGA 3Q0IA 4WXRA 4XGRA 3USES 2XMZA 4F71A 5JWRA 4HH4A 1I2AA 1BWPA 2ENUA 4B4WA 2R5WA 4HNTA 1BDBA 1BROA 4PC3A 4AC9A 1KS9A 1E1CB 3QA9A 4GE3A 5CA0A 3W8FA 1ZM9A 3D3NA 2FPIB 4CTKA 1U8EA 4QOHA 3K0HA 1CP2A 5JS1A 1WE2A 3CNOA 1FYVA 1OZHA 2ONYA 3EF3A 5AXDA 2VQSA 2V7QD 1X3SA 2NYVA 2XKAA 4FKBA 4UAUA 1ULZA 5KC9A 2V7BA 2LIVA 3KJIA 3PX3A 5ISMA 3SDBA 2XT0A 3HCBA 1SBCA 4ALNA 1E6KA 3AC0A 2TMKA 3GJ4A 4JI8B 3VSBA 4EVRA 2A5YB 2AWOA 1LF5A 2P8JA 3FHCB 2HPAA 3JASB 2N46A 3IAEA 4NI5A 4J0QA 5JRZA 4D1YA 3MJVA 4MR9A 2HSZA 4X64B 4TVSA 5CCEA 4LQDA 3KOYA 5EYPB 5IN5A 4Z51A 4YT8A 5KNBA 2EX0A 2RB5A 2WWHA 3V6LA 2BTQA 4I4CA 3WLSA 5AVYA 2CDAA 5TGTA 2OENG 4X8LA 3T1VA 3C1TA 2I6GA 2OAGA 4K3VA 1EFRD 1JECA 2GUWA 4GR9A 5TQVA 5B4TA 4TLBA 5C3UA 3I9MA 4N65A 1HDGO 3ZV7A 4QJ3A 1ZINA 4ACAA 5E4YA 5BVGB 3VC7A 2AF3C 5J2UF 2O7QA 3PUVA 5BYBA 5KTKA 1NDQA 3QI2A 2FMIA 5B3JA 1OB2A 3FTDA 4MGIR 3WB0A 1EP9A 3OU6A 4IQ0A 1W8DA 2C1XA 2WT9A 1COZA 4FYYA 3PC8A 1F8FA 3GFTA 3SVTA 3LY9A 3DZHA 2QW1A 1PRYA 1QM5A 5E6UB 1FPMA 2O2CA 3CIFA 3KUCA 4MV4A 4OFBA 4DEYA 5AW2A 1NULA 4RD4A 4U9UA 4I1RA 4HNVA 1Y4UA 2RJNA 1G8HA 3LQ2A 4EUEA 1PO7A 3ETCA 3GBVA 2HRCA 1GTL1 2G63A 2WUFA 1QH1A 2D8AA 3QUBA 4Z0TA 1FFEA 2PA3A 2NQTA 3N74A 3CWCA 4L5CA 1DFHA 3DTYA 2R68A 1ZBQA 3Q9NA 2FW6A 3IA2A 3M2PA 5CDHA 4NECA 1QK5A 4DNPA 1P81A 1SOMA 2DQYA 2G25A 1YR1A 4XCXA 1J6UA 4G97A 5IP5A 2YRWA 4OB6A 4DG5A 4BNFA 1Q1GA 1I4DD 1WXQA 1W9MA 2AZ4A 1FF9A 4DY4A 5KNBD 1I3KA 1CRPA 3NYRA 1UBSB 1VJTA 4MVXA 4KXUA 4YJ3A 5LU9A 1HFJA 1H2YA 4BP9A 1RBQA 1ACMA 3UTCA 1KSFX 1CUBA 4RZHA 1L1FA 2C8KA 3A26A 4JVOA 4F2HA 2BGMA 4HDNB 4NR0A 4DLRA 3BL8A 1R1DA 4A0SA 4DLSA 3CXUA 3KL2A 2BGGA 3E27A 4GOLD 2VJMB 2FPLA 3LT0A 1VECA 2Z95A 3I2IA 2OD7A 1ZGGA 1NQXA 4JL6A 3RC8A 3NASA 4IZ6A 3N2GA 5TLSA 1R4MB 3NTOA 3PL5A 4TWJA 1U0SY 4X24A 5EXDA 1JU3A 2OZVA 2E1RA 4HH3C 1Z3CA 1ND6A 5AIAA 1L5MA 5I5GA 3DF7A 5AT1A 3DCIA 3B9RA 4JKOA 3K1ZA 3HK2A 1PT6A 4IZIA 3RRJA 5ICFA 4PHHA 2B1IA 2XMRA 3H11A 2ZB7A 3ORSA 4OQXA 2E21A 2ODPA 2FZVA 4MV0A 3TRFA 1IQUA 3SYTA 5C1DA 1SC6A 4R1NA 1ZHHA 4B43A 3M4ZA 5EVCA 3KTAB 5FTMA 3LV8A 1HDRA 1UUFA 1X6VA 4JCOA 4GEGA 4OGGA 3WG9A 3H1TA 3IT1A 1ADJA 3EIFA 3TGPA 3VSDA 5CIWA 1JJIA 1TA0A 1EVLA 2FWAA 2V98A 3EQ7A 1J42A 3GWZA 3CTMA 4GSYA 1UJ4A 2JVIA 3GOHA 3F67A 3NHPA 5HKAA 2HF9A 5DM70 4O2LA 4BFLA 4D8XA 5JFGA 4AI6A 1J2UA 1U3CA 1XYGA 1X80A 3DXYA 1ZMTA 5L4LA 1JAHA 2V9ZA 3RWMB 3ICWA 4UUQA 3VPCA 4PG5A 3LMKA 3CG4A 1PP4A 5AW9A 2LKDA 1N8KA 4ALKA 3K92A 4YRLA 2EDCA 1WL8A 2WSYB 3EBLA 2KB0A 5KKNB 1ADCA 1W94A 2GBGA 5L53A 2GSDA 5AI0A 4H59A 3T0IA 2BELA 2QLBA 4EF6A 4JP3A 4FEAA 4R8SA 3LS2A 1GM5A 3IE0A 2Q4TA 1N2ZA 2J4CA 3KEQA 4BMZA 3BH0A 3ZE0B 2WVJA 1ZH4A 3BFKA 2DQZA 4IH4A 3VZBA 3N8GA 4ZAFA 2N0SA 4CI0B 3OCYA 1THGA 4M8SA 2ATEA 3AHJA 4QQRA 3BXOA 4DJEC 4KBGA 1OYVA 4H4DA 5C7LO 2F3UA 1CZLA 1EX6A 3DMTA 4XM2A 5A6SB 2PT9A 4O2BF 2X5JO 3GGOA 2EL9A 1NASA 2PM8A 1KAHA 1CUCA 3BWVA 3CF2A 2WDZA 2GRUA 1F9EA 2DAPA 2W71A 3ITNA 4GSLA 1KDZA 3RKRA 4GWGA 1U9CA 1FX0B 3QVKA 3UW3A 2WNSA 3QEJA 2DBQA 4CM3A 4JI6B 3W5AA 3PYLA 1NQ5A 1UODA 4LGYA 3NVMB 1OLOA 3L7BA 3NIDB 4F1JA 1NDHA 3A6DA 1D6MA 2J67A 3HDTA 1GPUA 4IIBA 1K75A 2P77A 4RY0A 3N53A 3UJ3X 4CG1A 4HGNA 1LPMA 1Y3DE 4RABA 1JQEA 1KDVA 4W99A 1I51A 1TE2A 2WMDA 3HLKA 3UHOA 4Q4CA 3FUWA 2GLUA 3RQSA 3VTFA 8AT1A 1IOVA 4A6PA 3KSBC 4QBHA 4BGEA 3SXPA 1TJ4A 1RWOA 2EKPA 4CEHA 1PJBA 2YJZA 4UM9B 1CW2B 2C9OA 2KQUA 2VOJA 2Q2NA 3OX4A 4EHAA 3LX4A 5BR1A 3QG5A 5ENDA 1SOAA 3STXA 3B3QA 3QSYA 2IITA 1D5WA 1TYBE 1N6RA 4DV3B 3FWKA 3SZMA 2G09A 2NQ2C 4DDUA 1XCGB 3KJQA 5H3CA 3R7DA 3GO4A 1X14A 1BW9A 1LTQA 3BE4A 1L9XA 3G5LA 1J2TA 2HGSA 2WU8A 3KT6A 2P9EA 3SX4A 3VYSB 2H85A 3WV5A 1WCYA 4NBNA 4QGBA 3JTMA 5B64A 1QX4A 4A23A 3ROPA 3TEFA 4HBGA 3ZNNA 2IX3A 1KXZA 4E4YA 3I28A 1J21A 1GPWB 5JS8A 2C4KA 2ZJ0A 1Z38A 2X1VA 1XSEA 2P2LA 3BQNB 4G5SA 8LDHA 1U2ZA 1P2BA 3NOQA 1X3LA 4B9AA 5FLEX 1ZGBA 2ODBA 2WF7A 5FWDA 3ECAA 3ADOA 3NOXA 4G5QA 4W8GA 3S4YA 2OP0A 5J1TB 1CG6A 2FV8A 4GBED 3MHTA 2D62A 4EDHA 5LQMA 5E8RA 1E0DA 4UULA 1QHSA 5F5NA 3FNRA 3T5PA 4FNAA 4LOJA 1OLSB 4IHKA 2E7ZA 4HT3B 3SOPA 1BMQA 4OQPA 3ZUPA 1K5PA 5ECDA 2KE5A 4Y6QA 5FIUA 3QRWA 2P5SA 3L7LA 1M8PA 1B0PA 2HQ1A 4MYTA 3T9CA 5CEEA 2VRNA 4RSGA 3H2GA 5DULA 5IT4A 3LECA 1KY5A 5ER6A 1ISIA 1P31A 4MWOA 4Q7JB 1P9RA 2QTWB 2VDRB 2RH8A 1Z0DA 4BGDA 5C31A 2CVQA 4G89A 5AVRA 2H7YA 2SKEA 5F9FA 2FR0A 4CUKA 1FP2A 3OFKA 1Q1NA 1RP7A 3A3PA 4PBTA 5EQJB 1RAAA 3FUXA 2E1PA 5P8WA 4UXIA 2IS4A 1YH3A 2EJBA 3KD3A 2X23A 1EJ2A 4AKIA 4A6XA 3ETNA 1EMDA 1G3IA 3I8SA 1I33A 5E1MA 3BBLA 1HWYA 3FNFA 4I4NA 5E0OA 4A8JB 4ENQA 2QTLA 2G0AA 3KCQA 4LY0A 3P71T 4GU5A 3OX1A 5A5FA 3HP4A 2GTIA 2IOHA 4X7BA 1HEUA 2HRZA 1UJ2A 2ZAOA 3UCEA 1HE4A 2I6FA 2CVHA 2JL1A 2ZRPA 3CC8A 2Z8XA 4JL8A 4WN3A 4PQFA 5LC1A 5IT0A 3QX7A 3R9XA 2BCJQ 2NUTB 4KV7A 2CLSA 4IW3B 1BFUA 4FYPA 4L8YA 5CFPA 1AD2A 1HYGA 2CUNA 1RU3A 2XD4A 1TC2A 3K31A 1M67A 2GBPA 4P7GA 4I1SA 1JI0A 3A27A 4LV8B 4YJ2F 3TS1A 3CLSC 4ZYZA 1NNEA 1R0RE 4FYWA 4C7OA 3HDVA 3CLVA 5EJ4A 1CZHA 2QENA 3PX7A 2QSUA 2Z6VA 1T3SA 1XAIA 2M32A 3GGSA 4BYGA 2OXCA 3O3CA 1A9SA 3KAQA 3A4TA 5EZYF 1NV9A 4CMEC 1QFZA 1K8ZB 1G8FA 4L5IA 2ZYGA 3AFGA 2CVOA 2E5FA 3IP9A 4W9RA 4Z4EA 5LA6A 2QVCA 4KXMA 2ZJOA 3ICCA 3MRTA 2DT5A 2JRLA 1TW3A 1V39A 2ZIEA 2PUTA 5G4KB 4X44A 4EB6A 3JW8A 4IPTA 1F4PA 2YOFA 1VL2A 3W5BA 4U7FA 2Q8QA 1RACA 2DWPA 4R9NA 4AXXA 2B7LA 5J2UA 3MAJA 1M0WA 5DJ5A 4B34A 1N6OA 2V74B 3NYWA 5U4XA 4O8ZA 4LHEA 1NVEA 3LKZA 4JLKA 5ADHA 4MW6A 3STHA 3NRBA 3ER9A 3AVUA 1CJSA 2C00A 3O9VA 2GXUA 1E8DA 4P81A 1TT5B 3ZKAA 1KOJA 3QV2A 2DJ5A 4U0JA 1IXKA 3QWFA 4GP6A 2D1TA 3EZGA 5CXSA 5D00A 1P4HA 1YA4A 2JI7A 2IXGA 3KSAC 2RAVA 2PVSA 2WIBA 3GFBA 4FJ2A 4QOSA 2QPTA 1EVKA 1H2EA 2NO6A 3CUYA 4K9KA 2NOAA 1MB4A 4F92B 1TK9A 4PYMA 4BO8A 2J0UB 4H27A 4AN0A 2JCXA 1IM2A 4IG9A 4RCZA 4ZZ2A 2NIPA 3MXTA 2ZT7A 3EIUA 1HX7A 1E18A 2IYLD 2FJPA 1WBBA 2IYWA 4BQRA 3EXFB 3RUEA 3ISTA 4E88A 2ZYUX 3AILA 4UXHA 5ELLA 4E08A 2R8OA 1JKJA 1FFWA 5JC8A 3GVXA 3OEWA 1FTGA 1WUYA 4JI1B 3VR6D 2QYTA 4BMNA 3R76A 5BPHA 5FLXA 3Q7EA 3G8DA 3A4IA 2DUWA 2BMWA 3MS2A 1E7RA 1ZA1A 4JGGA 3H65A 3MMXA 1LDMA 2PAFA 3Q85A 5AHXA 2G72A 1O1YA 2PGXA 4C4AA 2X1HA 3FR7A 5F12A 1OLUA 3OM9A 3RRNA 5L7WA 1CNMA 1S8NA 4DLWA 1E3SA 3EGVA 5I45A 5U1PA 4LFBB 2IXFA 4TS4A 3UKDA 1E20A 3TMYA 1IH8A 4YT2A 1FNNA 2LCIA 2FYTA 2Q29A 3ELDA 1V8PA 3HBMA 3IIKA 3WR5A 2OAEA 3M8KA 2FQWA 2ZJBA 4TUYA 4OI1A 3AXTA 1RXUA 2YV2A 4O1HA 2QW8A 2QRZA 4EZBA 2EW1A 2OE2A 3K53A 3PXCX 1VKNA 3VJKA 4GS5A 4NJOA 4JIGA 1JLLB 2O06A 4KX5A 3RSFA 4O5AA 3EZ2A 3I2FA 1TF7A 1HG0A 3NBZC 3NP9A 3E9YA 3T6KA 2BEWB 3A4LA 3GK3A 2QX4A 1JVBA 3RS2A 4DVGA 3GN1A 5JECA 5KREA 4U4AA 2G88A 4QTTB 4KWHA 4F0JA 1QGUA 2OLKA 4K9MA 4FHCA 1H4VB 2BKEA 3HJCA 4RA9A 4ETWA 3SP1A 4XWKA 5JQGB 2F1HA 5DX8A 3MGBA 4YDHB 3SMQA 4OLBA 4MDFA 4ARZB 2QX7A 1Q7TA 3IV6A 2HDOA 2O7RA 1PS9A 3A1EA 1J25A 2CNNA 4O4IA 2QL6A 4C0LA 2C7OA 3UV6A 1WV1A 1E2QA 1T5SA 1KNQA 2QTVA 1RRCA 3LOUA 2BI8A 1EQAA 3AF4A 2XMQA 3IESA 2NUAB 2HJGA 4Y2SA 1KBQA 1E1KA 2DY0A 2QRKA 1OBCA 3ZHUA 1TJ3A 1XTVA 1YBMA 2P79A 4LBWA 1OC4A 5EZYB 4B8YA 3C14C 3N2IA 4DWOA 1Q17A 4ML3A 4L16A 1MUUA 1E2EA 3GT7A 4RA9B 1TYAE 4NYMR 1Y3AA 4XA8A 3VPBA 3QYJA 3R5HA 3TL6A 4A6EA 2JGJA 3UC9A 1NTRA 1GQFA 1YQGA 3A6FA 3CKKA 5A9RA 1S4MA 4Q9LA 1EP2B 4RAQA 5CEJA 3AM5A 3RK1A 1P5ZB 2ACVA 1FFHA 5DLYA 3NAQA 2C8JA 5TT1A 4YXWD 3EJWA 1UWLA 2EW8A 3L77A 1ORRA 1VZ3A 2G71A 3KKEA 4E6EA 3C1UA 2Y05A 1C4OA 4F84A 4MIEA 5EP3A 4ETNA 2EEZA 1ZJ6A 1CYEA 5JCXA 2NAFA 4KXLA 4G67A 4O25A 3FI9A 3GPIA 2FG5A 2VHZA 3O8LA 3ROTA 1H9BA 4F9FA 4K6OA 3CG0A 4XYMA 2W42A 2WSBA 5JATA 1YU9A 3C6QA 5G41A 3W1EA 3NEJA 1WA5A 1PZFA 4IZHA 4C20A 1IEVA 4PZYA 3QU4A 3HBLA 2FUG1 3LYLA 2O8FB 2Y1FA 4BNWA 1NSTA 1NG9A 1QMPA 1NFRA 5LLSA 1YONA 2ZDGA 3JD1A 3DGEC 1ZH0A 3GCZA 2FZCA 3QFFA 3UTDA 2QN9A 1YQUA 1Y6GA 3E70C 1D2MA 1BHSA 3C48A 2HMTA 3S2IA 2QN6A 4BO0A 4S04A 4OBWA 4IEIA 4D79A 2BY4A 5EL0A 2WWWA 2BONA 4FOPA 1Z0AA 4BFZA 3S44A 1TIBA 2IIPA 1K6JA 2M2IA 4ZKDA 3AGQA 5TQ0A 4EPRA 3WICA 1MT0A 5GAJA 4Q34A 4RZ2A 3MN1A 4OAOA 4S1PA 4Z4CA 1HZZA 2P4EA 2X14A 1B14A 3BFXA 4D6YA 2I9PA 2G1JA 3VR1A 2FWNA 2ASEA 1FNDA 1MNQA 4QYIA 4URHA 1FP6A 3M34A 1T3LA 1U02A 2GZ3A 3AB8A 2ES4A 3B60A 1EWYA 3BQ9A 4LPSA 1KQOA 3KQYA 4NJMA 4L3WA 1P19A 4Q4HA 4C4RA 4CGZA 3VUFA 2C31A 1OU0A 4HXYA 5EJFA 5BQOA 4JXXA 3BG5A 1P2GA 3C8UA 2HDWA 1AX9A 3RGWS 3AY0A 4RGQA 3QUQA 3R4CA 5JPDA 2VI5A 1LH0A 2P68A 4V0LA 3ZE7A 4YB8A 4A91A 2CF6A 4I1VA 2B1QA 4JJEA 2CSXA 2XQGA 2YXBA 3NFRA 3OPVA 2JC3A 3RRZA 1QIJA 3WLEA 4B3MB 2B9VA 1XN4A 4D4LA 3ZS8A 1YZFA 1CE8B 4AKSA 4DR7B 1JHMA 2OBLA 3UT5A 2WE8A 3N2NA 4LOKA 4BVEA 2AUTA 2GM9A 4PZAA 1TTPB 3AF5A 4UTVA 1JQAA 4DUGA 1J09A 2W6QA 2X6RA 4NCJA 1THZA 4W7SA 2QT1A 3RYFB 4KTVE 1QE3A 2Q2QA 3FOEC 4C04A 3RVOA 1XYYA 1YR6A 1BCRB 2WHQA 1BJRE 2A5GA 4I9NA 1JI3A 3ENZA 1FJHA 3Q7IA 4D0GA 2PUAA 1EKXA 3T5MA 1SUCA 4FFRA 5HKOA 3NDRA 5IKOA 3ADDA 3T99A 4TLCA 1C0KA 2VP6A 4NU5A 1S8OA 1HQYE 2R00A 1MG0A 1ZXLA 2DWCA 3ZR4B 3G7UA 5LJLA 3P2MA 1RHUA 2PVCA 2R7LA 4QU9A 3G6KA 5EKTA 1SA0B 2BMEA 2B98A 1N1GA 2YQ4A 4NL4H 4OY3A 5KYYA 4OLFA 2MSCB 1Z8DA 4MOWA 1GN9A 1RYNA 1WHTA 5FDFA 4RK6A 1ECGA 2CXTA 4Y0NA 2G83A 1MB3A 2A92A 4R1QA 1W47A 4R8RA 5IMSA 4F56A 4DWVA 4Q7MB 1IDN1 3WFZA 1JKIA 1TLFA 1V35A 1B15A 1N7JA 2VUIB 1NMZA 1UK9A 3THYA 1BEEA 3O6VA 4C01A 1OGJA 2GGSA 1UC9A 4RHEA 4AKTA 2PCLA 4PNEA 3L6DA 5CFQA 5B3LA 1XVUA 3H5WA 1BXZA 3WP1B 4NCBA 1Z28A 1JWLA 2NVUB 5BT9A 4UBIA 4YUVA 1Y5RA 1QF6A 1FUUA 1VSVA 1KWGA 4EAAA 5AW7A 4F7WA 3JQAB 1BO6A 4HRVA 3JAWB 3LW8A 4KGVA 4RDCA 4JBIA 3KETA 3GLHA 2G5GX 3M5WA 1KZHA 1GL9B 4CF6A 4WESB 4FGZA 3AIIA 3F96A 1ZNXA 3DB1A 3PE6A 3ZX4A 1FFDA 3RWOA 3ORHA 5ARCA 3EYWA 1GTRA 4AG5A 1DIHA 3B1YA 4DC1A 1V37A 2OMKA 2IUYA 1TZ2A 4NQRA 2EZTA 3ON5A 4X1YA 2VPQA 4MH0R 2HI0A 3L8CA 1FJGB 1M7BA 4MB6A 4FYVA 3DEAA 4J43A 3WGMA 4E7OA 1O95D 3HDJA 5C8DA 1XI2A 3HDYA 3U56A 1HOXA 1RKXA 2YJ4A 3NAGA 3PTLA 2HHCA 4HAZA 1FRFS 4TMWA 4E13A 1VL1A 4YRFA 4BKRA 2JGRA 1JDNA 2W0MA 3I0MA 4FWBA 3CLTC 2QDXA 1RAHA 3LCCA 2AMJA 1NVGA 1TKCA 5CT6A 2IHVA 4F93B 3R3VA 2X2EA 3G1UA 1OFTA 1T10A 2UYQA 3DOCA 4O0LA 4BX0A 1GWNA 2EKBA 4B45A 3THYB 3AUAA 4DJDC 4AD8A 3E18A 5LKAA 2XQJA 3LLMA 4W9NA 5BW4A 1TXGA 2ZSUA 3FMOB 4QEZA 3VZCA 3V9PA 3DLBA 2QJFA 4KU4A 4X92A 3FNGA 3HRKA 3JAKB 3PUKA 2WWTA 3GLRA 1SY7A 2ATCA 3CSUA 3RARA 2K6GA 1P45A 3UMRA 2VNKA 3RC2A 4Z0PA 3S7ZA 3IRVA 4P92A 2Z56A 2FXIA 1J1IA 5J2TF 4ZAWA 5LP1A 1P74A 1V5WA 2YHAA 3DDUA 1A04A 3OM1A 4YCDA 3DFMA 2ZETA 3NHFA 5DXAA 1DSSG 3KR2A 1YOVB 1ZZGA 2R6CA 4S1TA 4O5OA 1O03A 1QTNA 1Z5WA 2ZI4A 4R68A 4AZVA 3DDOA 1BQ4A 3KX2A 6YASA 3GGDA 2CYBA 1IIBA 2NZUG 3OCXA 5CH8A 3ESYA 1N5MA 4V3CA 1BE6A 3BHJA 2A5FA 5ICMA 3H2YA 3QE9Y 3KZCA 4CEIA 5F35A 1G5FA 1O5TA 3HSYA 4A3SA 2PSEA 4Y1EA 1C29B 3OPXA 4D0SA 1LPSA 4KVZA 1Q6YA 2A57A 3F90A 3Q1LA 4NNJA 2HU2A 2TS1A 1QE5A 1V2GA 4B74A 4C7JA 3FFAA 3EB9A 3W1VA 1ODLA 1XZJA 4NK5A 2Z5GA 2HRDA 3GIWA 3UHFA 1PT5A 1W2WB 1PL7A 2V7XA 3MINA 4CKWA 4LF5B 2PN1A 1BU5A 5K3CA 3UNXA 4U2FA 3W34A 2WG2A 1E0JA 1KRHA 2FOLA 3HEAA 5H3HA 4WZBA 5CB4F 2UXBB 2BBOA 4DMFA 4WK6A 3NANA 5BW5A 3EWAA 1SC1A 3AJDA 1FX0A 4LTMA 3QUSA 4P6VF 4TXNA 1ZK0A 3OUTA 3U9SA 4CE6A 1M2WA 1VPLA 5IVDA 5LMUB 2EZ8A 1YQXA 5FUBA 3SLRA 3KYDA 1YA6A 1MO3A 1DZ3A 4OJNA 4BFUA 1A96A 2OFFA 4C1BA 4XXHA 2H1VA 3AUJB 1OSNA 2Q5CA 5F78A 1SC3A 3K0FB 2PQ6A 3CZPA 3PPXA 1NPTO 2ARKA 2LD4A 1I4OA 3ZKWB 3K70D 3R3WA 1AGNA 4CVNA 1ZDMA 1AKNA 1ZHOA 1QRAA 2WMOB 2YJ5A 1SVWA 5DLPA 2WY2D 4EG7A 1XWFA 4L0MA 4NVRA 5G02A 2YMPA 1GPJA 3M1LA 2W2OA 1LD3A 3C4VA 4MVJP 4QPPA 3IHLA 5ILGA 5BPFA 5JD5A 3UMMA 1U80A 5ERGB 1GPMA 4EZEA 2WB2A 2AXQA 4UBMA 1AZTA 2EKQA 4ITUA 2BE7A 4DLYA 1VKZA 3WE7A 3BSFA 4KW7A 1COWA 4UNSA 1HV8A 4MICA 4LRYA 1LB1B 4TKUB 4HYYA 3KR9A 1CJCA 1CNEA 1JEAA 4GNKA 2H51A 4KB5A 3SZUA 2D1YA 1KJ8A 4B32A 1YI8A 5J2TA 1P1HA 1UMCB 2GJKA 4ZAVA 4ZC1A 3E5NA 2GCEA 3LBAA 4JZYA 4XPIA 1GSOA 1L4GA 1NSFA 2D54A 3DFKA 1WZEA 2F2TA 5D5QA 4ZI5A 1TO1E 1BTOA 4RLSA 3HKEB 4OQ4A 4FQ5A 5H59A 4KOEC 3OCCA 4ZQHA 1RHJA 2M6RA 3RTAA 2NP6A 2JGIA 1DAHA 3G2LA 1U7UA 1EBBA 3U9TA 5DSZA 4C3ZA 3F3YA 5KOHA 3HGMA 4P7KA 2ZWMA 5JSYA 5B53A 2VTDA 1JHDA 2X19A 1GPKA 3OKFA 3N5KA 1LBTA 1W5TA 5FWXA 4I3GA 5IPFA 3HRIA 2CLLB 1N6PA 3GEPA 1BZYA 3CPSA 4H1HA 2IEZA 3D7RA 2HX1A 4KR2A 3NVKI 5FBKA 4R16A 3JSXA 3MTAA 1NLFA 1QG4A 3AFOA 1P2VA 2JFWA 1YTLA 2JIMA 5TMEA 5FYQA 1LWNA 1YULA 4XOUA 2R6JA 2Q4RA 3EA5A 3ZXIA 2PLWA 4V0RA 2CW5A 1IU9A 2WJAA 4O4LB 1P1RA 4F5ZA 4YMSA 4H7EA 3ABRB 5D1HA 3C16C 3GLGA 3BHIA 1TEZA 3V2GA 4BQSA 2PZFA 2QYOA 3KVOA 4JQOA 5DHRA 1OLXA 1PCXA 4LGVA 4CT5A 4AROA 2Z2KA 3BE8A 1OASA 4IGIA 4KO8A 4RIEA 5M3BA 5CLGA 5H4GA 2CJPA 1AKWA 3MWKA 1E2GA 2YXDA 4ND1A 1N2BA 1YVEI 3ETHA 4R83A 3PQ3A 4ALIA 1LXCA 2J3KA 4BKOA 3X1YA 3TLGB 1BGVA 3FTCA 3SMVA 2WU4A 2MIIA 4OH1A 5EGNA 5T4EA 2H29A 4X6UA 3QLJA 3SD7A 1SBIA 3Q10A 1PL8A 2JHGA 4Y7CA 1DBQA 1Z75A 2IK8A 2LW7A 1SNYA 3PVSA 4FGSA 4PWYA 3JQGB 3HVUA 4P4TA 4B3JA 3L9WA 2OZEA 1W4CA 1EFTA 2MSKA 4L8VA 4QGAA 4Z7NB 5KJ6A 2KMLA 1Q2XA 3I3OA 3F3KA 4P0QB 2VL7A 1EAYA 2BEVB 1X1QA 2KSQA 2VWQA 2YIVX 3E3LA 1CZUA 1KYQA 4MS1A 1D1QA 1JPNA 1ZVJA 3HNOA 4N7JA 1RYYA 4NE9A 5DM4A 4FYMA 4JB8A 1FU7A 1EGQA 2RI1A 4B87A 2DLCX 1H05A 3R20A 2CV1A 5K8LA 2E4ZA 1MX9A 2AFIB 2W6CX 4BPBA 1JKMA 4GBJA 5K8UA 2VJBA 2R8BA 3C7KA 4EY3A 2XQFA 2QW0X 3K4HA 4G2TA 3HUDA 3Q9LA 4L4UA 1Y7LA 1QAQA 3D6UA 3SHFA 4F3RA 2Z08A 2QK4A 3IQIX 4DKJA 3RFXA 3T38A 5IYZB 3RUPA 4WDRA 1G8PA 1LX7A 2IQIA 3H5TA 2GPNA 1U2TA 2XOKD 1DADA 5BSFA 2HMAA 2NXNA 2QMHA 4I8XA 1EDBA 4JJ4A 4MR8B 4L50A 4NCXA 5LCXA 3TR6A 1P7CA 3EPHA 3EH2A 2V7EA 1X13A 3VKVA 1UPTA 2BEUB 2EIXA 4RNDB 1AGRA 3QGMA 3AERA 3G9UA 1O9GA 3ROGA 5ITZA 1NP7A 4FZVA 3WRXA 3LWZA 3OCUA 2WSLA 1XMQB 3SHVA 3AV0B 4RENA 3PLAE 2HQBA 3UMFA 2RGXA 2XB9A 1V3UA 5EA2A 4GOOD 1GDHA 3PQ2A 1S3IA 1E60A 1OXBB 2HU5A 1WLYA 3E3AA 4NOJA 3OUUA 1E5VA 5AVWA 3UPTA 2BM1A 1CUJA 1ULTA 4EWLA 5T7BA 3E9MA 2ZU6A 1U7WA 3QU5A 1OHHA 1A71A 5DI3B 3F74A 4L22A 1PR2A 2FW7A 1NNLA 2FFHA 3V4PB 3V32A 4Y1RB 1AF4A 4IIVA 1V2HE 3T5TA 2I55A 2AB0A 3TX2A 4DM3A 3CCFA 3WKEA 4AO6A 1AVTA 2IUFA 3HGTA 4HJXA 4EVIA 1RMYA 3AERB 1M6WA 3OCZA 5BMVB 4AYXA 1JLRA 4TKVB 4JMPA 4Q9IA 4EX7A 1GTSA 2IELA 2Z8ZA 4EYEA 4TX1A 3LVFO 2XKJE 4FOTA 4RGYA 4XJVA 3IDSA 1CS0A 2UZ1A 3B5EA 2YZMA 4L95C 5CYPA 5E6RB 1XMOB 2GEFA 1IEXA 1BG6A 4MR7B 4P83A 4WINA 2G1PA 4LN1A 4J6FA 5K2OA 1G3MA 1DLJA 3EOAI 1KZ6A 1VIVA 4E2ZA 3OM8A 3U4IA 4JLSA 4N76A 3TQRA 4HXFB 3D3JA 3T5GA 4KODA 3B38A 4BQFA 4MINA 3JQ6A 4BV8A 4AX4A 5HTKA 3DM5A 1V3VA 4KBFA 1N5LA 3RC9A 5C5CA 4I2NA 5DTMA 4US2R 4JC4A 4URWR 3G2KA 3BB4A 4HCJA 5AR1A 4FONA 4RAOA 1KOFA 3HO8A 1E5QA 3HTXA 4LVUA 1R18A 2MHCA 4DFDA 1OFUX 2B7CA 2W8BB 4H0FA 4KRYA 1VIDA 4F4DA 4ZI7F 4EEXA 4B6EA 4X85A 3NLLA 1CUVA 3SIWA 3PNVA 1G9TA 1WXIA 2QN7A 4EATA 4PO9A 3R1IA 4BVJA 3GJQA 1NM5C 2Q2WA 2ZIFA 3GN2A 3JQCA 3P4YA 2NU6A 4P86A 3ECCA 4Y1FA 4B2LA 2B2CA 4P82A 3SM3A 4MV8A 1W34A 4N3BA 2FXVA 1WPRA 3MCZA 5TT0A 2K7FA 1U6KA 4OJKA 5CA1A 3QXSA 2J0VA 1JSLA 2XR1A 3I62A 3L5KA 1UKEA 1E59A 1II8B 2DFVA 3BILA 1JIVA 3IELA 3NC4A 1G6OA 1JGTA 4H4EA 3T8YA 4CR6A 3R8FA 3W77A 3DE0X 1EE2A 1N2JA 3DL4A 3ZCUA 5B3JC 2YV5A 1MORA 1SVSA 1NGSA 1MPXA 1S89A 1XE3A 3FVRA 3HCRA 2DRIA 2XUIA 3OESA 4YYZA 5AW8A 2PGAA 3NT2A 3KVYA 1E9AA 1NL3A 3U7JA 3UT6A 1XHLA 3A9CA 4I9UA 5FPKA 2AVDA 3AL2A 1ECLA 3U5ZB 2ODEA 4PO3X 3BJMA 4OL9A 3E82A 3TNJA 1Z39A 4FIDA 4UKDA 4KR7A 2P27A 2HDNB 4GICA 5FULA 3T9BA 3AKZA 3AQIA 4F5DA 3B7WA 2HHJA 3GDGA 4H6PA 5F7ZA 4BATA 2OY0A 2BM9A 1WPGA 4AP5A 4CUJA 5KQPA 2VTBA 2VDNB 2XZTA 3O2SB 3WVNA 5JVDA 3LHDA 1KAEA 3HDQA 3JYPA 3Q3IA 3V8RA 3LX6A 2J7PA 1PJTA 1TLTA 3AB7A 4KMSA 4LC1A 2H06A 1KQGA 3RM3A 4G0VA 3RIYA 4CLEA 3R2JA 4HK4A 2ODAA 2H48A 3EA4A 3KPYA 2ZYAA 4C07A 1JUDA 3M4XA 3EVCA 1V4VA 5D5PA 3NTLA 2OQVA 2NUAA 4MDHA 1VXOA 5I7EA 1PJSA 3E3NA 2JDIA 3GOQA 1IK6A 1C4XA 2Q6LA 4LXYA 1VL8A 1WQ3A 3V8MA 5LDGA 1LDYA 2NO0A 4YJHA 1L8LA 4IWYA 4X94A 3Q87B 2PGJA 5E4FA 1BS1A 1WP4A 4ADSG 1ZIXA 3PGKA 1ZH8A 1DGQA 4YWHA 1BVUA 4PRLA 4AO8A 1U3DA 4A9AA 4D26A 2JCVA 1ZRNA 1XEAA 1V71A 3G17A 3KQTA 1G17A 3NIGB 3FPHA 1IUNA 3UJCA 1NJ6A 3BGOS 5FNZA 3TUIC 1DNPA 1DAIA 4WD3A 2WG0A 5TSDA 1R8QA 3FETA 4LJAA 4B3BA 5KIAA 2QVGA 3W5SA 3MTQA 4DDHA 2ZWVA 2ZULA 4EG4A 3ZWKA 4TT3A 5FH9A 2IPLA 4XKJA 1GQSA 1CJVC 3MC1A 1XTKA 4OLHA 4WLUA 5B6JA 2VRBA 1C9YA 2XCUA 3KK0A 2Y93A 4AL4A 3H7IA 5GOTA 2BFDA 3PL1A 5JDCA 4PLTA 1W0JA 2QHXA 3HJFA 4JFRA 3EZ7A 5B2ZA 4IJ6A 4CYMA 5I7VA 4XGIA 3ROFA 3IV7A 1DKUA 4PHCA 3ZK7A 3WWEA 5C8YF 2PIAA 4P4LA 3D7MA 1V47A 3HXOA 2GYYA 4MO2A 1TDJA 5LP6C 5C32A 2ERXA 2QJRA 2ONCA 4D44A 2GERA 3HB5X 3H83A 3RIXA 3ZUGA 2MYUA 3ILSA 4BS9A 3RFFA 1WG8A 3NDIA 3PD7A 2AYZA 3HXLA 2GDZA 4AMVA 1J9GA 4YJKA 1YR9A 2J7KA 1UDCA 3BH6A 3I58A 4J0GA 2JHCA 3SQXA 1IJKA 3IYLW 2G08A 5AJTA 1Z73A 4KMRA 2AMVA 2E55A 1PL0A 4UDXX 2YY5A 3USZA 3OWOA 3G0IA 3D6FA 4FDVA 5LP6F 3HL0A 3PRHA 1RCFA 2EFYA 4RTMA 4BBAA 3D2BA 3WWYA 3AUYA 3F7MA 1DJQA 2Y71A 2YWJA 2GF2A 3JWGA 1NLZA 1VJDA 4Y2GA 5LQAA 4X41A 1NPDA 1R4MA 1UL1X 2VLBA 4WW0A 5EQFA 5FBVB 2IC5A 3E35A 1AV7A 5BN4B 1QV9A 1HXHA 2X22A 1Q3TA 1Q3KA 1BHQ1 2WIKA 1CHNA 3H1AA 3PDUA 1R74A 4ENRA 5IFKA 4BRUA 1NRWA 3JAMA 3KJZA 4DUZB 3DFIA 3N2ZB 3BFJA 3M83A 4ZOEA 4JVLA 4ASUD 4I5GA 2NT4A 5B6IA 1PR1A 3EDYA 3DE4X 5DE3A 4YREA 5DBIA 4Z4FA 4FSXA 4NOKA 2HU8A 2JFNA 4HUJA 3TCNA 1T9ZA 3K9NA 2Y0EA 3SBDA 3BX1A 1EG2A 1MG5A 2DJIA 2HF7A 2YJ3A 1B8NA 1K88A 1Q1BA 1W88A 4TVBA 4LRTB 1CJBA 1W44A 3LP8A 2V96A 1UPFA 4TV8F 5F23A 1QIFA 4ENPA 1GPNA 4IO1A 1OGIA 2Y0CA 4Y6LA 3ZWMA 5CD9A 3AEQA 3OQVA 3RFVA 2ZSIA 3CJTA 1QQ7A 2E37A 2AKYA 3QXXA 4A16A 4HQOA 2FE4A 4C4YA 3QY0A 3EVZA 1B1AA 1QONA 4XFDA 3QWBA 5U4QA 4HADA 2R6DA 4TSRA 1VL5A 3OZWA 1C1XB 2Z1NA 3OZGA 1KRWA 3H4TA 3LCVB 3WGUA 1H3FA 1KR2A 1VGVA 2WUVA 1XELA 4QBGB 3BWXA 5G3YA 1DU4A 3PIIA 1GU7A 3OZBA 4QFDA 1VLQA 1WSBA 2XA9A 4LCEA 4BMPB 5JS6A 4RLQA 4PTLA 4F6RB 3L93A 3MWDA 5KNCH 4ZKEA 3S55A 2ZIXA 1CQXA 4BUZA 4QJBA 2ZJ3A 5GINE 3H5IA 3UUGA 1EVYA 4G0XA 4KE8A 1ZEMA 3UFXB 4OF4A 3T61A 1EUYA 1UAAA 1T8YA 3A3KA 1V26A 1P5FA 5JJBA 3LHSA 1SUDA 4BC0A 1N8SA 3NJRA 5CYOA 2GM4A 1XU7A 5LBUA 2C2YA 3H97A 2FGJA 3R75A 1OV6A 1DAGA 2DFNA 5SZIA 3TH5A 4MR9B 1APBA 3V1KA 2WT4A 2NZYA 1GYRA 1A8PA 2X6TA 3BE5A 5LUAA 3H6HA 5FCDA 2YW9A 1YB5A 3KLOA 4Y2HA 3K0AB 3LPDA 3WIBA 3WK6A 1Z5GA 3GQBB 2Q3JA 3MWFA 2FEAA 4LF8B 2I8LA 3T7TA 2I78A 3ROKA 1X1TA 1Z33A 1HI9A 1RPAA 2CXQA 3WLLA 3BTSA 4WQMA 2R7KA 2X8JA 4QAQA 2X0EA 4B6GA 4XW2A 2OZKA 5T6MA 2PUCA 5A02A 1TZCA 3QJYA 1Z8NA 1M2JA 3A6JA 3HWSA 5K3SA 3UOWA 2I3BA 3JYHA 4IJUA 4PYJA 2CL0X 4LYYA 1NM5A 1W29A 2C61A 2NSJA 1Y82A 4NV3A 4PZ9A 4IIGA 1NBWB 1H5NA 4BBPA 1VHLA 2ANCA 4MWGA 4M83A 1YRQA 1OXTA 3BHNA 4I6JA 1O95C 5JXIA 1W76A 4UVHA 3TO5A 2GO7A 3A04A 4KDCA 1U7HA 2X0DA 1AKVA 2FN9A 1N5OX 4YRRA 4BN4A 1A5AB 1QQ5A 2CXXA 1GFSA 3EQ9A 4BDTA 4CT4B 4MKGA 4RPCA 1HDYA 5JAHA 3COYA 4BKPA 1JMVA 1L1EA 4YMHA 3HBFA 5JYEA 3FTPA 1LBHA 2SBTA 3PA6A 3RDPA 1R4AA 3DMHA 3S2YA 4A0GA 3JRNA 2H8KA 1DEHA 2AWNA 3NKFA 5DHFA 2EFDB 4JSYA 4F3CA 2JLRA 5EVJA 2O8NA 1D9XA 3CRZA 5DW0A 2R6HA 1JEDA 1QK4A 4GC5A 1Q95A 3I04M 2G70A 1P9LA 3JYOA 3RS5A 4CKBA 1Z29A 4BLWA 5GONA 2EV9A 1HLFA 4TVOA 3ZYCA 3EK2A 4QRHA 4HH0A 5DN6A 1ISRA 1T3ZA 5C7YA 3COZA 4BKUA 1NN3A 1JQLB 4XB1A 1HZZC 3GCXA 3E9CA 2RK6A 3KFLA 5BN5B 3RR2A 4HBZA 4H3HB 5JV5A 1NVDA 3FKSA 4PF1A 5F3DA 5E6SA 1SKMA 3VC3A 3WQRA 4FIZA 3ZHQA 2MT9A 3WLAA 2BUBA 1X92A 3KBBA 3LW7A 3NRCA 1E3WB 4H08A 1C50A 4RQAA 1IUOA 3U81A 3WQBA 2BGTA 3INTA 1TU3A 3VTZA 3PFBA 4BNTA 3ISJA 4WACA 1A77A 2J3IA 3BXPA 2A4MA 4AWBA 5F5XA 1ATZA 3N75A 2Z83A 1YZQA 4LJ5A 4IHJA 2HLPA 1F8XA 5DHAA 5FR2A 1GFIA 5A6SA 1FUKA 2AG1A 1QGDA 2ZSKA 1B23P 1U9YA 1G8AA 1ZR2A 1YL5A 2ZUDA 2QT0A 4P32A 1VHWA 4U6QA 3BTUA 1RI2A 4YAJA 1P75A 2ZTSA 4UASA 3A11A 3LNTA 2O8CA 2COUA 5HJEA 2QEQA 4PX9A 5IAGA 1IZYA 1AB5A 1NOIA 2PTHA 5A71A 4CV1A 1GPBA 4LNUB 5A1TA 5K0EA 1H8ED 1U04A 2GN4A 4TYYA 2Q9AA 4L28A 3TXXA 4Q3CA 4GZ6A 2A2ZA 2YCLA 4PG8A 3MWEB 1P1KA 5ITVA 4RQTA 5JCOC 1HC7A 1VI5A 3KE8A 4GT1A 1Y3IA 2H11A 1GNVA 2VP0A 3TDKA 1RQNA 4D46A 5KOYA 3KALA 1HSOA 3CEJA 4LJ9A 1UEXC 2H4YA 5DX0A 3RK4A 4TTQA 1FYEA 1Y37A 1YCFA 4NE7A 4V1CI 3T12A 1AV6A 2PZLA 4BUCA 1JQJC 2O3JA 3MJTA 2Z5LA 4KN9S 4A92A 2VXYA 2JFQA 1QBGA 4BASA 4P7JA 3L7AA 4JS0A 4O2AA 1PSDA 1EBFA 5ALNA 5H70A 3OLZA 1F8UA 3O5AA 1GNTA 1TVEA 1Z68A 1N2XA 2BISA 3FWYA 5CJ2A 1ZH2A 5ER9A 4AVYA 2VDOB 4X6XA 1OX6A 1X2EA 3IBGA 1RABA 1Z22A 2DR0A 3O82A 4IDOA 4ID9A 2Q7OE 1F6WA 4FYJA 4QDOA 4CU2A 2FSPA 1D04A 1U5BA 3FB4A 3I6IA 3JQPA 1KJYA 3N6RA 1QYRA 3GELA 4RTOA 1TPYA 2ZJ1A 3OBBA 4OBEA 2R751 2ZUEA 1CXZA 4GECA 5HZGA 2I2XB 1ZU4A 3LI2A 2V5VA 1ZVVA 2QN2A 3K9WA 4J7CA 3WNBA 1MO5A 4L6IA 2PUWA 4UJ5A 2JFFA 4L3VA 1ZD4A 1NVFA 2EVWX 5T4BA 1AZSC 3GAAA 3NJ4A 1T6YA 4R0VA 2B37A 3KB2A 1ESEA 2A5LA 2OXRA 1W5AA 2Q0XA 3EY4A 5GVSA 4TKMA 3NMUF 2MJLA 1SKAA 2UV8A 2FZ5A 2WJ4A 3G02A 1DKPA 1KGSA 3FZQA 5G0UA 1IBRA 5JO9A 3COVA 1R0SA 1K4KA 4PLCA 5KTRA 3TINA 2GNAA 5A4MS 1PV1A 2I4RA 3NS7A 1KO1A 3HCFA 4MVJG 5HIJA 3UG6A 4TMXA 3ZWWA 4YLYA 3RUHA 1SXIA 5DH9A 1J49A 1PWHA 3TJRA 2UAGA 2ZYVX 5J63A 3E7PA 1ZMRA 4Q47A 3QBJA 3I83A 5LWHA 3VAAA 1W25A 5GIOE 5T5QA 4DV7B 4AUMA 3GLTA 4CMBA 4FMBB 2VH5R 4OHFA 2CEKA 2BL4A 5T57A 1P80A 5GZ6A 5ALOA 3N6VA 4F3NA 2VAVA 1NN5A 3G2QA 3KYBA 3GJ0A 3QU9A 3GLIE 4E09A 4PSUA 2QIPA 1PK8A 3I9NA 3TEMA 3CGWA 3Q6IA 1SZDA 5K45A 3ZN2A 2BYTA 4JH0A 3IBFA 3V4SA 4J0EA 4QQKA 2B3DA 4AK9A 5AO9A 4BMSA 4X8OA 5JAMA 2H4XA 3AOEC 4QWWA 2QYHA 2E0IA 1ZSYA 5CM8B 3AM4A 2NACA 1C7IA 2OCIA 3VHXB 2J0QA 1XZLA 1GUBA 5ELMA 3VO9A 2OILA 4X1YB 3TXAA 2QPAA 1Z2PX 4Z9FA 2SECE 3K9GA 5KNDD 2WAMA 3QPVA 4XB6B 1AKEA 3GPBA 1E92A 1T3TA 2ZZMA 3SFVA 5DNEA 2JFVA 4RADA 4OHOA 1UZUA 1A4RA 2GPAA 4RA6B 3V8BA 4Q39A 5A9SA 3T3DA 3MZ0A 2PH7A 1AOXA 4X60A 1PW5A 3GEIA 5IJAA 4GP7A 2HM7A 3LIIA 3RSHA 4YDSA 4C5AA 1ADBA 2AT1A 4UFOA 3L7JA 5BR8B 4J91A 2WWVD 1JZQA 4Z4QA 1WY5A 3VR4H 3ZHYA 3UMSA 2CT8A 1ZW6A 3R9WA 1SG9A 3QWAA 2JD1A 2DF8A 2CMFA 4W1SA 1W36B 4LJ4A 4EKYA 3I12A 2VYVD 1EUDB 5EE9A 3WYGA 1P77A 1FFAA 3L1HA 1EXMA 3MWYW 5CVTA 1M6NA 1SCQA 1NN1A 5JU6A 3KHUA 4EI2A 4GVPA 1FYXA 1L5FA 1E58A 2XTAA 1E0AA 2EP7A 1HT0A 2GPYA 3ICVA 5FA6A 1BGWA 3GEMA 3QIAA 2V6BA 1OYOA 5FORA 5DIFA 5BVHA 1G5QA 2K4MA 3AB3A 2ETVA 1OB5A 5BQ5A 1Y1LA 3EWNA 3KQPA 2WKSA 2W43A 3NV7A 2XE6A 3DAOA 1H3NA 1F3LA 2H9YA 3W04A 2OKCA 1DJLA 1ML3A 4N5LA 4BU1A 1UZLA 2GBIA 3PRJA 3VNQA 4P5DA 1E1QD 1NVKA 4WZAA 4IX9A 2J85A 2PPVA 2VJNA 2ZOSA 3UMBA 2NQ8A 2OORA 1HYHA 1DXHA 3ETLA 2IXEA 1CP3A 4WH0A 3TSYA 3H17A 4CHGA 1HH4A 2WNIA 2WQ7A 3ZX5A 2DHRA 3CN9A 5J3JA 3IHKA 3Q7TA 1QS0B 4IIDA 4WCFB 4O2RA 5EKSA 3W5DA 3G59A 2RG1A 5GV7A 3FH0A 3M6WA 1B2RA 1W46A 4IUDS 2GKSA 4RH1A 5G1PA 4KJZA 2QZ4A 4QZVA 1JIJA 4UM9D 1CUGA 3W5IA 2HAEA 3K6SB 2QLNA 2ZUTA 1G5RA 4MQBA 1DELA 1MR3F 2FK8A 3U31A 1A9XA 1TX4B 4UVGA 1N0WA 3B6ZA 3CN7A 4H1WA 2C8LA 3K8QA 2O14A 2VNHA 1S96A 1M66A 1ZKMA 4C3UA 5KCZA 4GI1A 3IMCA 1DTWA 3FLMA 4RVUA 2WFZA 3BD9A 4P93A 1VCNA 3HYTA 2V7TA 1HO3A 4GBGA 5KCMA 4US1R 3DHYA 3HCPA 1Z25A 4LE2A 4NJMB 1YVPA 4TWZA 3RRFA 1SXJE 2IYVA 3GGCA 4JOBA 3TBKA 3IPYA 5I7UA 1RYDA 4Y3UA 1GQOA 3H8JA 4NMMA 1QRDA 3NC0C 1F2TB 2VHYA 1U7ZA 1EFPB 4FFLA 4Y0VA 1FTQA 3DVAA 3P9CA 3WRXC 4ZMSA 3ZJUA 5H7XA 1FYDA 4OHUA 3HM9A 1RMQA 3IE1A 2Z30A 3BUSA 1A2OA 2I4LA 2VJOA 2XUKA 4YJFB 4RQUA 3VPXA 3GG9A 2CJWB 3L49A 4DLXA 4IUCS 1VIMA 3RS8A 1YMVA 2DBYA 4IV8A 2QLLA 3C7DB 2HQOA 3PKJA 4CZ2A 2YHSA 4YCBA 3QX8A 4ZHQB 4D7AA 3G1WA 3BORA 1ODCA 1AQNA 3KUXA 3M82A 2HRBA 1ISFA 4TL8A 2VJAA 3SIXA 1EHIA 3WLNA 4CKYA 1PWZA 5JNTA 3QTTA 5HF5A 2SCUA 1BRTA 3K9LA 2CMDA 4MPJA 5AD1A 4L72A 1V5FA 4UEKA 5BWBA 4MUEA 3T3NA 5K2MA 2ZR8A 3IQDB 1DQNA 4Y9SA 1FS6A 2WFLB 3FGPA 3O38A 3L7CA 5DGDA 2LXNA 2E4XA 4D6PA 2FDCA 1VE3A 1XOIA 1TW2A 4WCDA 4F4IA 2R8XA 3MOGA 4YP9A 1C2TA 1GTG1 3MUEA 4LY9A 4RXTA 5LQSA 4A5SA 2JJ1A 2QNIA 3DH0A 1KAOA 2JCGA 3FWHA 4I66A 2W2NA 5IHXA 2P5UA 5HJ2A 1UJ6A 5JZOA 1I10A 1DPGA 3KQMA 4QL3A 4MP8A 1KMIY 2WWRA 4ZDKA 3FOZA 3QKSB 1WXDA 3ZWVA 5L3SB 4K9PA 4AN4A 4ZIRB 3C3WA 2FPRA 2WJWA 3C15C 4QPZA 1UKAA 1JVSA 1XZ8A 5KYGA 2BFCB 3IL2A 2CNKA 2GEDA 5TMDA 1F4VA 4YPOA 1T4GA 2ZJ8A 3K35A 4FE4A 3DV9A 3H2HA 2RBEA 1GADO 3UB2A 4Q3DA 3RG2A 4JJAA 5IBPA 3SSAA 2QR3A 1Q1EA 2QR2A 3SNHA 4OJTA 1SCJA 1WTCA 2V4ZA 2AOTA 3LTNC 4JBLA 4WXEA 4NDZA 2OSBA 5IH7A 1P6UA 3BICA 1AHIA 2GESA 2D13A 3RGGA 1WPXA 2IUSA 2QRGA 3G0BA 1NJ2A 3D8SA 4QHSA 4JJGA 2PX6A 3DPIA 2Q2VA 4HEA1 1GCOA 1TB4A 3U1TA 4U2DA 4U2BA 3VPGA 1ISGA 4N1AA 3C6MA 5JRJA 1EFVB 3MBKA 3I5UA 1OA0A 1SGWA 1C9MA 4N47A 3GNQA 5C9ZA 1GSHA 4CMGA 3RANA 1EM8A 1ENZA 2FLKA 2XE7A 4BKQA 4EVSA 1FK8A 1C7QA 3L4JA 4ITVA 3V8EA 3JVIA 4Z54A 1NURA 1VLLA 3BFVA 3ZTWA 4YHBA 2IHNA 3E23A 1KHHA 2C8VA 3LM8A 2OQRA 3I9V1 4JUCA 3JD0A 3PKIA 4M36A 4PGHA 3A6GA 1KFCB 3P9QA 4D5EA 1ESNA 5JMOA 2GRJA 4YV0A 2PX8A 2P35A 3ESQA 1N3YA 2QVXX 3HEBA 3I72A 3H4MA 4GXRA 4DJ5X 5I4CA 4ARIA 3CUVA 2GYWA 4ERNA 4FR5A 1QVVA 1Z4MA 1D2NA 3ICQB 1YR7A 2AJCA 5J23A 2V9CA 2AXEA 1LTKA 2OGUA 3N2LA 3IJ5A 3QUCA 4R2HA 5ALKA 3ZI4A 2Y27A 1HOTA 1T2EA 1GRNA 3O4GA 3LK7A 2DHDA 1QPZA 4QO8A 4K9NA 3SJAA 3C4QA 4AZ3B 4PVCA 4IS3A 4ND7A 3DDHA 4KGDA 5LD2B 2RHBA 4E22A 2FN8A 2FR8C 5AUNB 4Y2QA 2Y68A 1XDGA 2FSGA 3L0CA 1HTBA 5JSKA 5CA1F 1XNHA 3E8SA 2EATA 4IRXA 1I4EB 5IAEA 3OPMA 2XE4A 1RWKA 4BP3A 2B4YA 5CJJA 3FSGA 5LZ7A 1SVKA 5IAAA 5IWAB 3MCVA 3OIWA 3H9UA 4RMIA 1SBTA 2EJUA 2HD4A 3M1IA 3QHPA 3FVQA 2AW5A 1Q7GA 4OHXA 4Q05A 4JJFA 2JFPA 1NATA 2EHJA 2XYQA 3VPSA 1V8ZA 1A4UA 5THQA 1T1RA 3HO6A 4R7TA 1Q84A 5JNUA 5JSZA 4PONA 3P2JA 2V3CC 2AX3A 4PFJA 4WZAE 3UAXA 2FMKA 3VSAA 4GKBA 1PJRA 1J24A 3KJNA 5HF9A 3T7DA 1ZD3A 2Z5FA 3PHBE 5DN6D 2EARA 2YHIB 5DX1A 4CM4A 4UMVA 2AMLA 3CNBA 1KZYC 2XWBF 4LXQA 2W5UA 3ZWCA 1PZMA 4F8JA 3PNOA 1U7TA 3WLHA 2R1VA 1CB7A 2OBFA 1KI4A 3EXIA 4FZ3A 4FFBA 4YP1A 1I30A 1DC5A 2Q5QA 3PVZA 4DPLA 5REQB 3OLQA 3JWEA 4J0HA 3LLCA 4MW7A 4XZ3A 2DH6A 4R84A 3TZ6A 5EXTA 2LWIA 1QJCA 5EWMB 1XMIA 2F9LA 4J16A 4LQ4A 1O57A 3THWB 4QREA 1JFFB 1BVRA 2BJVA 1J8DA 1GOTA 1K6EA 3AETA 2G9NA 4EJSC 5KHLB 4QVIA 4MTCA 4V1CA 1ZHFA 3V4OA 5EJ8A 4M9QA 1K8XB 3VUEA 1U2RA 4N01A 2ZT6A 2PYDA 1I1HA 3EXG1 1R88A 2HO4A 3NBKA 3PXDA 3K8OE 1XDBA 4CCWA 1LEHA 1XWWA 3PWTA 4N5NA 4NPHA 3WA7A 3GVHA 2ZBGA 4CNQA 2JIZD 4DXHA 1EUQA 2O5VA 4JT8A 4MWBA 3UMYA 2HJHA 1B26A 3SEFA 4BQIA 2GLTA 2YN4A 1E9BA 4J2OA 4EBBA 5EHGA 4GHWA 1SOUA 5FJJA 1PFUA 2BKUA 3GLUA 3M3HA 1TAHA 2GEUA 2YL2A 2ZI5A 3RSSA 2ZSFA 1AXRA 1HNXB 3QVLA 1PN3A 2V6IA 4B79A