3CZRA

Crystal structure of human 11-beta-hydroxysteroid dehydrogenase (hsd1) in complex with arylsulfonylpiperazine inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
266
structure length
265
Chain Sequence
QQPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Discovery and Initial SAR of Arylsulfonylpiperazine Inhibitors of 11beta-Hydroxysteroid Dehydrogenase Type 1 (11beta-HSD1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 100
structure length 265
sequence length 266
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3czrA00
4GI2A 2QG4A 3D64A 2ZKLA 2I3AA 1E7MA 1KIFA 4JCOA 1XYGA 3D7LA 3WQQA 1U4OA 1DIRA 2X6TA 2E49A 4KP7A 1V3VA 5GZ3A 1JA9A 5TSDA 3ZWXA 1H0KA 2JAHA 2RHCA 1N5DA 3RFTA 4UVGA 2X22A 4W99A 3VZRA 1ENOA 2BD0A 3MJCA 2VYVD 3MEQA 4BV8A 2NU9A 3WX0A 1X7DA 4IGEA 1KS9A 4NZ9A 1WVGA 1A9ZA 1U3WA 4YACA 2NTVA 4GL4A 4Q3EA 4XEHA 4HBGA 4Y8VA 3PQDA 1BVUA 1NPDA 1HDRA 2FR8A 3BMQB 4K28A 3TZCA 5CAEA 3QVWA 3ZN2A 4BO3A 4J9UE 1VSUA 4WCFA 5EMHA 4NJOA 3TDKA 1ONPA 5JO0A 2GUGA 3P7MA 2ZTMA 4RF3A 3H7AA 1XA0A 1ZEJA 4CMJA 1PZHA 4TRNA 3PTZA 5ER6A 1LTHR 1E1LA 2G1UA 2PKRA 1GQ2A 1JTVA 2ZB8A 3OJ0A 2GZ1A 1DDOA 2FR0A 3KSDO 4CL8A 3ZV6A 4XR9A 3WGIA 3W8DA 4NBWA 1JKJA 1UDAA 2IXBA 4FJ1A 3PHIA 4ND4A 2AXQA 4D3FA 4DPMA 4TROA 4GPD1 1ZK4A 1E5LA 3NJ4A 1VE9A 1N7HA 5KJEA 3AU9A 2PTGA 3UKOA 2P4QA 3ZHXA 4P22A 1WZIA 3AOEA 1JKFA 4HNGA 3AY3A 4OHUA 3DZBA 1C1DB 4KOAA 1H6BA 3DBRB 1E7RA 3L4SO 4IDAA 3JQGB 5JYDA 5TJHA 1LI4A 2D5CA 1GYQA 4RQTA 4E3ZA 2EP5A 4CUKA 1ZMTA 4WCDA 1UXGA 1X1EA 1PS8A 4TQGA 2Q3EA 1D1TA 1H6DA 1GEGA 2Z95A 4E12A 1BW9A 1CIVA 5DBFA 3EC7A 1G6KA 1GUYA 5HRUA 3OFSA 4XJTA 2Y1CA 5C7IO 1GL3A 4HFNA 2NNLD 3PI7A 4IY1A 1XU9A 3C24A 3RUEA 4ZQFA 3WSVA 4HWKA 1DIBA 2F1KA 1LXCA 1LC3A 3N74A 1XLTA 4XQEA 1DO8A 2I65A 5EL0A 2P9EA 1WDLA 1ZJYA 2DUUA 3L07A 5BR7A 1ZEMA 3B1KA 4XYMA 2CVOA 3G1UA 3QWFA 3S8MA 2ZQYA 3EMKA 2J5RA 4O5OA 4WK6A 1YE3A 3U4DA 1WLYA 5B37A 3GNSA 1H2BA 4WGGA 3ZHBA 4NMHA 4AJNA 2BFPA 3WSWA 1EDOA 2ZYDA 4XA8A 3FR7A 2Y68A 1DIAA 5DCYA 5I7VA 5JC1A 5KKAA 2NACA 1P1KA 1CQJA 2OP1A 3DFZA 5JY1A 3JYPA 1KYQA 1PJCA 4TVOA 4E13A 4ND3A 3I1JA 2IODA 3K6JA 1P44A 4ZRMA 4Q3CA 1NQAO 3PQFA 2CZCA 4DRYA 1PGJA 3H2SA 4I5DA 4PG6A 1ULSA 1Y9AA 5IN5A 3KLPX 1T2AA 3LDHA 1JWAB 4INAA 1BTOA 4JQCA 4O63O 3WMWA 3JTMA 3DO5A 3G1TA 3JQGA 1K0UA 4LGVA 2ZB3A 2JKVA 2DTXA 1YL5A 2YDYA 2NSDA 1ZSVA 3JD4A 3GPIA 1E7YA 4DYVA 2C2YA 2ZTVA 1AE1A 4BO9A 1VC2A 4CM7A 1KVRA 3QW2A 2P5UA 3D4OA 4GX0A 2ZJ0A 4IJUA 2O7QA 3G3EA 5AXCA 5L4NA 1JU9A 2JD1A 2HCTA 4IS2A 4GX5A 4E2YA 1U2GA 1ZK2A 5KJFA 4WLUA 1HXHA 3KSZO 3NUGA 3ZV3A 1EBFA 4D7AA 4CM4A 5BSEA 1XEAA 3ABIA 4ESOA 3EVTA 1PL7A 1HLDA 5BSFA 1V3TA 1HDYA 2W90A 4E33A 2Y1DA 2FPGA 4RQUA 4J2HA 2OXIA 5T8KC 3OMLA 3R3SA 5DOZA 2V6GA 1H94A 2J3IA 3NDJA 4BNVA 3EZLA 5DDIP 3CEAA 5T8KA 5EINA 1RM5A 1C14A 4U6SA 1BG6A 3IUPA 1N7GA 2E48A 2NM0A 2V7PA 2QIOA 4A73A 4CMIB 1L1FA 4R1NA 4FGSA 4EUHA 4RVSA 5THQA 3L6EA 4XYEA 4DQVA 1PS0A 4R1UA 4OH1A 4CV2A 2WD7B 4J4HA 1MC4A 4BNWA 4O1MA 2EJVA 1U8FO 3ADOA 3ZNOA 3JQBA 3KBOA 1J6UA 1B3BA 4BKOA 1RM4A 1ENYA 3KSUA 5FFFA 3UCXA 4KTVE 5COAA 3WR5A 4YB8A 4F6CA 5H82A 2GD1O 4GWGA 4CQLA 2X5OA 5ADHA 3I6IA 4GGOA 3GGPA 3GHYA 1WMAA 1YB5A 3CSDA 4B7CA 1E3LA 3AM5A 5A03A 3AJRA 1I10A 3KZVA 1KEWA 4XQGA 4BNIA 1TT7A 2OO5A 3PLNA 5I7FA 1W4ZA 2IEBA 3DR3A 5JCJD 2Y67A 4JX8A 1ZXLA 1ADBA 1W8DA 1HZZA 1O8CA 3WLFA 1UDBA 2AEMA 4IBOA 4DQUA 3WTCA 4OQZA 5G4KB 3WNVA 3ZH2A 3RIHA 2WD8A 1E6UA 3D0OA 2NQ8A 2D3TA 4FR5A 5I8WA 5KTKA 3KXDA 1A4UA 2CD9A 5CG1A 3VZSA 1LLUA 3RVDA 2C54A 4NBUA 4YJHA 3O26A 5DNAA 3G17A 3DMTC 4FFLA 1NYTA 2PGLA 4BKQA 3QWHA 4ID9A 4IQ8A 4IQ0A 1Q7CA 5KVVA 4BNFA 3RC9A 5A5EA 4BGVA 1H9BA 3WGGA 3KOUA 3CE6A 1E0DA 4RPLA 1P31A 4Z9XA 2C2XA 2WMDA 2GF2A 2BLLA 3JQ7B 4FBGA 3H5NA 3F3SA 5TT1A 3OICA 4HFMA 4CQMA 4MP3A 1T1RA 3HFSA 4J49A 4J91A 5GZ1A 4TVBA 3HQ4O 4A10A 3PPIA 4E5MA 2O3UA 3UCEA 4A7PA 3RC2A 2JFFA 3U4IA 4MPDA 4YJFA 4NBVA 3P19A 1A4IA 2Q2QA 1WP4A 2AE2A 3GUCA 1VRWA 1ISJA 3BAZA 3P2OA 3INGA 4YT4A 4W82A 3Q3CA 1PJTA 5IZCA 1NFQA 1Z82A 4B7XA 3PHHA 2VZ0A 5ITWA 4XGIA 1NVMB 2Y0CA 3B1JA 4DREA 2JCVA 4OKNA 1X15A 4EI2A 1H2HA 1NVTA 4FIZA 2YFHA 4CJXA 2HAEA 1A5ZA 3JQCA 3IKTA 3UOGA 3F6YA 4OQYA 1T4DA 2J8ZA 2ZB4A 3C1TA 2Q4EA 3JV7A 3DQPA 2QQ5A 4G81A 3U5TA 3ZCXA 3TL3A 1JVBA 1ADCA 1A7AA 5A9TA 4YDRA 4UUNA 2XXJA 3LLVA 4EUFA 1Q2XA 2P9GA 1OMOA 4OXNA 4EEZA 3K31A 2IRWA 4A03A 1PGNA 1XG5A 3ETEA 4R69A 1MG5A 4BHTA 1P1RA 4CUZA 2PD3A 1RPNA 1YVEI 3F1LA 3WIEA 2G82A 3ONDA 2HK9A 4YAIA 2VUTA 3U3XA 4RF4A 1K3TA 1BDMA 1Z45A 1ZXBA 2AEJA 1QRRA 3NT4A 3PJEA 2CF6A 4RORA 2NU8A 3VZQA 1NR1A 5DOVA 4BMVA 4TKMA 4CR8A 1SMKA 2HQ1A 1NR7A 2YJZA 4E0BA 5AQ1A 3PFWO 1JDJA 3RBXA 3PDUA 2OUIA 3CTMA 4MINA 4BV9A 5JLAA 5IDWA 1JLLA 4KMSA 5F1OA 4Y6PA 2IZ0A 2EG9A 5ILOA 4RPJA 1QP8A 1QXSA 4JP3A 4YEDA 2GZ2A 3RFVA 4ONEA 3U09A 1VJTA 4ALNA 1GD1O 2VHVA 5IFLA 1C3VA 1PJLA 2C5AA 1GYRA 5JAZA 3ZDFA 5L9AA 4U0JA 4IM7A 1TT5B 4N5LA 3JQ9A 3NT5A 3DL2A 4FFRA 1MX3A 4Z0PA 3GVPA 5GZ6A 5COQA 1UXIA 1U9JA 2OORA 2NTNA 3BYZA 4MVJM 5T5QA 2ILTA 4Q39A 5T67A 1Z73A 3EZYA 4MKZA 3H9QA 3U0BA 3LT2A 3DBHB 2HRBA 2XAAA 4EJ6A 4BOYA 3TOXA 4MJLA 3SXPA 1PS9A 3JSAA 4CLHA 4D0RA 1I01A 1YL7A 1Y8RA 2ET6A 4KQWA 2VHWA 4I5FA 4KUEA 2EKPA 1JAXA 1DXYA 1KERA 2X9NA 3RFXA 4EJMA 2VRCD 1UDCA 5IZ4A 5L7YA 1LX6A 1DHTA 4RVDA 4ALMA 3CUKA 5F1KA 3GAZA 2CFCA 4Y6SA 2NU6A 3DMYA 5ILGA 4HP8A 5FWNA 4F45A 2J3KA 1P0CA 5A1TA 4ZQGA 1HE2A 3I6QA 4CMAA 1V35A 2AQIA 3H5AA 3PHJA 3Q2KA 5U4QA 1EUCA 5HS6A 3COSA 4D43A 3E9NA 4YJFB 1HEUA 3X2FA 2W2LD 1BXGA 1QYCA 3DDNA 3OQ6A 4OXKA 4RF2A 3WJ7A 3IIEA 4BNYA 1DRVA 4RL6A 3NV9A 2C5EA 2H1SA 3OQ1A 1Z75A 2BFAA 3KV3O 5KVQA 2PD6A 1H93A 2BGLA 4XIJA 3GRKA 4RZIA 1WAMA 4C7KA 1PTJA 2I66A 1C1DA 1CERA 4GKBA 1H6CA 3FD8A 3WGOA 2X5JO 4PZDA 1MA0A 5BSGA 3S55A 1FK8A 5TX7A 1ZBQA 6LDHA 2SCUA 3M2TA 3ZWYA 4IQGA 3OA0A 4ZA2A 2HDHA 4ZQEA 5B4VA 4CMEC 1DRWA 1Q1NA 3C8MA 3TPCA 2WM3A 1HDZA 2B4RO 1OOEA 4LVUA 5DBIA 4JBIA 4E4YA 1EVYA 2DTEA 1NNUA 2PZKA 1PGPA 2Y0DA 2VNAA 4II2A 5IDXA 3KM0A 1LEHA 1UZMA 3DXFA 2B37A 5FEUA 1IZ0A 5KVCA 1HLPA 4O6VA 4DGSA 4E2WA 4GAEA 3PWSA 3WICA 2H5LA 3HZZA 3B6ZA 1N1EA 3AY7A 2LDBA 1DIGA 2HJRA 3UUWA 2YFQA 3IP3A 3JD2A 4BB6A 4DC0A 4CLOB 4D42A 1ZW1A 2FY8A 1FDWA 4HXYA 4DA9A 2J6IA 3GMDA 4BO2A 1NASA 4CMBA 3SJ7A 4ZRNA 1GEEA 1PQWA 1ZH8A 4AG3A 1A27A 4WNCA 1DC6A 2DBZA 1E5QA 3W8EA 4HADA 1PQPA 4DYDA 4OJNA 3KTDA 4A27A 3WGTA 3ASVA 3KB6A 1FDSA 3DAFA 5KKCA 3IMFA 4BO7A 4XRGA 5LDGA 2VOEA 2EWMA 4YJHB 5JPIA 1Q0QA 4YA6A 3NYWA 3OETA 4FOOA 1KVUA 2YHIB 2ZQZA 3HE3A 4TRMA 1OI7A 1F0YA 1PR9A 1PSDA 1X0XA 3FTNA 4JN6B 2JHGA 4NBTA 4XGKA 3WTBA 5JW6A 3WMXA 1VKNA 1EEHA 1JAYA 2DKNA 3GK3A 3JQAB 1V0JA 4DBZA 2FSVA 3QJ5A 2FN7A 4R16A 4BO1A 3FWNA 1SOWA 3DBRA 2TMDA 1BSVA 3MCVA 1LDMA 2QRJA 4AJHA 1FXSA 2H63A 5AXAA 2OHXA 3GRPA 1GR0A 2GO1A 2UAGA 3QVOA 1HWYA 2JFGA 3B1FA 4BNGA 3F46A 3GOHA 3HG7A 2DFDA 4WLFA 3E9MA 3QE3A 1V3UA 1DRUA 3K92A 1LLCA 4WLEA 5COBA 3CIFA 4NNJA 2FP4A 3SJUA 3DMTA 3K8ZA 4BVAA 2HRZA 3PRJA 1AHIA 1Y9EA 3DZFA 3GEDA 1I0ZA 4CUJA 3VTFA 4I08A 1ZJZA 1B8VA 3SVTA 4UVEA 3QVSA 3HJAA 3Q11A 4HUJA 5U9CA 4ALLA 5KNLA 3UXYA 3RSHA 4OO3A 3KVOA 4CMIA 3D3EA 4EDFA 3FI9A 4WCFC 1U2DA 3I4CA 4XIYA 4J1SA 4E32A 3RASA 2WTBA 3D4PA 2GN9A 1I2CA 3F5SA 5B4TA 2B5WA 3A4VA 2Y1GA 1VI2A 3JQAA 5KIAA 3BMOA 2QW8A 3KUXA 3UCFA 2Y66A 3BMCA 3OH8A 3AI3A 4JGBA 4DLLA 1NFRA 1UZLA 3AW9A 2BGKA 4NDNE 4PIVA 3GGOA 1ZZEA 1D7OA 3KYDB 1KEVA 1SO8A 3H3JA 1Y8QA 3NDIA 4ILKA 4NG5A 4R9RA 4CM4B 5CEJA 3AOGA 2E4AA 3HB5X 1F17A 4YT2A 3RU7A 1QLJA 5L45A 4M86A 1I3LA 2BI8A 1GZ4A 2O7SA 2WE7A 2IDZA 3E9QA 2X0IA 3GG2A 3SBOA 5T64A 4QEDA 3BHJA 2DU8A 3FCOA 3SEFA 5MDHA 3ZV5A 1HETA 1UAYA 3I52A 3JQFC 3MJ4A 4RPHA 3ZWNA 5C37A 3ANLA 3VPXA 3JQ8B 3LF1A 1W0CA 1WMBA 4J43A 2ZIZA 4DIFA 4ZGWA 1E1NA 3LK7A 2FPPA 4YTEA 4CM1A 2A92A 5KJCA 1NQ5A 4IDGA 4XR4A 2QYTA 2HMWA 1Z74A 3PLRA 2ZCVA 3CMMA 4CL3A 3Q9NA 1KY5A 3FN4A 1ENZA 3Q6IA 4MDHA 4UULA 1SEVA 5L53A 3JQ6A 1MP0A 4HNHA 1U4SA 4PVCA 3QWAA 4PZEA 5TJ9A 1X14A 5EN4A 1FDTA 3TFQA 3K2BA 4W7HA 4Y6RA 4GGPA 2DPGA 3W4IA 1DPGA 3MWDB 4A2CA 2QHXA 3PGXA 4RCVA 3DBVO 4CLEA 1K6IA 4DLAA 2YUTA 3GMSA 4YJDA 1YB1A 3DB2A 4R9SA 1E7WA 1ONNA 3D3WB 4AVYA 1SPXA 1P9LA 2ZB7A 3FTPA 4MP6A 2EEZA 3T4EA 1EE2A 4FSHA 1LNQA 4Q3BA 3KO8A 4GKVA 4J1TA 5JSFA 3MOIA 3E82A 4LSMA 1PQUA 2X0RA 3I4FA 5THKA 1ADFA 1F8GA 1N1GA 1YB4A 4L76A 5TLSA 3FPCA 2ZK7A 2NV6A 3RWBA 1ZNQO 3ZU5A 4I5GA 2P68A 1T26A 2OMEA 1LSOA 1YOVA 2WE8A 3F5QA 3L9XA 1B3RA 2FR1A 3U9LA 5BQFA 5TGDA 1GV0A 2Q46A 3OIFA 3WDSA 5JAIA 3TN7A 3FNGA 1QKIA 1DFGA 2JCYA 3NGXA 2FSSA 4OXYA 4WPGA 4WLVA 4QO7A 3WWZA 4RPGA 2O3RA 4CODB 2OGUA 1XQ1A 1EZ4A 4FPXA 1GADO 4IMRA 2CNBA 3F4LA 1H9AA 1LRJA 4NBRA 4Y9DA 3WFIA 5BNTA 4UUPA 1R37A 1Y5MA 5KJ1A 1HTBA 1X1TA 4KWHA 4J2OA 3DTYA 4GVLA 4JP2A 3F1KA 1NHGA 3I9LA 4B4VA 1WWKA 2J3HA 3W8FA 4CMKA 2Y1FA 4CR7A 2CVQA 1K6JA 3NTOA 1PJQA 3WYEA 3FHLA 1M66A 1Q7GA 4BNXA 4OKIA 2AG8A 1XCBA 5K6AA 4RGBA 3RI3A 1IPFA 2EV9A 5K9ZA 2W98A 3PVZA 3QV1A 2H6EA 4IZHA 3W6UA 1DIHA 4RDIA 4OSPA 1YDWA 1X0VA 2EF1A 3OJEA 4S3MA 4PLHA 4XX0A 2CF5A 4BL5A 5L3ZA 1VKOA 4U6QA 1N92A 1Q7BA 9LDTA 1PJ2A 4O0LA 4H3VA 4LISA 4EITA 5EQFA 3IDSA 3NTQA 5AYVA 1PL8A 2EGHA 3H6KA 1EVIA 1RM3A 1WNTA 4I9UA 1FMCA 3PFFA 4I9NA 4EEXA 2R2GA 1FF9A 4AJ4A 3HDJA 3QA9A 5A4DA 2X5KO 3NX4A 3GVHA 3T7EA 1BW9B 1QMGA 3FNFA 3BMNA 4DBVO 3RD5A 1U28A 4R5HA 4M87A 3ROKA 4J1NA 3BHMA 4QT0A 4D41A 2VZ8A 2AEFA 1O9BA 3FF4A 3QQPA 4R5MA 4NK5A 2O48X 4FQ8A 2AG5A 4P8RA 5EERA 2Y05A 4KUGA 1LDBA 5DCWA 3Q0EA 1E77A 1QV6A 4XDYA 4N7RA 4MVJH 4R68A 3ZNPA 1P74A 4NFSA 2BKAA 2R6JA 2B0JA 3LC1O 3ZZNA 1MB4A 2Q2VA 1ZO8A 4RV9A 1PL6A 5DP1A 4EZBA 3HN7A 4QXMA 2Z1NA 2B83A 5KCZA 1FJHA 3JQ9C 2VWHA 3ZWCA 4BNKA 2DBRA 5CHEA 1Y6JA 4IDDA 2A9FA 4CLDA 2XXBA 3QSGA 1TB4A 2GR9A 2NVUA 3TZHA 4BNUA 4U0KA 3C85A 2P2SA 4CMHA 3AI2A 1BVRA 1MFPA 4BQPA 3GDFA 3OECA 3DZGA 4XGNA 1M6WA 3RUAA 5JDIC 2O3JA 1ENPA 4Y98A 5LCXA 2C82A 2YDXA 2QYSA 1NQOA 3JD1A 1RJWA 3TZKA 2NTJA 1AHHA 4EW6A 5EPOA 2EW2A 4K6CA 2VOJA 2NUAA 1I30A 3RUFA 1YDEA 5JS6A 4ZQHA 3GN2A 2EJWA 1LRLA 3E8XA 4R01A 1DLIA 3LVFO 4FC6A 4BGEA 1P45A 5G0VA 2OBYA 3UVEA 4PN3A 4DPKA 2WYVA 3DHEA 4BO5A 5KOIA 1V8BA 1K2WA 1YQDA 3BZUA 1QYVA 2C59A 1QG6A 2HJSA 3PIIA 4CM9D 1QYXA 2BF7A 1A7KA 2PV7A 2E6UX 1BXGB 3X2EA 1PEDA 1NFFA 2CDCA 4Z0HO 1CDOA 4PG4A 5AVOA 5TRTA 1P1JA 4D44A 3F4BA 1AUPA 2B69A 1GV1A 4N5NA 2ZTLA 4K26A 4I1IA 1PU2A 3TF5A 1N9GB 2VRBA 1MC5A 1YXMA 4RVUA 3I9KA 3VH1A 2X8LA 2G17A 1MXFA 1IB6A 1NX6A 1VSVA 3EAGA 4N54A 2EGGA 3GFBA 4BMNA 3UGKA 2DPHA 3KYCA 3PJGA 1U3TA 4MVJE 3INTA 3DHYA 1GAEO 2DUWA 4B79A 4IS3A 3OJFA 1LQUA 3ANNA 3TZ6A 4B4OA 1VL8A 4YRDA 5FI5A 3FBTA 3GEGA 1SEPA 1Z6ZA 3P5SA 5DF1A 4DXHA 3G0OA 5L7TA 4GMFA 1KY4A 3RC7A 1M76A 3E18A 1I33A 4QTZA 3S2EA 5CDSA 2P91A 3GFGA 4NFYA 4UAGA 1NQTA 2CVZA 1HE5A 2UV8A 4W7IA 4XDZA 4KTTE 3RBVA 4WCFB 4QX6A 5JYEA 3AOEC 1QORA 1FDUA 1O0SA 1ARZA 1QLHA 2JD2A 3L4BC 3MTGA 4JJIA 1UH5A 3JQFA 3R1IA 3L4BA 2PNFA 3L6DA 2A4KA 3ZV4A 1NM5A 1A71A 3E1KA 3AM4A 5JMPA 3IOYA 4I8XA 3DZJA 4NK4A 2DVMA 3JYLA 2IE0A 3VH3A 4BGUA 1KETA 1DFIA 4U7WA 3OBBA 5MGBA 1PJBA 4YXFA 3PIDA 4FN4A 5JE8A 2YQ5A 4Z9YA 2QRKA 4OOFA 1NHWA 5DZSA 2G0TA 5CP8A 4BIIA 4BNMA 3U4HA 1TI7A 3DC2A 3C1OA 4ZVVA 2YY7A 3ITKA 3JQ8A 1S7CA 3VAZA 2VN8A 2H9IA 4J4TA 1YQGA 3BMQA 3CMCO 4K9DA 1ULUA 4TRJA 4CM5A 5CDYA 1U8XX 4P4NA 2X86A 4WKGA 1DFHA 3V1TC 4ND1A 1DEHA 3H2ZA 4NI5A 4XD2A 3RCBA 3K96A 3K2EA 3OP4A 3TWOA 3ENNA 4PG5A 1KVQA 4FS3A 1EVZA 4J1QA 4LK3A 2DM6A 2O23A 3VVCA 3GR6A 1E92A 2BFMA 2VYVA 1DJNA 3VVBA 4CM6A 3KYCB 1GUFA 4B4WA 3GHHA 1PZGA 4R51A 2O2YA 1F8FA 1P3DA 2R00C 5CDTA 1QSGA 4S1VA 2DC1A 3OF2A 2WEKA 3DONA 1UP7A 2V6FA 3QLJA 1IYZA 1D1SA 1SNYA 2E37A 1K6XA 2WJPA 4JNKA 4G5HA 4FDAA 2HK7A 3ADPA 4ND2A 1U5CA 1CQIA 4AL4A 3S2GA 1IHXA 2JHFA 2VTDA 3GQVA 3C7DB 1OC2A 3IUSA 1Q0LA 3UF0A 1ZSNA 4JROA 4J7XA 1YKFA 2HK8A 4IINA 2HSDA 6ADHA 1LDEA 3AU8A 3N58A 5IDQA 2VHZA 4CM8B 3DZIA 4RPKA 1U3UA 1A72A 2I9PA 3G49A 1A9YA 3OM9A 2UDPA 1ML3A 5CPBA 4LCEA 3VKVA 2X7HA 1HRDA 2C07A 1TVEA 4AJLA 1PJSA 4CLRB 5FI3A 5JO9A 1P1FA 1E3SA 4A0SA 1E3IA 1U7HA 2OL4A 2QRLA 2Q49A 2VRCA 5ITVA 5K6AC 4EJ0A 2UVDA 3GA0A 1E6EA 3FNEA 4JXKA 1VJ0A 2W2LA 4WUVA 2VT3A 4R4JA 1BRMA 3QHAA 2PK3A 4PLZA 3T7CA 2FRDA 4EUEA 4RLHA 1R6DA 3KLMX 4CLOA 1AXGA 1OFGA 5JDCA 3IS3A 3OEWA 1EQ2A 3BA1A 3DZHA 1V9LA 2IYPA 1ISHA 5TF4A 2GN6A 2G76A 1MGOA 2HMUA 2B36A 5T57A 4XQ9A 1O94A 2HKIA 3UHAA 1BWSA 4A26A 4MO2A 4YYZA 5L40A 1KC3A 3EVNA 3LC7O 1YGYA 4NJMA 1M67A 2PLAA 4OM8A 2Q1WA 3JD3A 1YOVB 4CMCA 3ZWAA 1YRLA 2VWPA 2NVWA 4PGFA 2ZCUA 3IC5A 2EKQA 2V6BA 3E5RA 3PYXA 4E5NA 4IJKA 1QYDA 5T6BA 3O38A 3S2IA 2C20A 3RUDA 2GRAA 4WJZA 1EVJA 2AA3A 4R3NA 5I9NA 4MVJG 3LF2A 4IUYA 1JWBB 3UH1A 4XB2A 5ES3A 3ZHYA 3K9QO 3JQBC 4RVFA 4L4RA 2YZ7A 2IZZA 1P1HA 3HNPA 3LT1A 2NLOA 5J23A 1ISIA 2PH3A 1D8AA 2PKQO 4DWVA 2WDZA 2I67A 1KBZA 1LSSA 1KOLA 2EKLA 1BGVA 3WYBA 2HMSA 4ZQBA 4PLPA 4RJTA 1WW8A 4J0EA 1SZJG 1R0LA 3GAFA 1EUZA 1LBEA 4WOKA 5H83A 5I7SA 3GDGA 4MOWA 2X23A 1T2FA 1P77A 3IJPA 3L9WA 2CDAA 4GVXA 4P4LA 5TNXA 3JQEA 2IXAA 3AK4A 3LT4A 4TMFA 5F5NA 1ZCJA 3IQDB 5AXBA 3ZU4A 4DTIA 4J4BA 3NKLA 4PLGA 4CLXA 3KEQA 3JQ7A 3I5MA 1AN9A 5EQDA 4NHEA 1F06A 2O3TA 1HYEA 3TRIA 1GZ3A 3PQEA 2DAPA 1HYGA 3WQSB 1S6YA 1B7GO 5KVSA 4FW8A 3D5TA 3MJEA 3GT0A 1PZEA 4GLLA 5A3VA 2GERA 3D4NA 4OGWA 3ICPA 1CYDA 3NTRA 4O59O 3JQDA 2BRUA 3V8BA 4L75A 2BH9A 1K5HA 1VL0A 1HL3A 3WJAA 2JCXA 1HE4A 1R12A 2D0IA 4NFHA 4N5MA 4I5EA 1NP3A 5LC1A 2DLDA 4CM8A 1B8UA 3OQBA 1GPDG 1YBAA 2PZJA 5IG2A 4R1SA 3TQHA 3CH6A 2Y93A 3EHEA 2FZWA 2P5YA 1O5IA 2O3SA 4K1LA 1NAHA 4R3WA 9LDBA 1P0FA 2GDZA 3QIVA 3I9JA 3ZWBA 5CDGA 4JIGA 3E03A 4GMGA 4NR0A 4MVJD 4C7JA 4R1TA 4DL9A 3I9NA 3Q9UA 4PFJA 3EY4A 2FMUA 2RHRA 3CKYA 4QO8A 4G65A 2GLXA 1J4AA 5AOVA 4CV1A 2GGSA 1RM0A 3V1YA 4R54A 3ZGYA 5JDCC 2O3QA 3U49A 3WQRA 2WSBA 5G4LA 4GSLA 2EXXA 1D3AA 3DBLB 3EYWA 1SAYA 1I3MA 4LMRA 3TOZA 3FBGA 1E3WB 4PRLA 4QFDA 5DT9A 7MDHA 4ZJUA 3MWEB 1T2DA 4PCVA 3WXBA 4XYBA 4K6FA 3R0IA 4KUHA 4BO6A 1Y1PA 2IYOA 1ONOA 1J0XO 3BMOB 1XQ6A 1Y5RA 2WD7A 4Z3DA 1KEUA 2LDXA 2DBVO 2YHIA 1DAOA 4AJJA 2HMTA 3PZRA 3ZWPA 3EUWA 3L77A 2GN4A 2W8ZA 2JJYA 1B0AA 1HT0A 4XKJA 2VWGA 1B26A 4FFMA 3KETA 4YWJA 4YAJA 5G2OA 5C5IA 3BTUA 4DLBA 2Q2WA 1CETA 1ORRA 2Q99A 4PLVA 2PKQP 4Q3AA 4A5OA 5B12A 4WLOA 1HDGO 1E1KA 3FPLA 3KRTA 2BGMA 1ID1A 3QWBA 4M1QA 4LRTB 2VHYA 4XWYA 3I83A 4AJIA 3GH3A 1T2CA 2WWRA 4IJWA 1L7EA 3GZNB 4NH4A 4AJ2A 5IN4A 5A5FA 3NT2A 5TT0A 3AUAA 4Q3DA 4BNHA 4YQZA 5FYDA 1RWBA 1RKXA 1PWXA 1W6UA 2YV1A 3P2YA 3TZQA 2I5PO 1RYEA 4FJ0A 1LC0A 1XELA 3KYBA 1LQTA 2GN8A 3F9IA 2X0JA 2FPIA 3L0DA 3C3XA 4NIMA 4TKLA 5CEEA 3AUTA 3ETDA 3RJ5A 2AE1A 4FGWA 1DC4A 3PJDA 1E3JA 4NU5A 1MFZA 1ISGA 2GPTA 3IJRA 2RAFA 4ALKA 3I23A 5KJ6A 1I2BA 1NWCA 5B1YA 4DIBA 4L0QA 1LRKA 2PFGA 4AJEA 4KDEA 1UP4A 4J6FA 4W9NC 4XQCA 3QWIA 1XGKA 1XIVA 1YBVA 1I2ZA 4QSMA 4D3SA 1G1AA 1EFLA 5JCXA 1ZFNA 4L4XA 5HWSA 5HA5A 4D46A 3GY0A 1L7DA 1XHLA 2Y0EA 4JBGA 3AUUA 3H5RA 1I32A 4UREA 4WE3A 4OYRA 3VPFA 3S2FA 4XYLA 1B2LA 2EERA 2OP0A 3JD0A 3MJSA 1E7SA 5L4SA 1ZK3A 1EK5A 1MUUA 4UVDA 1M75A 4R41A 4WASA 4UEOA 1HDCA 4YAGA 3IAHA 5F1PA 2R00A 1JN0A 4DVJA 1W73A 3RUHA 2BFOA 3VPSA 1LSJA 2DTDA 4FCCA 4BNTA 2PGJA 3VPHA 4MIEA 4FC7A 4YVFA 1C0PA 1YO6A 4BMSA 2NQTA 2PA3A 3CPSA 4HFJA 3KEOA 4CM3A 1U7TA 1H6AA 3B70A 4YAKA 2Q1UA 2QZZA 2WYUA 1XSEA 3OJLA 1IOLA 4Y67A 1UAGA 7ADHA 1ZK1A 1C0KA 2X58A 3ETGA 3O9ZA 4IXTA 4PVDA 1Z7BA 1DBVO 3VC7A 3H9UA 1D4FA 5JNLA 4D0SA 4XJSA 2C29D 3V1UA 4CMGA 3E6AA 3LT0A 4KDFA 4UEKA 1NAIA 2NADA 4M8SA 2D5AA 3KYDA 2BELA 3LLSA 4B8WA 4E5PA 3QRWA 2D2IA 5DP2A 1EUDA 3SX2A 5DCUA 4OSOA 3U62A 1SB8A 1UXKA 3K30A 4W6ZA 4MVJF 3ZWMA 3KHUA 1T24A 2GCGA 3C7AA 4EYEA 2Y1EA 5CG2A 3PP8A 1GZ6A 2O4UX 2PGDA 1EFKA 1B16A 4J3FA 3DAGA 3LZ6A 5FF9A 4L4SA 4TZTA 1PWZA 3O8QB 1UJMA 4B7UA 1EBUA 3JYQA 4WLNA 3DWFA 3M6IA 3GZ4A 4KZPA 3EK2A 5JMWA 3CZRA 4PLWA 1LSUA 4GH5A 1VJ1A 2B35A 2XOXA 1GY8A 3RU9A 3ZNNA 3PDJA 4Z3KA 3RBZA 5U1PA 1KEPA 4BKRA 5K0ZA 1F14A 2CUKA 5JAMA 3ZWOA 3RUCA 3JYNA 4OAQA 3AI1A 4IJVA 3RQSA 4H16A 2GZ3A 3SC4A 3GNQA 2EW8A 5CPFA 3NEPX 5G0UA 2UUOA 3VPGA 3TFOA 2RBEA 3RAJA 1LDGA 4GX2A 3DBHA 3OIDA 4U5QA 1U1IA 2VNSA 5KWEA 3UN1A 5TC4A 2OBNA 3HUDA 3VHRA 3VH4A 2VUSA 1PX0A 3DTTA 2V6MA 3V2HA 2DQ4A 4IDEA 4BO0A 2FZEA 4Z9FA 4MKRA 4JJGA 3UW3A 3ICCA 1DB3A 1I8TA 4G2NA 3QY9A 2AMFA 4DPLA 2EP7A 2HO5A 1OZAA 1O95A 1XU7A 4XB1A 4CPDA 3GVCA 4J7CA 5HTOA 1SB9A 4NQZA 2VCYA 1DSSG 3DOCA 4YJGB 5GMOA 3ULKA 5BNIA 3AFNA 2VQ3A 4MP8A 3PWKA 1I3NA 5CFZA 2GYYA 1CWUA 1J49A 2E82A 3I9OA 1DJQA 3V2GA 2F00A 2NVBA 4CM9A 4OOEA 1EQUA 3B20A 1GCUA 1ZMOA 2YV2A 5C3MA 3FRJA 1J5PA 2YQ4A 1HYHA 1LA2A 3W1VA 1G0OA 2A94A 3WBBA 3ZU3A 1R66A 3ROQA 2TMGA 1DHRA 3EGOA 3H9GA 1JQBA 2I6TA 1PJ4A 1HDXA 4BNLA 2W2KA 4FFPA 3ZW9A 1IZ9A 4CLRA 1UP6A 3WIDA 1YL6A 1YWGO 5IAAA 4ZU3A 4KWIA 1ZSYA 3PZBA 4L8VA 1O89A 4JBHA 1Z7EA 1NPYA 2X9VA 4TWRA 2AQ8A 3GVIA 1WZEA 4E30A 1SCUA 4AICA 5IF3A 2I99A 2P4HX 3DAPA 3WLEA 1VM6A 1MLDA 2B4QA 3BTSA 3WGZA 5IJZA 4RDHA 4IDCA 3ZHZA 4FOSA 1YS4A 3FSRA 5L95A 4WEOA 4L73A 4ROSA 1GU7A 4M89A 4LMPA 4YAEA 1TT5A 3H4VA 4E2XA 4URFA 4YPOA 1Y81A 1ISMA 2HMVA 4RO0A 4LCJA 4BUCA 5G0TA 2GSDA 1PZFA 5L51A 2D1YA 3MOGA 1LLDA 2ZJ1A 1PJ3A 1R4MB 1XWFA 2PH5A 3IL2A 4PLCA 3WOHA 3AUSA 2CY0A 4J16A 4RLSA 4P4GA 5A9SB 4CMEA 3VH2A 5F3RA 4DMMA 4MIOA 4NPCA 4YT8A 5CEFA 1MG0A 3GZNA 4UEJA 2Y99A 4IXWA 3RUIA 3HDHA 3DZKA 2VHXA 5BNFA 4CQMD 1LUAA 3SC6A 2BHLA 1GFSA 2X1HA 1N8KA 4IGFA 3ST7A 3V5NA 1HKUA 5BT9A 3UFXA 1YBMA 1LDYA 5CDUA 3WB9A 5TQVA 4TSKA 2NU7A 1TXGA 3E48A 3ZWWA 1ZIDA 5JXWA 1YH3A 4YBZA 3PJFA 1WDKA 3W4KA 3JYOA 3O4RA 4EBFA 3U4CA 1GPJA 1EK6A 3AWDA 1UXJA 3A9WA 5A9SA 2YW9A 4PG8A 1JKIA 1YQXA 4LRSB 4FD3A 3TJRA 3EW7A 1E7QA 3GN1A 3PXXA 3RC1A 4E5YA 5C7OO 1I36A 2P9CA 1GUZA 3OHSX 3TNLA 5BSHA 3GDOA 4CV3A 3A06A 1BHSA 1UUFA 3QP9A 4D79A 3H9JA 3O8QA 4CR6A 1T1SA 4Q3NA 2ZATA 3W4JA 5A3JA 2J3JA 1OAAA 4PLYA 5JBIA 1BDBA 4AJ1A 4GWKA 3H65A 1UR5A 4GSKA 3HN2A 4XCVA 2ZYAA 3HWRA 1R0KA 1RYDA 4JLWA 4YJGA 3IKVA 3CXRA 5I9LA 2PY6A 3K5PA 5F5LA 1BMDA 5EJ2A 4IZIA 1ZVMA 3BMNB 2Q1SA 3GPDG 4MVJA 4H7PA 1IHYA 1LLQA 4TZKA 3WFJA 4D45A 5TIIA 4E21A 1DLJA 4B3JA 2C0CA 3GVXA 1DC3A 3WGHA 4IIUA 4BQRA 4BGIA 5ICSA 3H8VA 4D3DA 2Y1OA 1TLTA 3MZ0A 3PYLA 4E31A 2OZPA 2HLPA 5JDIA 1ZUD1 2D4AA 1GQQA 4W9NA 2BI7A 3STHA 3Q2IA 4AFNA 3RJ9A 1R15A 3BTVA 1K89A 3LU1A 2NWQA 4JJFA 2BMAA 2AW5A 4XZ3A 4YQYA 3RKUA 1N2SA 1GCOA 5JY6A 1PGOA 2Q4BA 2CDBA 3BIOA 4OL9A 2Q50A 1HZJA 1JVSA 1JW9B 5IZCC 1MV8A 1CRWG 1R4MA 3FWZA 4IPTA 2JFHA 3VKUA 4UVIA 4WECA 3VDQA 4BKUA 2WYWA 3BXXA 1G0NA 1E3WA 4I9HA 5DULA 3ROMA 3TL2A 3GLQA 5ICMA 1GTMA 4BKPA 4WNIA 4ZD6A 3GNTA 4HFRA 1GQYA 1UXHA 5I8ZA 3DOJA 1C0LA 3MTJA 1DC5A 2VUUA 1HSZA 2W4QA 4EGFA 1O6ZA 1IY8A 1U3VA 5ENDA 2Z5LA 2VT2A 3ENKA 4AJPA 4QQRA 4QECA 3R3JA 4ZICA 4PZCA 5HM8A 3R6DA 5F21A 4PLFA 2J5KA 1XDWA 3LYLA 1C0IA 3VOSA 3NJ8A 4LVCA 1GDHA 2O2SA 2I3GA 1WXDA 1ZK0A 2GNAA 3GF4A 1BXKA 1NVGA 5GY7A 2IZ1A 4PG7A 3S1LA 4DMLA 3H9EO 3OEYA 2J5QA 4OIMA 1U5AA 3ZI0A 4B8ZA 3HADA 2EHDA 4PRKA 3PK0A 1KVSA 4E5KA 2GASA 3BTOA 3NRCA 1IL0A 4W4TA 3GGGA 1NPTO 2VWQA 2RH8A 3ONEA 3PYMA 4AJKA 4DQXA 1T4BA 2C7VA 4YCAA 1SC6A 1P1IA 2PWZA 4NJMB 4BNNA 1AXEA 1Y8QB 4M54A 2FWMX 4LSWA 4WEQA 5AXDA 2POQX 3OA2A 5HS4A 4AJOA 1NXQA 4YRAA 2PR2A 4DUPA 1HDOA 4FFOA 3MJTA 3FR8A 2JL1A 3M2PA 5G0SA 2VTEA 2VYNA 2O50A 3OIGA 4ZHSA 1B15A 3ON5A 1OBFO 2C7GA 2V65A 4UUOA 4HKTA 2ZTUA 2VZ9A 1IPEA 2YYYA 1CF2O 3A1NA 5IDYA 3M1LA 2JAPA 3SLKA 1ADGA 1XKQA 4L9RA 3K73O 3PGJA 5JCJA 1V6AA 4B4UA 4MIYA 2Q45A 4P38A 3I3OA 1NTOA 4F6LA 5ENVA 1SBYA 1WPQA 1AGNA 3FNHA 1TEHA 5H81A 4RZHA 4J7UA 4MKXA 2YV3A 4Z6KA 4J90A 5L7WA 1X7HA 4YRBA 3BHIA 1X7GA 5B4UA 4ALJA 4GLOA 3E5MA 3AY6A 4CQMB 3A28A 4M55A 1OC4A 3RKRA 3QVTA 1ISFA 1WDMA 1PIWA 3GEMA 1E6WA 3ZNQA 2DBQA 1SOVA 3OSUA 4QUKA 4J9VA 3ITDA 2RH4A 5A05A 1B8PA 1LU9A 1Q0HA 3F47A 2HUNA 2I76A 4LN1A 1R16A 4E2ZA 5A9RA 4BB5A 1N9GA 4BO8A 2OFPA 3WBFA 4ALIA 3SLGA 4ITUA 2RCYA 1EE9A 3A14A 2HU2A 3PHGA 5HBRA 1GYPA 1VPDA 2FOIA 2QX7A 3LSYA 1QV7A 1PR3A 2XF8A 3VTZA 4UUMA 5DBGA 4GQAA 2QZ9A 3L6OO 4KQXA 3RROA 1DOHA 1UZNA 1YJ8A 3GUYA 1R0SA 3TSCA 3ZWVA 1HSOA 2A35A 1Y7TA 2D59A 1M6HA 2PD4A 4WOJA 4F3YA 5A06A 5JC8A 4QFCA 1EDZA 4J0FA 2W2KB 4B3HA 3D5QA 1FDVA 1I24A 3WGYA 3ONFA 1PGQA 2CMDA 8LDHA 4ZN6A 4HX5A 3WYCA 1R4NA 2JD0A 3INRA 5I7EA 4M49A 1ZKMA 1NBOA 4NU6A 1F12A 1NWHA 2PZLA 4CV0A 3GC6A 1BXZA 3PHLA 1TA4A 3H3FA 1T2EA 5A02A 4BS9A 5IXYA 3D1LA 3JCZA 3NDRA 4XRRA 2NVUB 5EIOA 1YONA 1X13A 4OMUA 2RIRA 3DBLA 4RVGA 5EESA 2X0NA 2AQKA 4H15A 4RVHA 3G79A 2XPCA 4X54A 1B14A 3WNQA 4N18A 2YHUA 4B3IA 4E6PA 2AQHA 1VLLA 4PLTA 1KC1A 3UAGA 5DN9A 3AFMA 3WGQA 2OOSA 1H5QA 4JK3A 3EDMA 1LJ8A 3WWYA 1QYWA 3I9MA 3HFGA 5I9MA 4C4OA 3DFUA 4DC1A 3ANMA 2X4GA 3WS7A 1C1XB 1M2WA 3DHNA 4IIVA 3C1AA 4GBJA 5TS3A 4L74A 3NGLA 3D3WA 3LQFA 1I3KA 4LW8A 1XR3A 4FB5A 3Q1LA 2AHRA 4FFNA 3V2UA 2ZYGA 4IDBA 3VZPA 3UICA 3LC2O 2PZMA 5C7LO 4F46A 3ROPA 1HF3A 3HDYA 4TRRA 5G4KA 3W6ZA 3M1AA 4YR9A 4XYGA 1R4NB 2D8AA 3ORFA 1CJCA 3WG9A 1KVTA 1T25A 3ASUA 3C7CB 2VYND 3CINA 2Q1TA 4GX1A 3ZU2A 2UUPA 2UYYA 3AM3A 4RF5A 2B4TO 4MVJI 5LDHA 4YT5A 8ADHA 4HV4A 1MXHA 4IDFA 4IMPA 1I5RA 3HB4X 2FHSA 3DEYX 4BNJA 4ND5A 3DOOA 4BNZA 4CQLB 1EMDA 3HHPA 4FJ2A 2X9GA 3NAQA 3CZMA 4MVJP 3PWZA 1E3EA 1Y8RB 2IEDA 1IUKA 2DT5A 3IP1A 1QR6A 5A04A 4DIOA 1VL6A 3O03A 2B5VA 3OJOA 3MJVA 2G5CA 3QVXA 4Z0TA 3HDQA 3BMCB 5JAQA 1YJQA 2DFVA 4Q9NA 4U8GA 1E1MA 4UVHA 3VDRA 5IXSA 1LDNA 2EIHA 5JFOA 2O4CA 1IULA 5ER9A 1C1XA 5L4LA 2Z1MA 3ZW8A 3HSKA 1HE3A 3JQAD 3N7UA 1IE3A 2CSUA 1CEQA 4II3A 1DAPA 3PEFA 3T4XA 5G0WA 4HY3A 1P33A 4BO4A 3GG9A
chains in the Genus database with same CATH superfamily
1BD4A 4GI2A 1N2CE 1G8AA 2C95A 3WRYC 3TZEA 3D64A 2ZKLA 2WOOA 1L5SA 2BFFA 2X6QA 1GHTA 2Z4SA 1U4OA 4DJTA 1C1HA 5HFNA 1KZ6A 2E49A 4KP7A 3TGLA 3OU7A 1PQYA 1XXHB 2A33A 4K9KA 1GILA 4BU1A 3TB6A 1JA9A 5TSDA 1F20A 3ZWXA 5GZ3A 4R9VA 3RFTA 3D0KA 5M3BA 4BAUA 1NJ2A 2J67A 2X22A 4KIUA 4PZ9A 1L4LA 4YRQA 4NCXA 1CDEA 5SYMA 1UJ5A 4ZTZB 4HI0E 1TUIA 4LZLA 1YVUA 1U0OC 3UAYA 5A1JA 3U44A 3N07A 4G1MB 5FUBA 5H3HA 3JWHA 4B3TB 2R8XA 1WVGA 1NT4A 4YACA 2NTVA 3WBBA 3MT0A 3VGJA 2D5LA 4Q3EA 2XWQA 5LD2C 4HBGA 1AGYA 5KOHA 5CM9C 3DEFA 2FR8A 1HDRA 2WKRA 1P2DA 3ZN2A 3T61A 4W5QA 5HEKA 5EMHA 1MIHA 2ZVJA 3P20A 3TR0A 3IEVA 1Q1EA 3N8KA 2ZTMA 4RF3A 1BN6A 2YWCA 5DTIA 4C4RA 3BGOS 1JFLA 4P0PB 2V7XA 3EWNA 4TRNA 5AI6A 3PVSA 4EX6A 1E1LA 2C8LA 1CUGA 3BXFA 4MQEA 4QJIA 2ECOA 5A7HA 1JTVA 3AR4A 3H83A 2W70A 4EHLA 2CMHA 2OQ2A 3QUBA 4NBWA 1EFPB 1T0PA 2P2CA 2VDVE 4G0OA 2PUBA 2W6JA 5DHSA 1WZ2A 4YK7A 4DPMA 1DKPA 1JP7A 2VATA 4UHBA 2PMCA 3SHVA 2ETXA 1TJ3A 3FAZA 4NJEA 3SEZA 2VQFB 1T5HX 4MV9A 3TW8B 1QAMA 3PNMA 3IESA 3U61B 4HNGA 4QSHA 3RNOA 1IDN1 4GNKA 5FPTA 3U4QA 5DFAA 4KOAA 4BEWA 3DBRB 3EMVA 4LMBA 2ZRPA 4MV7A 2OGZA 3JQGB 4QARA 3EGXB 1LI4A 4AKSA 5M04A 3R3ZA 1D2MA 2WR8A 3BQNB 421PA 4DMFA 2H52A 4OFXA 2ZSEA 2QJWA 2XDYA 1ZMTA 3OY2A 3C5HA 4G97A 1PW5A 1A5TA 1UWCA 5KO2A 1PS8A 1CC1S 4TQGA 1D1TA 2Z95A 1JLRA 1LF5A 3A27A 3LCRA 5EXPA 1CIVA 1QS0B 3BPSA 3NHAA 5DYYA 5I3ZA 2QAGA 4K6KA 2X0DA 4BZWA 4IYJA 5HUJA 4A8PA 3G2QA 3FFXA 4KXYA 5FTLA 5HRUA 1JHMA 5H4GA 3KHSA 3S29A 3PI7A 5LP6A 1Z26A 2QI9C 4K88A 5I5EA 2ST1A 1XU9A 2AH5A 1GVHA 4LHZA 1YHNA 2WTNA 5PNTA 3WSVA 3VR2D 1YVRA 3WL7A 4FMCB 4WXEA 1J8DA 2UKDA 2W93A 3AEKB 5TR9A 3KQOA 3IR5A 4L50A 4OXQA 4UDOA 1PEAA 3QELA 4X20A 3GIDA 5EMKA 4XQEA 2Q7OE 5B7QA 3TOCA 4DWJA 2I65A 1FS5A 2Y8EA 5EL0A 3FOFC 2P9EA 1ZJYA 4NAUA 3L18A 1ZEMA 3C43A 5F51A 3UQZA 5LJLA 1PF7E 4MW5A 2C0QA 4EYKA 4EA9A 4CCSA 721PA 1AMOA 4K0KB 7MHTA 1EIWA 4UHFA 3OWHA 4KW7A 4KI7A 2JFBA 3PNOA 2BKUA 5ALNA 3GNSA 1H2BA 5B37A 2Y3IA 2R1TB 4AZ3B 2BFPA 1D04A 4NCHA 3WSWA 2J3QA 1EDOA 2AOVA 2FZCA 4KXVA 1XZLA 2IU4A 2AOWA 5DYIA 3THWB 1WKCA 2CLIB 3JAKB 4Z86A 4GRAA 1X2EA 3EGXA 1YF3A 5LD2B 1P1KA 3VR6D 5E4TA 3LIIA 2I4IA 3H7IA 2WB2A 2AN5A 3ASZA 1GNTA 1R6UA 4KO1S 3KFVA 3T7KA 4A92A 3TD6A 1T8YA 3CLSC 2XNHA 1ESZA 4YUXA 3UA4A 4BPRA 5IKMA 4XX1A 5FUVA 2NZ8A 1FB5A 4EPTA 4DRYA 4I5DA 4ESEA 2FI1A 4PG6A 4UTZA 10MHA 5KYVA 4P3KA 5FL3A 3ZUPA 4EB6A 4LV6A 2J9YB 3GU3A 3IIKA 2FGKA 3PDWA 4U2KA 5B6IA 1Y4DE 1GTZA 3TL6A 1NLFA 1UJNA 1MX9A 2I6QA 3KKZA 2BDTA 4E09A 5KQMA 4O63O 1F2UA 2PGNA 3LRTA 4R7GA 1P9WA 2GBIA 5J40A 1QE3A 1MX1A 3G1TA 2OENG 3HP7A 5FO0A 1K0UA 5KQSA 2JKVA 2DTXA 1PZXA 4E7PA 4GXQA 4RTQA 5JSQA 2XEDA 1OI4A 1ZSVA 3JD4A 3GLFE 1J2JA 3IJ5A 3NMUF 3CNQS 3D2BA 4W5TA 2OOKA 5A4JA 3TQRA 4AP9A 3LKZA 3NHFA 1AE1A 5GJVC 4YO7A 2J45A 5DGIA 3THXB 4FFVA 2Y0PA 4CM7A 2I6XA 1EFRD 3GLHB 4GX0A 2IXEA 3OCVA 4GP6A 5JOQA 4IJUA 3R75A 4DJAA 5BSWA 4U2DA 2TECE 1P2BA 1JU9A 2NT4A 1Z25A 4XX0B 1C41A 5EJGA 5L4NA 2ISQA 1FL9A 521PA 3GCGA 1VJDA 3KSZO 4D7AA 2R7AA 1G20B 1CRQA 4UW9A 1O4WA 3TLEA 1WZCA 3HXLA 3CVOA 1PLJA 3DOIA 3L0PA 1RE1A 1V4VA 1SULA 5EG5A 4F9FA 4KQHA 3CVJA 2C2WA 2X9QA 2EFHB 3G9UA 3NDJA 3OMLA 3PNKA 4L8LA 2VDKB 2ZJAA 4S24A 5TQ0A 1ONBA 4D92A 1X7YA 2PXXA 4IIYA 5EINA 5T8KA 2WTMA 1ZDMA 3QUAA 4YCLA 4U6SA 3IUPA 4DLTA 3C3KA 4HWSA 2E48A 3CRNA 3ZI4A 2QIOA 1AX9A 4X1KA 4A73A 3W5JA 4MRMB 4O4HB 1UBEA 2XECA 4RVSA 3SKXA 3A2LA 2GAJA 4LYHA 4BTLA 3QLTA 1ZVJA 4OH1A 1F3LA 3HRHA 3E9RA 5ALKA 1M8FA 2NYUA 4PPYA 1MC4A 4X45A 3CVYA 2BEWA 3MC1A 1U8FO 3ADOA 4O1MA 4DE5A 5IM4F 3L7OA 1PK7A 3KBOA 3NBKA 1UIMA 3QBEA 1B3BA 4BKOA 3KSUA 1ENYA 4CZ2A 4ZIRB 4QA9A 2Y77A 1T1EA 1DWUA 1PG2A 3GARA 4I7EA 4KTVE 3GH1A 3G9QA 4MUYA 5COAA 3WR5A 3U16A 3LHDA 2C8KA 3N9IA 3DAYA 4EY8A 4YV7A 1REQB 2C3PA 4GWGA 1JQAA 2WSMA 3O94A 2H7CA 3QFFA 1TAUA 1GP2A 1ZISA 3IDZA 5ADHA 5LBUA 3I6IA 5HFAA 4MVYA 1P5HA 4B7CA 5SYNA 1E3LA 1JPVA 2FWNA 1K7FB 4GXNA 3W5AA 1I10A 1OBOA 1AS2A 4XQGA 4BNIA 5BW5A 2Q4TA 1TJ5A 3OTGA 2OO5A 2XKBA 4JB0A 4DJJA 1J21A 2QLMA 1TKAA 1XQVA 2IEBA 4FFBA 3ESQA 3QVKA 4LDQA 2OK7A 2QK4A 4HQKA 1W8DA 2WFLA 1HZZA 4JBWA 1RHMA 1ZX1A 4K03A 2HA6A 4KSBA 3RAEC 1VHLA 1HZZC 5I8PA 5FPQA 4DQUA 3PD1A 4OQZA 4QBTA 5A6SB 4MZDA 3LUCA 3DCNA 4MCJA 1GZ7A 3RIHA 4G0WA 4LOHA 1L5GB 4EA8A 2PUCA 1Z17A 1ISPA 4DIMA 3T5AA 3GI1A 4URUR 2VFAA 1A4UA 1IHDA 1V37A 2YWEA 4P3OA 4ER3A 5C9ZA 5H68A 1TM1E 1KZHA 2WFZA 3O26A 3Q41A 5B3AA 4LBYA 2IYRA 4PHCA 4O4IB 5DNAA 5HRAA 5TPZD 4BP3A 2CUNA 3G17A 1GGHA 3P32A 2QU8A 3CA8A 4BKQA 3II6X 3QWHA 2KWIA 4IQ0A 1B76A 1Q7CA 3PCRB 2PXCA 4H1HA 1G8SA 4NQRA 3T3IA 5KVVA 3E05A 3RG2A 2V1XA 1SFRA 3M6UA 2OHGA 3UATA 4YDHB 3WY9A 3A36A 1S2DA 5EE1A 5F7OA 3RVSA 1SUSA 4NE7A 4H17A 1X9GA 3WGGA 4ZVLA 2WQ7A 5K6RA 1G21E 3FVRA 5K6TA 1H85A 3HI4A 3R9KA 3RC3A 3JQ7B 3W7AA 2JKZA 4GSYA 4M83A 3DXYA 2C5HA 5JJIA 2V7TA 2VC2B 4B17A 5HE8A 3MWLA 5GGYA 4ZI7B 2FPPB 2WAYA 1T1RA 2YNMC 3HFSA 2IU0A 1EJ2A 1CD5A 2I4MA 2JLRA 1U2DC 4TVBA 1J2YA 1MT3A 2D1SA 2JFFA 3ELYA 3NHLA 4ON9A 1GKIA 1F1BA 3C8ZA 3F98A 3I39X 4RIGA 1WP4A 4KZKA 5B2ZA 2FPXA 1P4GA 4EDHA 3INGA 4Q48A 3FVVA 2FTKE 1PJTA 1H69A 1XEFA 4P31A 3SP1A 4ARSA 4B83A 2JGLA 5BV0A 1J8QA 4K6OA 4XGIA 1KI4A 1AURA 2NZVG 4V02A 5BORA 2JB9A 1V48A 4QU9A 5ERGB 3MS7A 4IJMA 3DE3X 3VNBA 1LK0A 4Y1EA 1YRYE 2VBFA 3G9ZA 3C2QA 2JBAB 4U1RA 2R8ZA 2XVXA 4LEIA 4GP9A 4DLVA 2GTIA 5KX5B 4B87A 2AIRA 1A5ZA 3UJNA 3IKTA 1YKGA 1O94D 2AJ8A 1AB5A 4KAJA 2XXAB 3OF3A 4CKXA 1WVIA 2OE2A 1O7JA 1T4DA 3FPJA 4OYLA 1V6SA 2J8ZA 2ZB4A 5AWFC 4Z51A 3C1TA 2Q4EA 5JZSA 4BP8A 1B93A 4N76A 2C83A 4ZYYA 3FDZA 3L41A 3TL3A 1R9MA 1ADCA 1D03A 4ZDKA 1USVA 5BW8A 2JGEA 1OMOA 2A9RA 4G37A 2IRWA 2AYXA 4A03A 1XG5A 2GD0A 1ATIA 1SUDA 3DE7X 3K6RA 4HAZA 4R69A 5E1DA 1P1RA 2WTAA 1NW9B 1M10A 1N3IA 1Q0ZA 1RPNA 2FVYA 1Y33E 2PD3A 2ZBUA 4JUAA 3WIEA 3ONDA 4ER5A 3N8NA 3RS8A 4YAIA 4LY3A 3L5OA 1LW6E 4XCQA 5KNBA 3CE9A 1BDMA 3G88A 4LFBB 2FF7A 5SZJA 3G2LA 2OV4A 4MWBA 1Z45A 2F1JA 3NT4A 1QRRA 3NUZA 2PMWB 1T6NA 3T1VA 1FRZA 4S05A 4BX8A 3LJKA 1ZL0A 3A1DA 1AKQA 1PUIA 2R44A 2W6JD 1G21B 3ETLA 2MR5A 4GR4A 4UMEA 3RSLA 4QJ3A 1JE1A 4TMYA 1NVDA 4BV9A 4G07A 4KMSA 3AVXA 3REGA 3CFYA 2IQ5A 3DP7A 4RPJA 1QP8A 1QXSA 4JP3A 2RGCA 2GZ2A 2VVTA 2G83A 2YICA 3RFVA 1AHPA 3CRMA 1C29B 3KAKA 3IJEB 4XQ0A 1ECGA 1C3VA 1PJLA 1SKAA 3UWDA 5LVAA 4U0JA 1XNQB 4V0ME 3QXJA 3F9RA 4BFSA 2FJ0A 4JSYA 1MENA 3A2NA 4F2GA 5EJ6A 2HYDA 3DL2A 4FFRA 4Z0PA 5GZ6A 4H1UA 5COQA 4RMIA 5KMGB 1UXIA 1QDEA 2NTNA 4MVJM 5T5QA 2VHEA 1T5TA 3VR0A 3GIWA 5IUNC 3E7WA 4MI1A 1I4TD 1RKUA 1TD9A 4N47A 2BWJA 4TTRA 4MR9B 3WAGA 4PR0A 3PNYA 2VJBA 4TQ9A 4EJ6A 5DEOA 3OZTA 3D1JA 4Y0VA 5BWMA 4D3ZA 1VE1A 2B1IA 3UJCA 1W5TA 1WXXA 4NV1A 4CLHA 1U2QA 1LVGA 4KXMA 4G86A 1SIBE 5HIJA 3IMEA 3S8EA 3KB2A 1Y8RA 4R1OA 2VHWA 4MMYB 3TM5A 1KERA 1RYBA 3ZCVA 4MMZB 5TQ2B 1M5RA 2RAPA 3R5JA 1Z4LA 1UDCA 2BSXA 5L7YA 4NENB 1Z07A 3LP8A 1SKUA 2WIAA 1X1QA 4QQNA 4RVDA 4ALMA 1KRHA 4JLOA 3CUKA 4EW3A 1T5SA 3GAZA 5JS1A 1JHDA 2WK1A 5KC8A 4HQOA 5FWNA 4CG0A 3I58A 2RGNA 2Y6VA 4FLMA 2FX5A 1T5OA 1XRQA 4N01A 3P26A 3BJZA 2QGNA 4BQEA 2GXAA 1RLUA 4CMAA 3DQQA 4G84A 2E89A 3PHJA 2OTCA 2DPYA 3AJEA 2GHTA 2VJAA 2ZROA 4OB7A 5U4QA 3UGJA 4BGDA 1M0SA 1Q74A 2R6ZA 4YJFB 4ACAA 1HEUA 1GAQA 3VV2A 3F2VA 2VK2A 1MU0A 2G88A 3GL9A 4U6NA 4KQJA 4MGEA 1BEZA 3DWIA 3ZJ5A 1AKNA 2BFAA 1Z47A 4BBAA 5KVQA 4ZI7F 4KNYA 4EENA 4F4FA 3HYLA 3P0RA 2AMLA 3Q3JB 3PTLA 2GPSA 4RZIA 1WAMA 2VJPA 1E2DA 1PTJA 3GJ5A 5T4EA 4B0PA 4B8YA 4TSFA 4C2AA 4RTSA 1GPAA 1R3UA 4EI8A 2FPOA 2FEAA 3V48A 1Z3IX 4GBMA 3ZLTA 5DRYA 4G01B 1KR2A 4YP5A 3IPCA 1MZPA 4PZDA 1R5BA 2PU7A 1KMNA 1MA0A 3KT6A 5BSGA 1FZTA 2ANCA 4QT4A 1TD1A 2PU5A 1ZBQA 4UHKA 1DKQA 4HAIA 4AKIA 4H9GA 3B8EA 4B6RA 3L43A 3NOXA 1IHPA 1GSOA 1KHTA 2XYGA 2I7VA 3OA0A 2JEOA 1Q1NA 4M22A 3GFSA 2WABA 4Z7JA 3RVNA 1XD2A 1KDZA 4EJ2A 3KOWA 1E96A 2YCBA 3GCXA 2WM3A 5LB2A 1QVZA 5K0LA 1E2UA 2YZNA 2FCRA 3TMYA 3P4YA 1EGHA 2EGUA 2DTEA 3AC0A 3TZLA 5JS8A 2QN1A 2FSFA 1PGPA 4QLAA 4C4SA 2EYUA 1P2VA 4EGFA 2MT9A 3IHKA 3HCAA 3R5SA 1LEHA 1RXEA 1V8FA 4TKUB 1XMPA 2B37A 4OQNA 3WLNA 1N2CB 4FWBA 5FEUA 3RYIB 1PAUA 2CNNA 3IDQA 5BV8A 4E2WA 6Q21A 1YZ3A 3PWSA 2HQOA 3SWWA 4INOA 1NBAA 3AY7A 4UQLA 4M7WA 3RVJA 4H0NA 1R5OA 4DLYA 5CBPA 3JD2A 1IPHA 3I04M 3NIGB 4B75A 4D8XA 5AVTA 3ZWDA 1QK3A 4DC0A 1A97A 1FDWA 2XDQA 1S5PA 3P0IA 1IFXA 1NASA 3SJ7A 4LTMA 1GEEA 4C87A 4AG3A 1A27A 1WF3A 5A6SA 4TKVB 3W8EA 1DC6A 3C6KA 4HLNA 4PTYA 3WL6A 3ZCPA 2V6JA 2D1QA 5FR1A 4UOEA 4DJDC 2HSWA 3Q12A 5HJEA 3IAXA 5KI6A 4HWPA 3QEMB 1T0BA 3ASVA 3L40A 1JSLA 1SVOA 1PFGA 2ID4A 4MW7A 4DA0A 4RD0A 2ADFA 2QVZX 3T5BA 4R1LA 3PCXA 3HDTA 2EWMA 3A3KA 4PAGA 4W8GA 1M2OA 4FTWA 4YA6A 3SICE 4TV9A 4BX3A 8OHMA 1FSPA 1TO2E 4LXXA 3IPXA 3OETA 1DS6A 4PZAA 1XNJA 4TRMA 4HGNA 2FCAA 1OI7A 4RHFA 4UATA 1X0XA 1SCKA 2EZTA 4LIPD 3TKLA 1DQZA 3T9BA 3TR5A 3H2YA 5A7GA 5BO5A 3TEJA 3LFHA 1ZMBA 3S4YA 2QL9A 2DKNA 3GK3A 3JQAB 4K8OA 4MR7A 2XNSA 3HJGA 3S70A 1QGUB 3DBRA 5JMTA 3CNOA 4G5OA 3MCVA 3NWOA 1J06A 2QRJA 5FLKA 1FXSA 2H63A 3MW8A 4AO6A 1G8GA 5JD5A 3G5AA 3F49S 1C30A 1GR0A 3X43A 2BGWA 4HH3C 1HWYA 3B1FA 4BNGA 2O8BB 2PWAA 4FFWA 3HG7A 3CZPA 3GLRA 2UVPA 1PK8A 3BIWA 4RYDA 3SX0A 4G0VA 4ARZA 1Z0DA 3V80A 1CFJA 2XMDA 5BSMA 3LY5A 4FDUA 2XDQB 4GLJA 1FTNA 2WMOB 3OLVA 5COBA 1SCDA 2FP4A 5IKEA 3DMTA 4BVAA 1Y1RA 5JRJA 2JCSA 2IL1A 2QTNA 4H18A 4UD2A 4N12A 1CP3A 1I0ZA 2OXEA 4DA6A 1JAZA 2P6MA 3CF2A 4EB6B 1B8VA 1NRJB 2F62A 3CT4A 1JEAA 1TW3A 4HTFA 3RODA 2VK8A 3GCWA 1E4YA 3LO8A 3QVSA 4BLUA 1YFLA 2P7HA 4HUJA 1DKOA 2MSCB 4PZ0A 3VKGA 5KNLA 3LY7A 3UT5B 4LRWA 2X2OA 3RSHA 2F67A 4CMIA 2DJ5A 4EDFA 3FI9A 2C5BA 2ODTX 4HBZA 3REFA 4J1SA 1US8A 5PGMA 2X6RA 3RASA 2YMLA 4C01A 3D4PA 2GHRA 5P21A 2PZBA 2BH2A 5GJBA 1OFUA 2ZIVB 1I2CA 3NOQA 5IXJA 3F5SA 5B4TA 2ZE5A 2H4WA 3JQAA 4ZDIA 1X94A 2B7LA 3AR3A 3LKVA 2YXLA 3UCFA 2QEQA 4LTNA 1T8UA 1MHPA 1YCHA 1QHNA 4HNSA 2WJGA 1A7JA 1KSFX 4NXNB 3DOHA 5CR9A 5BRAA 1TZMA 3CPEA 3Q87B 4BLWA 5DXJA 3VYUB 1PNRA 4PIVA 4RDCA 1BE6A 4NG5A 3HBAA 4L7QA 4M99A 1QIMA 2D2FA 2RDMA 2WJ6A 2YIVX 4O8ZA 3SNKA 3QOYA 3WIOA 1NLYA 3QFHA 4JOQA 5CEJA 5K8IA 3UENA 2GXSA 4M86A 4MAMA 2BI8A 3LBIA 1GZ4A 1I7LA 2WE7A 3A9CA 1OD6A 4PYKA 4X61A 3SBOA 4K7JA 2I4RA 5MDHA 3SEFA 3PEEA 2GPAA 4UBIA 5HF5A 1UAYA 4B2LA 3MJ4A 2F4VB 4FMCF 4RPHA 3ZWNA 3GGCA 4AWAA 4KQMA 3VPXA 3LF1A 1PK9A 1WMBA 3RYCB 2EFDB 4Q1EA 2OK8A 2GK4A 3RLIA 1MOZA 1JIXA 4L8GA 4W9RA 5D51S 3DVQX 4G41A 3K9HA 4R84A 5BN4B 4ZGWA 2AVNA 4TTVA 5AD1A 1ZCBA 1E1NA 1JU4A 2G77B 1WVMA 4X1IB 1OW3B 1A82A 2A92A 5KJCA 3CZCA 3U37A 1VJCA 4XR4A 5FB3A 1KYIA 1ACJA 2AFHB 1UCFA 2YJNA 1TTPB 2HMWA 1Z74A 3M5CA 4U7PB 4EK9A 1BMFD 2VNKA 4CN8A 3DZ8A 3Q9NA 3D6NB 4GUAA 3SXJA 4QATA 1V41E 3FN4A 4MDHA 2PRIA 1KFJB 1ZD9A 2H4HA 2VJMA 4MWGA 4IIHA 4PZEA 4PVCA 4ZAZA 1GKUB 3LY8A 5TJ9A 3TFQA 4UTNA 1WCXA 2GH1A 1R6XA 2VPYA 3FFTA 1DKRA 5DYGA 2WF6A 5LZ7A 1PFKA 4GZLA 3K0KA 3AHGA 1XV5A 1QOZA 1T0HB 2DPGA 2EFCB 2NT3A 1DPGA 3W4IA 3MWDB 4E5UA 2HJ9A 2RGRA 3HXOA 3PNSA 3E53A 1RCTE 3TX6A 5I7RA 3WAJA 2IGTA 3SBEA 1V2GA 4YUVA 3UPTA 4ZCRA 2XBMA 3F8SA 1JR4A 2VHUA 1T9DA 3D8TA 1Z36A 4F72A 3PPYA 2R8BA 4YJDA 4JJ6A 1SRQA 1E7WA 2BDUA 1ONNA 4XD7A 5LLSA 1E5TA 5JQWA 1N3YA 3E84A 1P9LA 1X1DA 1XLTC 4XM1A 2RFLA 4ERNA 3MIIA 5H02A 3X1KA 4Q3BA 1LNQA 4ZOLF 5HK8A 3HU2A 2C42A 3OQJA 4DDKA 3O7MA 1Z22A 5JSFA 4W6QA 5KVAA 1LKZA 2ZR8A 4X7BA 1FFDA 5CM8B 2BAGA 4RTLA 1ADFA 1F8GA 1YB4A 3UMVA 5TLSA 1UAAA 1QLWA 4YMTA 5MHTA 3UHPA 2B7BA 2IXGA 1I94B 4Z3OA 1ZNQO 3MWJA 4Q7EA 4QHTA 4OHZA 1W25A 2WE8A 3O1LA 2BGIA 1L4FA 3L8EA 4M1KA 1B0PA 2Q9UA 3E27A 3OE1A 4DABA 1K7CA 3NKVA 2WUDA 3WDSA 1DJPA 1KFCB 2OCLA 3FNGA 1ODJA 4OXYA 2XWPA 2X13A 2F8LA 2QTLA 2FEWB 4TS3A 3I62A 1JR6A 4RPGA 2O3RA 4M7PA 1YIDA 4C0WA 2OGUA 3WRVA 5JJ5A 1D09A 1GADO 4IMRA 5AW9A 3WFIA 3KB1A 1AOXA 1PQ4A 4NBRA 4E5DA 4F11A 3TNJA 5I6DA 2QMOA 4ZV4A 1NW8A 1N3LA 1SKYE 3GUHA 3ZDXB 2W2NA 4B5KA 3ERCA 4QGAA 1QVRA 1ZUNA 1X8LA 2VDUE 2XUIA 3HA2A 3FE2A 3M8KA 4QPCA 5DTQA 3UAZA 1N36B 3S6JA 2Y71A 1FY2A 3F1KA 2ZGVA 3TVDA 2EBWA 1EP1B 4CKZA 1NHGA 4BVLA 3D6AA 4YREA 2P6NA 2J3HA 2P9HA 3B52X 4G0PA 4QELA 1JB1A 4MHOA 4RKEA 3W8FA 4CMKA 2PBFA 1PJQA 4WNYA 1TCVA 1TK2A 2HIHA 3D6FA 2G5TA 3RIYA 1NE7A 4KYVA 1JBQA 1UBFA 4BNXA 1CE8B 3MSXA 4OATA 4X90A 2KI5A 4I6GA 1JJ7A 1RADA 4N03A 3TXXA 1XTSA 5IP5A 1DQRA 3KKQA 4ESVA 4N49A 3VI3B 4B80A 1JJBA 4CF6A 3BWDD 3L7IA 4RGBA 4ASUA 3QM1A 2IYEA 1UBCA 2PT7A 1PLLA 5K9ZA 3F3KA 3PVZA 2J5XA 4OSPA 5IBRA 4A6EA 1X0VA 2EF1A 3OJEA 4E70A 4TL9A 1M1NB 3A4TA 1PV4A 1AO3A 4G09A 4S3MA 3PI6A 1RYHA 3WLPA 2WNHA 1S2OA 2O14A 5FFNA 4ES6A 3ZXYA 5JCPA 1Q7BA 5SV2A 2ZYRA 1E2BA 2NU8B 4LF9B 1RWPA 3CVVA 1N6IA 2PCLA 1ODTC 4NONA 3IEMA 4OM7A 4ABTA 3IA2A 3JRXA 5FUWA 4FVTA 2Q8NA 3CRZA 3L7BA 5AYVA 5FBRB 1FC0A 1PL8A 2EGHA 1EVIA 1WNTA 3PD7A 1Z2EA 4IMJB 4LNUA 1AG9A 4L08A 1FMCA 3PFFA 4I9NA 3THSA 5LP6F 3P1JA 1FF9A 3TW6A 5KOHB 3G8DA 3LGAA 4EQ6A 3I5XA 2E85A 3HDJA 4Z2AA 2R96A 3RSFA 3R9WA 3JAWA 3NX4A 5SZKB 3V7FA 1N2OA 2YKGA 3RREA 2Z5FA 1KIMA 2AS0A 3PS9A 1QMGA 1C1YA 3WA7A 4NOMA 4MQUA 2DEUA 1VCOA 3LUJA 5ITSA 3DQZA 1TQ4A 4KBFA 4WNAA 2R8RA 4J1NA 2VZ8A 2O6LA 1HDIA 2G28A 5FR2A 1O9BA 1PV1A 3DE2X 4IDQA 4O2AA 1ORIA 1QRUA 5LOVB 1I3CA 1GRQA 3QU5A 5J59A 3SPXA 3NPAA 3B53X 3KPJA 3V6MA 3I64A 3G68A 3KVNA 3ZJTA 2AG5A 4P8RA 5EIBD 1IXZA 2FFAA 3FPBA 3K05A 3L1HA 3Q0EA 5TY0A 3W90A 5JSHA 5GIPE 3AF0A 4C78A 5LXTF 5C5EA 5LQUA 1D6JA 4JB8A 1P17A 1P74A 1RPTA 2FX2A 5ED4A 3OVMA 3OZ7A 4HNAA 2WV7A 4O4JA 5KWIA 5AJZA 1AO0A 5EMNA 3I53A 4PO9A 3W9UA 5EJEA 2B8WA 3HN7A 3MAJA 4DARA 1FUUA 4IVNA 5KCZA 2VWHA 4HRVA 5IBQA 3HA5A 2ZU6A 2JLZA 2Y4OA 2XXBA 3QF7A 2NVUA 3TZHA 4AJ9A 1RWMA 1IK4A 4MKIA 4X8HA 4JMPA 4MDYA 4OYHA 1JMYA 2X7JA 3AI2A 1BD3A 3OPNA 1BS1A 2X3UA 3IHWA 4F0JA 3B2EA 3JRNA 3RUAA 4CFSA 4LFCB 4MWZA 2O3JA 3FKSD 1FXWA 2C82A 1NQOA 1N2EA 2YDXA 2YRWA 4TV8B 1I5OA 1M2NA 2NTJA 1AHHA 1EXMA 2C00A 3IQIX 4M53A 5FBZA 3SYRA 3UJ6A 5ISMA 3RVPA 1BX3A 2IOHA 2QMEA 1JVNA 3CW8X 5A7FA 1U9CA 1CW2B 4UJ5A 4ZQHA 3ZCUA 3WLHA 1Q21A 3KOZA 4JLMA 1OX6A 4D9FA 1LRLA 2WYHA 2DE0X 4YWHA 5BYAA 1FP1D 2QMYA 4C6TA 1ZMXA 5C35A 3MRTA 1U0JA 2IYQA 5G0VA 3NBXX 4DPKA 3E8SA 1EG7A 2WYVA 3DHEA 2ODBA 4TL6A 3RJTA 1TCAA 3P9PA 1OZ0A 3BZUA 3ZKAA 4G1FA 2IKSA 2P6OA 5GM2A 5BMVA 3OESA 1UMBA 7REQA 4KNWA 4R7TA 2HJSA 3PIIA 1WBDA 3MQFA 4NTZA 2VRNA 4F93B 2E6UX 3VJRA 2QLTA 3X2EA 4HYYA 1EUDB 3TDMA 3F96A 4REQB 5AVOA 4URHA 4TMWA 4ZO7A 1Z5WA 5EHGA 4OHPA 1JMVA 2X3YA 2ZBVA 2ZTLA 3DDUA 1BWQA 3HPRA 4JP1A 4K26A 2AJDA 2O2JA 3MCZA 4L15A 2VNJA 2PS9A 3KJQA 3FZNA 1AQYA 1BHO1 1MC5A 4KE6A 4OV6B 4EGSA 5AVXA 4E15A 1YXMA 1QCCA 3I9KA 2CWDA 3JAKA 4OBWA 1G8KA 2ZI4A 1VSVA 3KAJA 4N54A 2B8EA 3FOBA 4A0QA 3GFBA 5EUCA 1A8HA 2Y1XA 4ZALA 3PDHA 5EWMA 5DM60 4MUBA 1NMZA 2DUWA 3QKTA 4PXYA 1A8PA 1L5KA 2WJ3A 3ANNA 3GRYA 3BWYA 3TLMA 1A8SA 1KP3A 1JG6A 1QE5A 2QUKA 5TQ2A 3VDXA 1Q3HA 1JR3A 2YMPA 5FHQA 3LA8A 1F3OA 3GEGA 4RD3A 4DXHA 1ABFA 3R0ZA 2OMKA 3RSSA 1KY4A 4QTZA 2CCJA 4X7MA 3TQFA 1NQTA 1RYZA 1G1MA 4WCFB 3O74A 1H66A 3Q7TA 1B6GA 1C7ZA 2BI4A 1VMDA 1JIQA 2CC2A 2VH1A 2JD2A 3G2MA 3L4BC 3NC4A 3VX3A 3SC2B 5IABA 3JQFA 3OIUA 4EG4A 3L6CA 1YCDA 3NC0C 1BCRA 5K20A 1NM5A 4N6GA 1RVDA 3RQIA 1JHUA 2I91A 5JMPA 1H1DA 2Z8YM 3AM4A 4DEXA 1JSZA 2J0UB 3KNZA 4C43A 1GJRA 3DZJA 3DW1X 3U9TA 3Q0IA 2DVMA 1YE5A 2BIFA 2IE0A 2XYVA 4MLDA 3RANA 4WA8A 5DLPA 1I6MA 1KETA 4V0RA 2X40A 2ORWA 1TK3A 3KEGA 3ER8A 1JDPA 1PJBA 3QX3A 3PRHA 4Y0AA 5F9MA 2P27A 2I4NA 3UXEA 5B1IA 2YQ5A 4JYAB 4Z9YA 3UC5A 1PBNA 2VUIB 2WSYB 3KJNA 2TMYA 2XT6A 3OX2A 5DZSA 2G0TA 2ZWIA 3OIWA 2AW3A 1E3DA 2XA2A 3ANSA 4UMFA 3DC2A 4REOA 2R79A 3C0KA 1QB8A 2V5VA 2WUFA 3ITKA 3KHKA 2INGX 4V24A 5EWMB 3ENQA 2HK6A 3TZBA 1QHXA 3DCYA 2VN8A 3TSYA 2QRQA 2DYKA 2H9IA 2EX0A 4J4TA 3TLXA 4PICA 3ODPA 4DCPA 1YQGA 3BMQA 5EY5B 1XYVA 2VNIA 2JGDB 2XQVA 2B2XA 3U1VA 2VYCA 4I46A 3OZGA 3VR5D 4D8VA 3F67A 1QCZA 2FSVC 2R8OA 3BVPA 4AC9A 5B1EA 4QJBA 1HGXA 2YYSA 1EFDN 3R20A 4OHYA 4F71A 2IA5A 2RB5A 1Y5LA 3K96A 3B5IA 3DFMA 4Q4AA 4QTUB 2YS6A 3T5DA 2B1GA 5I9TA 4CTNA 3U0VA 3FHTA 3ZV6A 1EVZA 1UWKA 2O23A 4EKDA 1RPZA 1OLUB 1E64A 2PX3A 4LXQA 4L1KA 1BQ3A 1BN7A 1GDDA 4Q37A 2D6FA 2PT5A 1GPLA 7YASA 4OMDA 3N6RA 4P32A 1ORVA 3FGZA 1P3DA 3HSSA 2QP3A 3DC7A 4QAQA 3S99A 4B6GA 4F3CA 1WY7A 5BWNA 1IBCA 5DHUA 2XVYA 1GNSA 1S8OA 4C4XA 1IYZA 1ILEA 2RGXA 1K6XA 2JDIA 2ZUFA 2H1FA 2MYNA 1Z8HA 2BFDA 4FDAA 5CFMA 3WRYA 2PBRA 1U5CA 1GU0A 3HKDA 3AIKA 2BFWA 4WESA 4BNDA 1EXVA 1VQ1A 2VTDA 2UZ4A 5ECGC 3EQZA 4F8YA 3EC1A 1E1RA 4JROA 4KLRA 4LDNA 4MI3A 4TLMB 4ZEXA 4XOUA 3S7TA 2HK8A 5KU7A 3PGA1 3M7IA 1CSEE 3RRNA 2VHZA 4TTQA 4KLCA 3AFIA 4FGUA 1U3UA 5ESDA 4U2FA 3G49A 3TMKA 3MIZA 2J6BA 2XMGA 1MIOB 4TWZA 1XZFA 4G23A 3DD5A 4RVOA 2C07A 3LTEA 1YCGA 4YFYA 4AJLA 2V9CA 2XV1A 1PJSA 3AETA 3IP5A 3WDMA 1XUOA 5JO9A 2PYIA 4YJ2A 1Y1QA 4LHWA 5K3FB 4UJ3A 4DY4A 4D8UA 2H16A 2V98A 1E3IA 2OL4A 3AH8A 3LCUA 2VRCA 4NV3A 3IQHX 5K6AC 1N2IA 2VP9A 4G8JA 3VU8A 2VSOA 2AUTA 4WRRA 4QOEA 4ZOCA 1TM5E 2QBYB 2UYOA 3HVRA 3K09C 1J07A 3N2GA 1BXRA 4L5CA 2QMZA 4GPIB 4WUVA 3Q0TA 2VT3A 2O8FB 1BRMA 1C0EA 3AZPA 4PLZA 2QTVA 2FRDA 3RDPA 5JI3E 3KLMX 1GL6A 1RJFA 3B1YA 3LX5A 3Q6MA 5D3MB 2A7XA 3EPHA 1OFGA 2A1TS 1YVDA 2XB8A 1NY5A 3DYVA 3KS9A 4M1EA 2B98A 5JSUA 4YRZA 3DZHA 2AZ4A 1V9LA 5IM5A 2XODA 2A5YB 5AM3A 4LI0A 1MGOA 2EZ9A 2R4TA 3HDVA 3GCDA 1JHRA 1U3GA 2OG1A 3I09A 4X92A 5FA8A 1TJ4A 2HKIA 1K8QA 2H08A 2Q5LA 3CRQA 3E1GA 3OURA 4IJ6A 3FVTA 4YCBA 3SVLA 3AB7A 1W1UA 4D9JA 1HV8A 2CXXA 4WESB 4YROA 4BNDB 4NJMA 4UBMA 4YYZA 4A82A 5J2UA 5JBQA 4ZOAA 3TD2A 4QFMA 3OCUA 3ABOB 3IB3A 3NP7A 3IBTA 2CHQA 1Q0RA 1VKHA 3I1IA 5DHTA 1U2RA 4RHCA 4CKEA 1AMNA 4KDCA 4MYCA 4PGFA 4X91A 4D96A 2ZXEA 3DV0A 3TUIC 3W05A 2C88A 4DQLA 4E4TA 2V6BA 4PQEA 1RQ2A 4EP1A 3T9EA 4IJKA 2F1HA 3DP9A 5T6BA 2C20A 1GXSA 2HJWA 4MMXB 1VE7A 4IIDA 4NV0A 1F2UB 2VSXA 1KE2A 2W8BA 3LF2A 4HQ0A 2ZBQA 2Z4TA 4OJMX 4QDUA 5B1SA 2ZRBA 5FDFA 3UH1A 1IN6A 1WL8A 2C94A 1WV0A 16PKA 2H5IA 1E32A 3JQBC 3K72B 1TUBA 4OQDA 4XB2A 5ES3A 4AY3A 4DSAA 1BXRB 1WSBA 3HXMA 1II0A 4IF6A 1VE5A 3FYCA 2W6PA 2AC4A 2IQIA 2QRMA 1EWVA 1G9XA 3AUFA 4EWLA 2O2IA 4MJ7A 3OT5A 1LTKA 3N3AC 5E4YA 6YASA 2LZ0A 1BGVA 3L5KA 2VDRB 3OT1B 4JOCA 4ZQBA 4KFTA 4BE4A 3Q5DA 2GAIA 3H97A 4WAUA 3LP6A 5H83A 5I7SA 2P4SA 5DNYB 2RBGA 3GDGA 4D5GA 1GZHB 5EWJB 4P4LA 4N40A 3CRW1 1N4DA 2ZIXB 3KLNA 4TMFA 5F5NA 3VU0A 2Z3WA 3ZU4A 2AYZA 4AUKA 4BLRA 4C7VA 5CB6A 3KEQA 1RABA 1VJGA 2IU6A 1AN9A 2JA1A 3I8SA 3IHLA 4NHEA 1F06A 2VKTA 4FCVA 4UDYX 4Z9AA 3TLCA 2FMXA 3ZHTA 3PQEA 1NATA 4GEGA 4YRTA 5IVPA 3EOBI 3Q5GA 4NP6A 1QFMA 2GD6A 4LDRA 5FUQA 1M9NA 2XI4A 4IXDA 3JVVA 4TUYF 4AS1A 1RKBA 4LGCA 2FW1A 4LBZA 4GP7A 3D4NA 3RU3A 2V59A 4O59O 3NTRA 1UKCA 1UXOA 2P9TA 1D2NA 1Z37A 5NULA 3V8BA 3EVCA 2D0IA 5EGSA 1PUXA 2WT9A 3QBDA 1RI2A 4MTLA 4QGGA 2W48A 1E0AA 5FBLB 1L5FA 4PWZA 3TH5A 4CM8A 5CB8A 4P9NA 2G06A 3OQBA 5IG2A 2PZJA 4OREX 1PHPA 1UFRA 3AERB 4I36A 1ADYA 4MR9A 4WDQA 5L8VA 5KWVA 4CIYA 3UK6A 4CQJA 3KKNA 2UXCB 5B57C 2GA8A 1VHJA 1NAHA 4K9LA 2YHBA 1ZMRA 2G6BA 5CDGA 4JYBA 3AJDA 4FD2A 4DL9A 5IBPA 4XM0A 4YR7A 3P9CA 4LX8A 4PFJA 4F06A 5CB4B 1QTQA 1KY3A 1G59A 1J4AA 1SOAA 3T1OA 3LXXA 3G5LA 4R98A 3W2IA 3ENWA 1QX4A 1XA3A 4R54A 3ZGYA 3IQXA 1N7JA 2P2LA 2VDPB 3OIYA 2W22A 1TTQB 1KDVA 1GN9A 2CEKA 2HEGA 3OWXA 4NZMA 3C6ZA 3DFFA 4Q19A 4TX1A 4LYAA 1GZUA 2JHAA 4IVPA 3WNCA 4TVSA 3WK7A 1APBA 4R2JA 3UMYA 2YWFA 5DT9A 1E3MA 2QMHA 1FPQA 5JAPA 2HREA 3WXBA 4DR6B 4BO6A 2H8KA 4EG7A 1Y1PA 5HMLA 4M60A 4E51A 1OLOA 1XDZA 2HF7A 4PEVA