2NU7A

C123as mutant of e. coli succinyl-coa synthetase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
287
structure length
287
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNSPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
publication title Participation of Cys 123alpha of Escherichia coli Succinyl-CoA Synthetase in Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 108
structure length 287
sequence length 287
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2nu7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nu7A01
4GWGA 4D44A 4FFOA 4J4BA 4DLBA 2FPGA 5EPOA 3DZIA 3F46A 4FQ8A 1E3IA 1R6DA 1NYTA 2FR1A 3DONA 4ZQEA 3WLEA 1M2WA 3HFSA 4R9RA 1Y9AA 4YWJA 1ZJZA 4WLEA 4CMIA 5BSFA 3AFMA 3QHAA 4ILKA 1SCUB 3ZWNA 2GO1A 3ZWVA 4YAGA 1PGQA 2DFVA 4DL9A 4BNNA 2O50A 1N7GA 4LK3A 3GEMA 2IDZA 1PSDA 4DQUA 1K0UA 1IZ9A 4R41A 3GVHA 3AY6A 5T6BA 4BUCA 2X7HA 1WWKA 3UCFA 4L76A 4M86A 5IDWA 1KYQA 1N5DA 1VKOA 1NM5A 1B8VA 1U5CA 2X58A 5DBGA 8ADHA 1LXCA 1M6HA 4BKUA 4CLOB 3BAZA 4YB8A 2CNBA 2Y0EA 3CZRA 3G0OA 3W8DA 1JU9A 1SPXA 5G4LA 1Y5RA 5KJFA 1PJ3A 3Q2IA 3IQDB 3R3SA 1I24A 2X9VA 4KQWA 2EEZA 3ULKA 3AI3A 4GMFA 4M54A 1J4AA 2O4CA 4IM7A 4OM8A 2GN8A 3I6IA 1JWBB 4IUYA 4BHTA 3P2OA 1IL0A 2RH4A 2POQX 5DOVA 2CDCA 2QZZA 1QYDA 3JYLA 4I9HA 1NFQA 2XPCA 5C3MA 1YBVA 3JQGA 5K0ZA 3KSZO 1F0YA 1Y8RA 3GFBA 3LC7O 1LTHR 4R1TA 1CYDA 1CQIB 1F12A 3PPIA 5AOVA 3ZV3A 4A73A 4CMJA 1ISFA 4N5LA 1OBFO 4AJNA 1TEHA 3TWOA 4PZCA 4B7XA 4WCFB 4DWVA 1CJCA 4FS3A 3PQFA 3H9GA 5TQVA 2NQTA 3TSCA 2NWQA 4OGWA 2P5UA 3LQFA 2BGKA 1B15A 4A2CA 2GN6A 1GUZA 2JAPA 3U4CA 1EMDA 4ND1A 2GSDA 2ZJ0A 7MDHA 3GZNB 1QKIA 3W4KA 1M66A 1CQJB 1K89A 4M8SA 4II3A 2Q45A 1VRWA 3E9QA 4GLOA 2P9GA 1FDUA 4IIUA 1RM3A 1E3EA 1VJTA 3U4DA 1H6AA 3OQBA 3I9LA 1B3BA 2OL4A 2EGGA 3VTFA 1U3UA 1HRDA 2CUKA 2B4TO 4TRJA 1H9AA 3B6ZA 4JX8A 5ILOA 4UAGA 1KY4A 4A10A 2HMUA 3U49A 3CUKA 4FFNA 4OXYA 4WLNA 2DC1A 4XYLA 3ENNA 3IJRA 4F46A 4HNHA 1J0XO 4MKXA 4MPDA 4BNVA 2NU8B 2YJZA 4RPHA 3JYNA 3MEQA 3GHYA 2CMDA 2D1YA 3DMYA 4OO3A 1W6UA 3TOXA 2H1SA 3GG9A 1V3VA 4FSHA 2P9EA 2BKAA 5ADHA 5JCJD 2FPPA 1XEAA 2O2YA 3HSKA 5EESA 2NUAA 3WSWA 1GFSA 2Y0DA 4OMUA 2HMVA 4XQGA 1B8UA 2D8AA 4IDAA 2D5AA 3KEOA 4Z0HO 1T2FA 1E3JA 4DC1A 3RC2A 1MGOA 4BNMA 2Q46A 1MUUA 1QYXA 3ZU5A 2NQ8A 4HFMA 3RUEA 4BNWA 4IPTA 2QG4A 1E1MA 3HN2A 5F3RA 1EBUA 3JQ8B 1Q0LA 4E5MA 1YDEA 4WPGA 1PS8A 4BOYA 1T24A 4D46A 4YPOA 3BHMA 1T1RA 1VL8A 5EQFA 1DC5A 3PEFA 1PGNA 2X0JA 3GFGA 4IS3A 4Z9XA 4BS9A 2J5KA 5CEEA 2XXJA 3CPSA 1C0LA 5K6AC 3RKRA 4P4NA 4HV4A 1I2CA 2OHXA 1YS4A 1X14A 2ZB4A 4L0QA 4XWYA 4EBFA 3UUWA 1KIFA 4GPD1 4ZQHA 4DTIA 1W0CA 3ETGA 6LDHA 1ISIA 3IP1A 4FJ1A 4PLVA 5T57A 3K31A 4CV1A 1KVRA 5C5IA 1HDGO 5IAAA 3TNLA 3DDNA 1BDBA 3PHGA 3I4CA 2PK3A 1I3MA 1I36A 3DMTC 3MOIA 4KZPA 3RUDA 3ZNNA 1Q0QA 3OJ0A 1XYGA 3IIEA 2DQ4A 1CIVA 1U2DA 3KETA 1A72A 2Q3EA 3GMSA 4Z0PA 3OEWA 4IZHA 1JLLB 2X23A 4B4WA 1H6CA 4ZN6A 3U4HA 1OI7A 1EUCA 5DP2A 3U5TA 4G2NA 3TDKA 3QRWA 3I3OA 1ADCA 2B0JA 3L6EA 5EN4A 2NM0A 4WLOA 2PTGA 3CZMA 2RBEA 1X7GA 3T7EA 4RVUA 1EK5A 4JN6B 2NUAB 2H63A 2JHFA 1CWUA 3GF4A 3WFJA 2W4QA 3SJ7A 2CVZA 3ZU3A 2IXAA 1GYQA 3EC7A 4NZ9A 2YQ5A 4TRMA 2JD2A 1UXHA 3WQQA 1ZK3A 3ITKA 2ZK7A 1E3WA 3IS3A 2GZ3A 5AVOA 3KLMX 4XA8A 1GQQA 1IE3A 4HFRA 4D3FA 4TMFA 4E30A 3MOGA 1JQBA 1T2AA 3EDMA 1Y8QB 4B3JA 3KSDO 4IDDA 1DRUA 4RVDA 1H93A 4RVFA 2BGMA 2VOJA 4JIGA 4L4RA 4RZIA 5F1OA 4AJIA 3RWBA 2EW2A 1ZW1A 3B1FA 5A05A 5F21A 3ZNOA 3GN2A 2I3AA 3BTVA 1GAEO 3FTNA 1GEGA 1KEPA 4J6FA 4CR6A 4YRBA 4Q39A 1SZJG 2YHUA 5JAIA 1MC4A 1VKNA 3WS7A 5A9TA 4A7PA 4YJFA 2HLPA 5G4KA 3BHJA 1ENYA 3D7LA 3HUDA 1LBEA 4H3VA 4I9NA 2O3QA 4IGFA 4XYGA 1ONNA 3VH2A 3ZNPA 4IJKA 1JKIA 4W9NA 1P1KA 1LJ8A 5C7OO 4NBRA 5K6AA 3QVTA 5TJ9A 1XU9A 1W8DA 1FDTA 3G1TA 3VZPA 4DIFA 3I83A 1NPTO 1QXSA 3HFGA 1R4NB 2HK8A 1XELA 3F4LA 4L73A 3PP8A 4ND5A 1T25A 2QRLA 3QVWA 3W4JA 4GVXA 3G17A 3Q9NA 1DIAA 1FJHA 5JY1A 1ENZA 2J5RA 2H6EA 3UCEA 1TI7A 5F1PA 4UUNA 4DIOA 1NASA 3PJDA 4D43A 2VZ9A 4ZRNA 3FF4A 1Q0HA 3H5RA 4LMPA 5GMOA 1JLLA 3MWDB 2ZKLA 2EP7A 1NR7A 1HYEA 1GPJA 1HSZA 1U2GA 4J1SA 2CFCA 5CDSA 3JV7A 1OZAA 3SX2A 5CHEA 2A35A 3AU9A 4LCJA 4XYBA 3ICPA 3B70A 4GX5A 4N5NA 1MP0A 4HY3A 3MJCA 3RU9A 4CR8A 3GDOA 1E7WA 3CXRA 4R51A 3JQBA 3DZKA 2AEMA 2ZCUA 4CV3A 4INAA 2YQ4A 1SO8A 1UH5A 4TSKA 2JAHA 3DBRA 3BTSA 3U4IA 1PX0A 4URFA 4M49A 4OQZA 3WQRA 1P45A 3WFIA 4RPGA 4IMRA 3KYCB 4K6FA 1LDEA 5IF3A 3FSRA 1DC6A 2DLDA 2ZYAA 5LDGA 4WCFA 3GPIA 1JW9B 1B26A 1PGPA 1PJBA 1Z6ZA 1QV6A 2FSVA 1UZLA 4FOSA 2D4AA 2BFPA 4E2ZA 4JNKA 4BO6A 1F8FA 3HQ4O 2ZYGA 3JQGB 3GZ4A 3ZWMA 4R3WA 3I9JA 4CQMB 1MG5A 4E31A 3VZRA 2VHZA 3AUTA 2O3TA 1U9JA 2YDXA 2X6TA 2YZ7A 4MOWA 3ZCXA 4F6CA 2WJPA 3GVCA 3VVBA 4GSLA 4R1NA 4II2A 4CR7A 5G0WA 4EITA 1YKFA 3W8EA 4IJUA 5TIIA 1O8CA 2A94A 3D64A 4IQ0A 2UDPA 3GNTA 1KEUA 2CVOA 1A9ZA 2VNSA 3O4RA 2RH8A 4RF3A 2UUPA 1YOVB 1CETA 4TKLA 1WNTA 3FNGA 4ND2A 3COSA 4H7PA 4DPLA 5CG1A 5L45A 3I9KA 2I65A 3DZHA 3VPHA 4YRAA 4JGBA 4OXKA 1K5HA 4KOAA 5TRTA 3D1LA 1WDKA 2AMFA 4NG5A 1IULA 3NKLA 5JCXA 4I5DA 1NTOA 4R9SA 5I8WA 1HDRA 3ZWYA 3IL2A 1NQTA 1MB4A 1VPDA 1L7EA 2JL1A 3GVPA 5CDUA 4A26A 5JDIC 2GYYA 4O0LA 5DZSA 1BRMA 3SXPA 4MVJF 5BNTA 2E49A 4Q3AA 4DBVO 4DIBA 1RYDA 2PLAA 4MVJM 2JD0A 2WM3A 4YYZA 3QP9A 1VJ0A 1K6IA 4YQZA 2BD0A 4WNIA 2GNAA 4FC7A 2HKIA 2DBRA 2I9PA 2OP1A 1LRKA 4BMNA 2ZB7A 5KCZA 2W2KA 1GTMA 1LC3A 3Q11A 4MINA 3IKVA 1GUYA 3LZ6A 1CF2O 4LISA 3C7AA 5A02A 3BA1A 4WEOA 2WE8A 3FTPA 4NPCA 2B5VA 1PS0A 2EWMA 4J91A 3EUWA 3C3XA 4N54A 1VM6A 2JD1A 2BFOA 3O38A 1K2WA 3VH1A 1PJTA 1BDMA 3NDJA 4J1QA 3CTMA 1ZSVA 3U0BA 2G82A 4OAQA 3X2FA 4GVLA 1HYHA 5BSEA 2FMUA 3K73O 3PRJA 1QLHA 1DC3A 2NACA 2PGLA 1CERA 2HO5A 2UVDA 3P7MA 4MP6A 5L7YA 1HSOA 1XDWA 4WCFC 1VE9A 1JN0A 2AQIA 2Q1TA 3WXBA 4WGGA 4FJ0A 2D2IA 4LVUA 3WDSA 3PZRA 3QVOA 3BMCB 1H9BA 4XX0A 1BXGB 1MA0A 3TZKA 2PWZA 3IUPA 4YJDA 3JD1A 1QMGA 1IPEA 1OC2A 1O6ZA 4DQXA 2NTVA 4EJ0A 2GN4A 2OUIA 3GDGA 1I8TA 1LLQA 3OBBA 3AOEC 2AEFA 3F1LA 1SCUA 1WLYA 1IPFA 4PLPA 1H94A 3EAGA 4DPKA 3STHA 4DYDA 1M75A 4CL8A 4ALMA 1R0SA 1I32A 3A06A 3QWBA 3ROPA 2NVWA 5DNAA 4PFJA 3KTDA 4DMLA 4KWHA 3PGXA 1P1FA 5K9ZA 3BTOA 5CPFA 1V8BA 4CM4B 1V35A 3I5MA 3NGLA 3BXXA 2NU7B 2AA3A 4PLHA 5HM8A 2UYYA 1D3AA 1H0KA 3FI9A 3QLJA 3RBZA 1X1EA 2GUGA 3FCOA 4J9UE 5JW6A 1KS9A 3GR6A 3O8QA 4D79A 3DQPA 2HDHA 4PLYA 1MG0A 3GAFA 4J7CA 4WOKA 3MJSA 4L75A 4S3MA 3DBVO 4P38A 2XAAA 1E77A 2FWMX 1UP7A 3GAZA 1PWZA 3K2BA 4XZ3A 4S1VA 2QRJA 2VQ3A 4I5GA 1MC5A 3WNVA 3QWHA 2BMAA 2LDXA 4RQTA 2AQ8A 2NSDA 2J5QA 4KWIA 5H81A 3ZV4A 4BNYA 4EYEA 3C1OA 3VPSA 1SB9A 5H83A 3UHAA 2JCVA 3E6AA 3LSYA 2X0NA 4U5QA 3JQ7B 3WTCA 4CPDA 2WEKA 4GX0A 5KVQA 4GI2A 2AG8A 3JQEA 4GLLA 2B36A 3RASA 1N92A 3I1JA 4QFCA 3ZWAA 3LLVA 4CM9D 1HEUA 4RPJA 2PZKA 4QO7A 1OAAA 1Q7GA 2W2LD 2O7SA 1DPGA 3KSUA 2VHWA 1S7CA 2GDZA 4CMGA 2Y1EA 3H65A 2GASA 3K6JA 4PLTA 1N1EA 4HUJA 4OXNA 4GX1A 5JO9A 6ADHA 1P0FA 2XXBA 5DCUA 4AICA 3M1AA 1R37A 1KETA 2EKLA 1VLLA 4ZQFA 3CIFA 3ZHZA 1L1FA 3WJ7A 4WLFA 3KM0A 4A27A 1TT5B 4R1UA 5IFLA 3WGYA 3LF1A 4E5NA 3ZWOA 1GV1A 4PZEA 1DRVA 5G0TA 4O1MA 5MGBA 2ZB8A 1E92A 3QA9A 4FW8A 5C7LO 2AXQA 2DBVO 3V5NA 3L6OO 3RROA 2FZWA 1EK6A 5G0VA 4A5OA 1UZNA 4YDRA 1KOLA 2YFHA 4TZTA 2YW9A 4BO5A 2HJSA 1B0AA 2QIOA 3KVOA 1QR6A 3TOZA 1HL3A 2QYSA 4IMPA 4R5MA 4KUEA 3UOGA 3MJVA 4L8VA 2Q2WA 2VHYA 2Q1UA 2ZTVA 2AG5A 1I3KA 1MFPA 4P4LA 1OFGA 4O59O 2JCYA 1ZMOA 3FR8A 2PGDA 1P1JA 3NDIA 3RBVA 3CMCO 3SLGA 4BNXA 3NDRA 1GZ4A 3TL3A 2JFFA 2ZJ1A 3NTRA 4ESOA 2C2YA 4IDFA 2WTBA 2CSUA 5IZCC 4LRTB 3VPGA 1ZEMA 4AJOA 1ZXLA 3AUUA 1DAPA 1GCOA 2YUTA 2GCGA 1SNYA 3AOGA 3FHLA 1E6EA 3OETA 4XQ9A 1JAYA 5B4UA 2QX7A 3KEQA 4LVCA 3G79A 3OIDA 4BNUA 2ILTA 1DC4A 4FFLA 4CLXA 1RYEA 4D45A 1FK8A 3SJUA 1PTJA 2AE2A 2PD4A 3SVTA 2A4KA 4ZJUA 3EHEA 2DUWA 2X86A 2GZ2A 1LLUA 1X7DA 3TRIA 3JQBC 1CRWG 1P1IA 1V0JA 1WMBA 4BVAA 3GH3A 1ONPA 5L4LA 2PR2A 3HB5X 4M87A 2GGSA 2YHIB 3I9NA 3E9NA 3LDHA 5I9NA 5IDQA 9LDBA 2I6TA 2BI8A 3QWAA 4BKQA 4R3NA 3UW3A 2GERA 1Q7BA 2NNLD 3K30A 3A9WA 1YGYA 4L74A 5KWEA 2FOIA 1BSVA 1LC0A 4JJGA 4ONEA 1Y6JA 1JVBA 5KKAA 4TVBA 3DAPA 3PFWO 1E6WA 1XU7A 4BNZA 5COQA 4YBZA 3C1TA 2Q49A 3D3WB 2VRCD 4J7XA 1LDBA 3L0DA 4LRSB 4NK5A 3KRTA 1P1RA 2AEJA 3NX4A 4AG3A 3PWZA 3JD3A 3VOSA 1LEHA 2DUUA 4TVOA 4ALJA 4XB1A 1Y81A 5FWNA 2Y67A 1X1TA 2Q1WA 3OJFA 4R5HA 3ROKA 3VDRA 2I5PO 4BO1A 3ONDA 4Q3NA 2VOEA 3DBHA 4D7AA 2X5KO 3GQVA 4PG8A 4PLZA 4J43A 5JS6A 3N58A 3C7CB 1F8GA 4FJ2A 3PZBA 3ZWPA 2FPPB 4TROA 2VWQA 2PNFA 4CL3A 3OM9A 1EFKA 3C24A 2B69A 4WNCA 1YL6A 4B4VA 5DT9A 3ROMA 3GA0A 4HWKA 4YACA 2ZTLA 3T4XA 3V1UA 4FCCA 4ZRMA 1HDZA 2NVBA 1E1NA 1QYWA 4I5FA 4LGVA 4WUVA 4YRDA 4HNGA 3WGHA 1N8KA 2C7GA 1HE5A 3WSVA 5HS6A 2DU8A 1QG6A 1U4SA 3DFUA 3BZUA 1QYVA 4MVJE 2Y99A 3D4PA 3UCXA 2VYND 1EQUA 5TS3A 1V6AA 3I52A 1FDSA 4FBGA 3B1JA 1VJ1A 1YWGO 4JBGA 3RVDA 1V3TA 2JFHA 4GKBA 4MVJP 2BFMA 2SCUA 4PVCA 4WECA 5IXYA 1P77A 4IY1A 1LSOA 5IN5A 2AHRA 3E82A 4JJIA 3EMKA 4WOJA 3QWFA 3VPFA 1ZO8A 4UEJA 3UICA 1EDOA 1LX6A 3D0OA 1SC6A 4NFHA 4K1LA 2EW8A 4XIYA 4UEOA 2G1UA 3RAJA 5ICMA 4O63O 4YJGB 3OQ6A 4ZD6A 2EV9A 2PA3A 4AFNA 1NNUA 2NU6B 3JYOA 2PKQO 3RUIA 1CQIA 1BXKA 4L4SA 5JC8A 3WG9A 3S55A 2DTXA 2BFAA 2X22A 1J49A 4M89A 4MVJA 5DDIP 2BRUA 4ND4A 3WX0A 1SEVA 4D0RA 1PR3A 2WMDA 1DSSG 1NR1A 1KC1A 4QTZA 5JO0A 2O3SA 5A3VA 1C1XB 3QY9A 5EERA 2EKQA 2FZEA 3DHNA 1OOEA 1PJCA 4J1TA 4AJPA 4MKRA 4TRNA 2O2SA 4E0BA 1U1IA 3AM4A 2R00C 3WYBA 5A03A 5GZ3A 2D5CA 4KTVE 1NWHA 3ONFA 2D0IA 5CEJA 3QV1A 3WBFA 3JQ6A 2Q2QA 4LSWA 5CPBA 1C0KA 3F5SA 3DBLB 2EKPA 2Z95A 4ZU3A 1LUAA 1DHTA 3WGZA 3WNQA 5JAQA 3IDSA 1HYGA 3OP4A 4BNTA 5HWSA 1VL0A 1AN9A 1ENOA 3L4BC 4MKZA 5ENVA 5EL0A 3CINA 4IDGA 2V6MA 4ZQBA 4D0SA 3RIHA 3PJGA 4BGIA 3O03A 5A3JA 3WIEA 2V65A 4K6CA 4NDNE 2GF2A 2FSSA 4U6QA 4BGVA 4RORA 4AJJA 4MIYA 1JKFA 4FFRA 2NU9B 4AJLA 5I9LA 3JQAA 1GL3A 1UUFA 4Q3EA 3SC6A 5A5FA 1BXGA 2PD3A 3JD4A 4OJNA 2E37A 1ISMA 3VZSA 1R12A 4J16A 2HMSA 3PVZA 3FWZA 4IXTA 3RI3A 1RWBA 2HUNA 3QE3A 2CDAA 4LCEA 4XJSA 1U3VA 3E5MA 2PKRA 3PDJA 3VAZA 3GC6A 1R4MA 2PKQP 3DZJA 3D5QA 3JQCA 1DO8A 4Y67A 4CLEA 1R16A 4CM8B 2C54A 4M55A 1H2HA 4RVHA 2HK7A 3ICCA 2BF7A 4IBOA 5HTOA 1DBVO 5JBIA 5ITVA 1R4NA 4OH1A 1WMAA 3CKYA 3CEAA 4OOEA 5A4DA 3KHUA 3GVXA 1C1XA 1JA9A 1UZMA 4OQYA 4UVHA 5KNLA 4FDAA 1KERA 1T4BA 2IXBA 4Q3BA 1DXYA 2F00A 3N7UA 4PG5A 3DAFA 5BNIA 1XCBA 1V3UA 2Q2VA 1BG6A 4OOFA 3V2GA 3NAQA 5A9SB 4I9UA 1H2BA 1ZJYA 1GZ3A 1D4FA 4DREA 2Q99A 3H8VA 4YJFB 4J4TA 4HBGA 1I01A 1DJQA 3MWEA 3F1KA 3WTBA 1IOLA 4BO4A 4OSPA 1YQDA 4CLRA 3DWFA 5L9AA 1PJ4A 4BNFA 1NPYA 4YR9A 2IZ0A 3RKUA 3LT0A 4JROA 4XR9A 4J0FA 1BTOA 5JMPA 5KJEA 3D3WA 4RVGA 4ITUA 1YBAA 4WE3A 3DC2A 2EJWA 3BYZA 4IZIA 3A28A 3VKUA 1EUDA 1Z74A 3E03A 4RO0A 2B35A 4HFNA 3BMQA 3PHIA 1AXGA 3ZV6A 1U8FO 2AQHA 3TFQA 2C07A 2OP0A 3TFOA 5DULA 1P9LA 2CY0A 4ZICA 2Y0CA 1TLTA 5COBA 3RCBA 3E18A 2Z1NA 1TXGA 4PLGA 3TF5A 3I9OA 3VVCA 3AFNA 4E12A 1IHYA 1IYZA 3AUSA 1UDBA 3MJTA 1MXFA 4B4OA 4BO0A 2BH9A 1YL5A 1TA4A 1QRRA 5B4TA 4RPLA 4E5PA 4KP7A 4GL4A 4AJKA 4MP8A 4CQMA 1P44A 4PGFA 1P0CA 3RJ9A 4UVDA 3Q9UA 3NJ8A 1SBYA 3NTQA 5LCXA 4U0JA 5T67A 1U3TA 4J4HA 4PG4A 3RD5A 1DIBA 5B12A 4XGNA 1MV8A 4F6LA 3VHRA 4YJGA 3ZWCA 1HDXA 2OZPA 5AXCA 4OIMA 1DHRA 2PV7A 2C59A 1CQJA 3FNHA 4YT2A 4JK3A 5JPIA 4XYMA 3A4VA 3S2GA 2RHRA 3QSGA 3ZV5A 4EJMA 2J8ZA 1PGJA 4GGOA 1MXHA 1UXIA 2R00A 2TMGA 5ICSA 4D41A 1LRLA 2E6UX 2XOXA 3HJAA 4CMKA 1DIHA 5AXBA 5KOIA 3WWYA 1W4ZA 3ANLA 1LLDA 1GZ6A 3ENKA 4P22A 3GLQA 5ENDA 4NNJA 3RBXA 1ARZA 1EZ4A 5IJZA 1J5PA 2YV3A 1KEVA 4EDFA 1GD1O 1R66A 1A4UA 2X9NA 4BMVA 2VUUA 4W7HA 1NVGA 3NT4A 4EEXA 3UFXB 1NVTA 3RQSA 4BO3A 4CUZA 5TT0A 3DOJA 3OJLA 3K92A 1ENPA 2O4UX 3KYBA 4RGBA 4WCDA 1AUPA 1E3SA 1HKUA 1WPQA 1SOWA 3DL2A 3TN7A 1KEWA 3LF2A 3VH3A 3HADA 4RDHA 3OQ1A 5U9CA 2QRKA 2BELA 3ZNQA 1JKJB 2YV1A 3RFVA 1I0ZA 3FWNA 5TC4A 4CQLA 3K8ZA 5AXAA 4E13A 4E2WA 1I10A 2OBYA 3WLFA 1ZVMA 3GDFA 3ASVA 5T8KC 3P2YA 3M6IA 1DEHA 5L40A 2O3RA 4ZHSA 4GGPA 4Q3CA 4NH4A 1LLCA 5U4QA 3JQDA 1AE1A 2X0RA 3L07A 1B2LA 4IJWA 1TT7A 3RC9A 1ZSNA 4E33A 3GOHA 3R0IA 3ZU2A 1SEPA 1T4DA 4ZGWA 2J3IA 2ET6A 2HRBA 2OO5A 4AVYA 3ADPA 4N7RA 4UVGA 2O7QA 4NMHA 4FB5A 1M76A 3JTMA 3OH8A 4UULA 5HS4A 4CLHA 2UUOA 1DLJA 2DM6A 3IOYA 2GLXA 2VN8A 1WDMA 3UGKA 2OORA 3RC7A 3MWEB 1EVJA 1KVSA 1Y7TA 3MWDA 4NQZA 5T8KA 1DB3A 2HJRA 5IDYA 3PLNA 1X0VA 1YO6A 2NLOA 2G0TA 4QUKA 3E5RA 4PRKA 4BMSA 2PFGA 4PG6A 1ISHA 5KTKA 4WLVA 3KOUA 1UR5A 3IJPA 2DKNA 1F14A 1A7KA 3L9WA 3Q3CA 1EBFA 1E6UA 4KMSA 2E48A 4PLCA 4RV9A 3H6KA 4YT5A 5JC1A 4KQXA 2RHCA 4AJ1A 4XGKA 4XB2A 4ALKA 4N5MA 2NU8A 1I30A 2NVUB 3UF0A 3EK2A 2BGLA 2PY6A 3GN1A 4H15A 2WYVA 3MZ0A 1ISGA 5BQFA 1OC4A 3H9JA 2CF6A 2WWRA 2Q4EA 5G0UA 4BNJA 5A9RA 2YV2A 4NI5A 3W8FA 3HB4X 3HDQA 3E9MA 3ZW9A 4UUOA 2UAGA 1BVUA 2CZCA 4U7WA 5G2OA 4IQ8A 4WJZA 3QVXA 4UREA 3WGOA 2Y1DA 3ZZNA 2DT5A 4YVFA 3MJ4A 3L77A 2VUTA 4CLRB 1YH3A 3PWSA 2R2GA 1ZNQO 3ZU4A 3HNPA 3DFZA 2VHXA 3EY4A 4CLOA 5JCJA 4DRYA 1ZIDA 2J3HA 2IRWA 2OGUA 3S2EA 5CDYA 1M67A 1ORRA 4DPMA 3F47A 5A04A 3L9XA 4U8GA 3PGJA 2H5LA 1FF9A 4PVDA 2VRCA 3CSDA 4DVJA 4TKMA 1GU7A 2TMDA 2QW8A 5GZ6A 1PJQA 1G1AA 3KBOA 4YAEA 1AXEA 1EEHA 1L7DA 3D3EA 2VT2A 4J3FA 1PWXA 1IZ0A 1GV0A 3SBOA 5DCWA 2C0CA 1Y5MA 4FR5A 3OIGA 2FPIB 3DZBA 4MIOA 4AL4A 3FNFA 1A7AA 3KZVA 3GT0A 1EFLA 3K5PA 4RDIA 1GR0A 1DOHA 4J2HA 3WR5A 2X5OA 2DFDA 3HDHA 4J9VA 1LDYA 1QORA 3GGOA 2C2XA 2VTDA 4Z0TA 1ZKMA 3WICA 3WGTA 2HSDA 3QIVA 4R68A 4YQYA 1WXDA 1LDGA 4DQVA 1NQAO 2X0IA 4I1IA 5I7VA 4GAEA 3ABIA 3B1KA 4BB6A 2FPIA 1PIWA 1NXQA 1LA2A 2X8LA 3NV9A 4AJEA 3RUCA 5ER9A 5IZCA 2F1KA 4BNIA 3DAGA 3QJ5A 2W8ZA 1P31A 2YY7A 4IIVA 2Y1OA 4BNKA 3A1NA 1GPDG 5CEFA 5L7TA 1GYRA 1QYCA 1MFZA 1H6DA 4G5HA 1WAMA 1C14A 1E7QA 1HTBA 2C5EA 1K6XA 2O23A 3OFSA 4GX2A 4I08A 4MP3A 3U9LA 2C7VA 5C37A 2FR0A 5DBIA 4EGFA 1PQUA 2DPHA 2D3TA 3BMNB 4BO7A 3PIDA 3PXXA 2VYVA 4NJOA 3WGGA 4BNGA 1X15A 1GADO 1K3TA 2DBQA 4BQPA 4CM5A 1VSVA 4B79A 1JDJA 3QQPA 3TPCA 5I9MA 1UDCA 3KB6A 2W98A 3WMXA 1LSUA 1PQPA 4GMGA 1BW9A 4JCOA 3SEFA 5U1PA 1B7GO 1X13A 4E21A 4Z6KA 2EERA 4DMMA 4JXKA 2X9GA 1RM5A 3BMCA 1YB5A 2WYUA 3AW9A 1NVMB 1VSUA 4YAKA 2YDYA 4FD3A 3GG2A 3VDQA 3ORFA 4R54A 5I7SA 1C0PA 3CMMA 3AI2A 3X2EA 3N74A 1YJQA 4N18A 2JJYA 4QX6A 3DZGA 2JHGA 4A0SA 5EQDA 3U62A 1QSGA 4OHUA 4NIMA 3DOCA 3GMDA 3W6UA 1DJNA 2VYVD 3VC7A 3INRA 3IUSA 1ZSYA 4CM7A 1M6WA 8LDHA 4A03A 5FEUA 3PLRA 1E3LA 1ADGA 2C29D 3UN1A 3LT4A 4B3HA 5ITWA 2P68A 4W9NC 2FR8A 4YTEA 3Q0EA 1ID1A 1R4MB 4NBWA 3PTZA 1BW9B 1QP8A 2W2LA 3JYQA 4E6PA 2DBZA 1X0XA 5C7IO 3JSAA 5L3ZA 4NBTA 4ALLA 2Q4BA 2AW5A 4Q9NA 1E7RA 2J6IA 4R1SA 1PR9A 2QQ5A 3F4BA 2ZQZA 1YJ8A 3VZQA 3JQ7A 1XG5A 1F06A 3NJ4A 3ZH2A 5CAEB 2IE0A 3P19A 1XKQA 2FRDA 4UVIA 4YT8A 1U8XX 1EVZA 3PJFA 3DBHB 3ZHXA 1G0OA 1A71A 3OEYA 3ZWWA 2SCUB 2Q50A 4FC6A 1U7HA 2ZTUA 1ZBQA 2W90A 3OJEA 4HFJA 5DOZA 5JDCC 3GEDA 4UVEA 4IJVA 1CDOA 1U28A 3DO5A 5JAZA 4RF4A 4XJTA 3K96A 4EUEA 4KUHA 3GY0A 2Y66A 1ZFNA 3VH4A 2Q1SA 4DXHA 3KO8A 3T4EA 1NX6A 1WW8A 2WD7B 3PIIA 2WYWA 3G49A 4XCVA 1E5LA 4CQMD 4C7JA 3W6ZA 4BGEA 1YVEI 2DTEA 3F3SA 5JDCA 4W4TA 1ULSA 4B7CA 4MIEA 5TNXA 1XHLA 1FXSA 1PGOA 7ADHA 1PQWA 3ZI0A 1HDOA 2HAEA 4ROSA 3IAHA 4I5EA 3FRJA 1EDZA 2EG9A 3ZN2A 1OMOA 1Z7EA 2ZYDA 1KY5A 1KC3A 1AHIA 4OKNA 4PZDA 2BI7A 4HADA 3RFXA 1O9BA 2A92A 3LT1A 1NHGA 4OKIA 3T7CA 4OYRA 4JQCA 3PFFA 3EVTA 1HXHA 4LMRA 1DRWA 5KJCA 2Z1MA 2OMEA 5DN9A 4B8WA 1U5AA 1F17A 5JFOA 3EZLA 3PJEA 3MTGA 4YEDA 3R1IA 1E5QA 3W1VA 4XQCA 4D42A 4QT0A 4OL9A 3RC1A 5BSGA 1UXKA 5AQ1A 1EUDB 2HQ1A 1WDLA 1PZEA 1E1KA 5A1TA 3I9MA 4MVJH 1JTVA 1PL8A 3C8MA 4QXMA 2FP4B 4E32A 3RFTA 3NT5A 4CMAA 1C1DA 4YJHA 5F5NA 4NJMB 4FGSA 5TF4A 1P33A 4QSMA 4XRRA 2WE7A 4RJTA 1A27A 2V6BA 4CM6A 2A9FA 1Z45A 1GY8A 2VZ0A 5BSHA 3PK0A 2R6JA 2HMTA 3PI7A 3ETDA 4B8ZA 5CAEA 4TQGA 5AXDA 5HRUA 1JKJA 4LN1A 1D1SA 4NFSA 4E5KA 2I66A 5I7EA 1A9YA 1ZXBA 3GVIA 5AYVA 3TZHA 2GRAA 3DTYA 1Y8RB 3GRPA 5ILGA 3H3FA 5CG2A 3QVSA 4CM3A 2IODA 3OSUA 1C0IA 1HF3A 1XGKA 3ANMA 2P9CA 3IP3A 2G5CA 3V1TC 4NBVA 2E82A 3PQDA 2X4GA 1O0SA 3ADOA 3OECA 1Y9EA 2WD7A 3PYXA 4NHEA 1HDYA 1T2DA 3MTJA 5JDIA 3D4NA 3EVNA 4XYEA 3AY7A 4U0KA 4PCVA 2VWHA 2EXXA 4XDZA 4IDEA 3H7AA 5FF9A 2DAPA 3ZW8A 2EGHA 4E3ZA 3KV3O 3F6YA 4XX0B 2FHSA 3JQAD 3KYCA 4Z9FA 2HRZA 1EVIA 4K28A 1UDAA 2V6FA 2DPGA 3V2HA 5L7WA 1CEQA 1XLTA 2VWPA 4EI2A 4DYVA 2HCTA 5DF1A 1I33A 1RPNA 2QZ9A 1Q7CA 1UXGA 5COAA 4CJXA 2I3GA 1MX3A 1Z73A 2PZMA 3O26A 3WYEA 1O94A 1Z82A 3OA2A 1H5QA 4RF2A 1WVGA 5JAMA 1IB6A 1ZCJA 4XR4A 2ZATA 3B20A 3LLSA 1XQ6A 3UAGA 4C4OA 1BWSA 3I23A 2EF1A 3IMFA 2FPGB 5T64A 1FMCA 3H9QA 4PRLA 1ZUD1 3L6DA 5JLAA 3UFXA 4B7UA 5B1YA 1PL6A 5KVVA 2VRBA 2VNAA 3V8BA 2FN7A 4CMCA 1E7SA 5CP8A 1ZEJA 4XGIA 1XWFA 2VZ8A 5EIOA 5JXWA 5DP1A 1AHHA 4DBZA 4J2OA 2O3UA 3AJRA 3VTZA 4PIVA 2PH5A 3TZCA 3KUXA 3AU8A 4HX5A 2Y1GA 1PEDA 3O8QB 2QHXA 4CODB 1PS9A 3E48A 3R6DA 2P4HX 3HN7A 4BB5A 5FI5A 4HKTA 3UXYA 4J0EA 1O5IA 3DR3A 4JLWA 2PD6A 3F9IA 5KJ1A 3DOOA 3LYLA 4YT4A 1Q2XA 2DVMA 3C7DB 1WZEA 5HBRA 3FN4A 1ISJA 1HZJA 3FBTA 3JCZA 3RJ5A 2YFQA 1K6JA 3NEPX 4KTTE 4WLUA 2HU2A 4IXWA 4RQUA 4R69A 1D1TA 1PJ2A 2OOSA 1N9GB 1NP3A 2Y1FA 1YE3A 4CV0A 4DLLA 1R15A 2X1HA 4LW8A 4YA6A 4BKPA 2IYPA 3FPCA 4CMIB 3K2EA 1BGVA 2Z5LA 1N2SA 3QWIA 1DFIA 3WQSB 4Y8VA 3HDYA 3VKVA 4E4YA 4Z3KA 4R01A 3FPLA 1G0NA 2AE1A 2V7PA 4MDHA 1NPDA 2ZCVA 3WGIA 4M1QA 1BMDA 4GBJA 4F3YA 4F45A 3LK7A 4QQRA 2VCYA 1ZK2A 4O6VA 1P3DA 4ZQGA 5TT1A 1XIVA 2EP5A 1SOVA 2NADA 5MDHA 1NBOA 2CDBA 3PDUA 3RU7A 4CMBA 4CM9A 4CUKA 4KDFA 2GR9A 4QO8A 1TVEA 1DAOA 2J3JA 1O89A 3BHIA 3AI1A 1B16A 2E4AA 2UV8A 4P8RA 1QV7A 3GNSA 1EUCB 2WD8A 3OIFA 4FIZA 1VL6A 5IG2A 2XF8A 1I2BA 4HXYA 2ZIZA 2IYOA 5ER6A 2I67A 4BO9A 3JQFA 3S8MA 4C7KA 2G76A 2PZJA 2WSBA 3D5TA 5EMHA 4I8XA 1P1HA 1C3VA 3V2UA 1Y8QA 3WMWA 3GPDG 3VPXA 3ETEA 4NU6A 1YQXA 2B5WA 1ZH8A 3HE3A 3MCVA 3CH6A 4EW6A 1E3WB 3WBBA 1LNQA 3WGQA 3H4VA 3WIDA 1YXMA 1ZK0A 3ANNA 4CM1A 1GDHA 1XQ1A 2FY8A 4BV8A 3AM5A 2ZTMA 1YB1A 3WYCA 3WOHA 4E2XA 1LQTA 3L4BA 4B3IA 1T26A 1DFGA 3OICA 3GUYA 2I99A 3NUGA 4PN3A 4KUGA 4YAJA 2PH3A 3M2PA 4BNLA 1ZZEA 4J49A 4L9RA 3TZQA 4YXFA 2IZ1A 1HLPA 1HETA 3JQ8A 3OMLA 5DCYA 1SMKA 4ALNA 5DBFA 3DBLA 1MLDA 5L53A 3JYPA 2QYTA 2VHVA 1B3RA 3EW7A 1BXZA 4NBUA 4ZVVA 1ADFA 4Y6RA 5GZ1A 1RM0A 3P5SA 2YYYA 3Q2KA 3FR7A 3ON5A 4OSOA 4W7IA 2YHIA 2CD9A 3C1AA 1H6BA 4EUHA 1ZMTA 1NQ5A 2NVUA 2ZQYA 5KIAA 2HMWA 1LSSA 1SB8A 4W6ZA 2C5AA 3FNEA 4ID9A 1DLIA 2LDBA 1TB4A 1GUFA 1LDNA 4TWRA 4EUFA 4W99A 5FYDA 4RCVA 4RLHA 1T1SA 3NTOA 1Z75A 3GK3A 3AY3A 2OFPA 1R0KA 2O48X 3JD0A 3LVFO 3JQ9C 3H3JA 1PL7A 3AOEA 9LDTA 2P4QA 1N9GA 4AJ4A 4BNHA 5IN4A 3BMQB 4IS2A 5TX7A 3IKTA 4W82A 1HZZA 2FP4A 1R0LA 3OHSX 4Q3DA 4ALIA 4RZHA 1NFRA 4IDCA 1XA0A 3HZZA 4JJFA 2OXIA 1KBZA 3DB2A 1GQYA 4H16A 3WB9A 3ZHBA 3PWKA 2D59A 3DEYX 4EZBA 1E1LA 2NV6A 5JYEA 3UH1A 1W73A 2BLLA 3SLKA 5TGDA 1I3LA 1UP6A 3G1UA 1PJLA 3HDJA 1YRLA 4FOOA 3RUFA 5JY6A 2IEDA 1I2ZA 3S2FA 1N1GA 5THKA 3H2SA 4XEHA 3GZNA 5L95A 1UXJA 4RVSA 4DA9A 1GCUA 3AWDA 3AM3A 4CQLB 1BVRA 3PHHA 5A9SA 5JSFA 1NHWA 4NR0A 3EYWA 3QW2A 1DDOA 1XR3A 3I4FA 4J90A 4AJ2A 4G81A 4UUMA 3U3XA 1ZK1A 3JQ9A 1WZIA 1KVTA 4PG7A 4JP3A 5F5LA 2AQKA 1D7OA 3E8XA 2B4QA 1PZGA 5TLSA 1JVSA 2B83A 4GQAA 4RF5A 2I76A 4RPKA 5J23A 2NTNA 2P5YA 2NU6A 5KKCA 1Z7BA 4XKJA 3H5NA 4MVJG 4O5OA 3M2TA 2ZB3A 5HA5A 5A06A 1HLDA 3BMOB 3WWZA 4CUJA 2W2KB 3GGPA 3H2ZA 2VYNA 5JMWA 1IY8A 4Y6PA 1UAYA 4RL6A 3UKOA 3E1KA 2RIRA 1A5ZA 1QLJA 4FFPA 5JYDA 2IEBA 1D8AA 1N7HA 3INGA 4XRGA 3ZGYA 1B14A 4GKVA 5T5QA 1X7HA 5CDTA 5I7FA 4J7UA 1NAIA 1HE4A 2BHLA 2X5JO 4Y98A 3SC4A 1EUZA 1JAXA 4EJ6A 2C82A 2WDZA 3ASUA 1UP4A 3A14A 3DBRB 3OA0A 5G4KB 1Y1PA 3FD8A 3K9QO 4D3SA 2P2SA 4E2YA 2B4RO 3GGGA 2RAFA 1E0DA 4NU5A 4G65A 2O3JA 3PYLA 1VC2A 2CVQA 3PYMA 1EE2A 3PHLA 4LSMA 5B37A 4MJLA 3ONEA 2VWGA 5KVCA 4IGEA 1U3WA 4CV2A 5CFZA 4YCAA 1NFFA 1YBMA 2JCXA 1NWCA 3KLPX 1U4OA 1XSEA 5KVSA 3W4IA 4IINA 4NK4A 3TZ6A 4YAIA 1PU2A 1ULUA 1ML3A 1FDVA 2V6GA 1EVYA 3FBGA 1VI2A 2EHDA 5B4VA 4R16A 2GD1O 1GYPA 2PZLA 3DZFA 3NRCA 3EZYA 1UJMA 4E5YA 3HHPA 5EJ2A 1ZK4A 2RCYA 3LC2O 1NQOA 1T2CA 5GY7A 3HWRA 3NT2A 4BGUA 3GEGA 5IDXA 4DC0A 3DHYA 3ITDA 4FFMA 4PLFA 4TRRA 2GPTA 3LU1A 2G17A 5BNFA 2J3KA 1C1DB 1G6KA 3G3EA 3Q6IA 4WASA 4YJHB 5FI3A 1ADBA 3BIOA 3KYDB 4U6SA 3M1LA 5BT9A 1YL7A 4WK6A 2OBNA 3AUAA 4XIJA 2CF5A 5H82A 4BO2A 5IXSA 1A4IA 5EINA 1IUKA 3PHJA 4JBIA 3BMNA 1E7MA 4DLAA 3GRKA 5TJHA 2JFGA 4DUPA 3KXDA 5JE8A 3H9EO 2NU9A 3LT2A 4ND3A 1E7YA 3TL2A 3JQFC 4FPXA 4MVJI 3AK4A 5L4NA 4KDEA 1LU9A 1NAHA 3RSHA 1LRJA 4BKOA 1EE9A 3ROQA 1LI4A 3WJAA 3U09A 1O95A 2VT3A 1GQ2A 1U7TA 3CE6A 3GUCA 3LC1O 1BHSA 4IQGA 1YDWA 4X54A 4XQEA 5F1KA 4BL5A 1HWYA 2P91A 5G0SA 4WKGA 5L51A 4XDYA 1I5RA 2VUSA 4TZKA 3OF2A 4JBHA 2DTDA 4PLWA 3H9UA 3UVEA 1DFHA 3BTUA 2HK9A 3BMOA 4NFYA 2Y93A 2NU7A 5FFFA 1ONOA 1PZHA 2PGJA 1LSJA 3GNQA 4QFDA 4Z9YA 3V1YA 4CM4A 5THQA 1AGNA 1HE3A 2IZZA 1LQUA 2B37A 1HT0A 1RKXA 4JP2A 2GZ1A 4BIIA 3PQEA 4BV9A 4Y6SA 3NGXA 1JWAB 3MJEA 2Y68A 3RUHA 4DGSA 1FDWA 5IZ4A 4MVJD 1I3NA 4AJHA 3JQAB 4HP8A 2EJVA 5L4SA 1T2EA 1RJWA 1J6UA 1UAGA 3ST7A 2NTJA 4MO2A 4FGWA 5LC1A 4ZA2A 3I6QA 3DHEA 4K26A 4B4UA 4FN4A 1KVUA 1YQGA 3DMTA 1LDMA 2EIHA 2Y05A 3GHHA 3ZWBA 2JKVA 4P4GA 4UEKA 1HDCA 3RUAA 4EEZA 5CDGA 5A5EA 5KJ6A 3S1LA 5BR7A 2Y1CA 1S6YA 3F5QA 1P74A 1V9LA 3EGOA 3JD2A 3O9ZA 3KYDA 5I8ZA 3HG7A 4NJMA 5ES3A 3OJOA 1YONA 1PJSA 4CMEA 1EQ2A 3TQHA 1GEEA 3D4OA 4IDBA 4K9DA 4UUPA 1IHXA 1PZFA 4GH5A 3Q1LA 4WEQA 2H9IA 1YB4A 3DXFA 4RLSA 3H5AA 4CM8A 4BKRA 3R3JA 5TSDA 3DTTA 1TT5A 4R4JA 2GN9A 4QECA 4D3DA 4Y9DA 4L4XA 3ZWXA 4QEDA 4Z3DA 4GWKA 3TJRA 5LDHA 3L4SO 4CLDA 4BO8A 1YOVA 4CMHA 5JNLA 1WP4A 3ZDFA 1Q1NA 1DIGA 3NYWA 3ZHYA 3C85A 3S2IA 2VTEA 4CMEC 1DIRA 1KVQA 4GSKA 1HE2A 4XD2A 2C20A 1B8PA 1RM4A 3IC5A 3INTA 4J1NA 1SAYA 4BQRA
chains in the Genus database with same CATH superfamily
3UTDA 3VR4A 2FPGA 3KZNA 3DZIA 3F46A 2JATA 3ITNA 4J0DA 4HRYA 4QC2A 3FNQA 4D6PA 3ZZMA 4OQ4A 2YOHA 1IU9A 1M2WA 2I1QA 3OPYB 4PPYA 4R9RA 5AHXA 4YWJA 3EXFB 5KZMB 1QBGA 4IFIA 1XQXA 3MAJA 5DLQC 2REOA 4ILKA 4X8LA 1S9DA 1SCUB 3JQPA 2GO1A 4ZT2A 2JLUA 2X3YA 4QJ3A 2FKNA 3KKPA 1NXTA 4E5UA 2O6HA 5JS7A 2PT5A 3WL5A 3K5IA 3E1SA 3NTLA 2H8GA 2CCKA 1KIMA 2O0HA 1T9HA 3M83A 3N05A 3V9PA 4K9RA 2OXRA 2IDZA 3C7KA 1G17A 4PQYA 2IV7A 3DAYA 1PR6A 4ARZA 3LP5A 5CB4B 1T4CB 3GVHA 3AY6A 1RJ9B 1H9CA 1WWKA 4IGAA 3UCFA 3C39A 4L76A 4M86A 1MMFB 3YASA 4WKNA 3CNNA 2AKAB 2QNBA 4WD3A 3WYAA 4JI8B 4TKUB 4F9EA 2JGMA 1XQYA 4JITA 3NP9A 1FTWA 4P31A 2WSSA 2ADFA 4DIKA 4YB8A 1TE2A 2N3ZA 3H86A 4NV0A 1KAQA 2G1PA 4Y18A 3HCWA 1JU9A 1QBKC 3BK2A 3G1WA 4HSGA 1Y5RA 4D9HA 1PJ3A 2GNOA 5A4FS 5KJFA 2BZ1A 3R3SA 5EQJB 2X9VA 3T5BA 3AKDA 4KQWA 3L0BA 5CXSA 2EEZA 1J33A 2H18A 1LY1A 3QU9A 4HDSA 2GZSA 1DX6A 2C9ZA 3BX1A 4M7PA 5J59A 5BWCA 2R8XA 3CW8X 4JGIA 4CNQA 2H7VA 3IAEA 3VAAA 1EGVB 1K4KA 3CO5A 5HGXA 4X62B 2RH4A 3A10A 5DOVA 4AUEA 1KY3A 2O8FB 5IWAB 3JYLA 2G4CA 3ENVA 2QE7D 2VHQA 2XPCA 4I9HA 4M7RA 3RJZA 4WX2B 3ZVRA 3ZCTA 1SELA 2PZEA 1Y8RA 2EU8A 3KSZO 4EHDA 1GU1A 1LTHR 3LQRA 5JTUA 3D8TA 3TLEA 4QWWA 3L8DA 2MR5A 4B7AA 1ISFA 3QF7A 2OD9A 4AJNA 2A0YA 5GOTA 1E96A 4M0LA 4B7XA 2OGZA 3BRWD 4DWVA 2WA1A 4C1NA 5DNUA 5B2FA 2CL7X 1FXUA 4PRZA 2VCHA 3H9GA 3SIXA 4ZVTA 2NWQA 2HPZA 3H04A 3ND5A 4RIIA 1RLJA 3LQFA 5HUHA 4A2CA 5I4IA 2B1GA 3LUKA 4IWXA 1CRPA 2JAPA 3GCGA 3U4CA 1ECGA 2ZJ0A 2VXYA 4K46A 5DBEX 3VX4A 7MDHA 1QANA 3W4KA 1VSTA 3TD9A 5IAOA 2XE8A 1CQJB 1JYEA 4YH1A 1NT4A 5AJUA 4UAUA 1VRWA 3E9QA 3I09A 3TLYA 4CF7A 2VTVA 4GLOA 2HFJA 1P9OA 4UFNA 4D57A 4M53A 1T1JA 1QTIA 1H6AA 4Y0AA 1XKTA 2VG8A 5L6MB 3K70B 2WSYB 1E2EA 3H5VA 4EPVA 2XAUA 4ECEA 2C77A 2ROQA 2CXXA 4MX8A 4D0GA 4EPWA 4HGNA 1HRDA 1N8TA 3TMYA 2WTMA 1UFRA 1AB6A 1DCTA 1OJ7A 4D25A 3B6ZA 5ILOA 1Q5PA 2PT9A 1W30A 3UPDA 4MYUA 1KPHA 3BH7A 1U3GA 2HMUA 4MWTA 5BNZA 1MRZA 1OYOA 2AZDA 4FFNA 4YREA 2Q1YA 3D0RA 3WZMA 2HA6A 1SZDA 3A9RA 2J9ZB 4MPDA 3B8EA 3KZOA 4RPHA 1PV2A 3OWOA 3VI4B 2CMDA 4MYSA 2D1YA 3DO6A 2B99A 3AEXA 2GF9A 3KSRA 2VJQA 4RX1A 1TZ2A 1BROA 2X5XA 2P9EA 4JELA 1X2EA 2FPPA 3OZGA 1VG9B 3TBKA 3QU2A 1N2CB 2BCEA 1CFJA 4EKDA 2PLFA 4UHEA 4QRIA 4AUNA 4HGOA 3MS2A 3V7FA 5LL6P 1SKBA 2D8AA 9ATCA 2PWYA 2A1UA 4FMCF 4NZZA 5D6NA 4Z0HO 421PA 4DC1A 1MGOA 5JPCA 4S0XA 3TW8B 4HFMA 4WJLA 4ZCRA 2A2ZA 3CC8A 1C7QA 2Q7OE 2D5IA 1XZCA 1E1MA 3AHGA 4KN9S 4UNNA 3FVWA 5F3RA 3T5AA 1FFYA 2FRXA 1X1SA 2QYOA 3ESXA 4ZHQB 1XNQB 1FFCA 1T24A 4YPOA 3PQCA 3BHMA 4ANFA 5JFGA 4JC8A 1L4KA 3EJ6A 1PGNA 1F51E 4Z2YA 1XYVA 2J5KA 5CEEA 1KU6A 5K6AC 2QGNA 1C0LA 2GN0A 4TWJA 3RS0A 2YQZA 1HC7A 4DRZA 3TVYA 5ADWA 5HUJA 1IUNA 1PZNA 5AR1A 2OHXA 2ZB4A 1VA5A 1S2LA 3RB8A 1KIFA 8AT1A 4GPD1 4BBZA 1NI4B 1RLTA 2ZRNA 4KDRA 5FCDA 4OHXA 4FWTA 3E53A 1U5BB 1ISIA 3TIXB 5JXIA 5EC8A 3IP1A 4HJXA 3OI7A 1DTEA 2FETA 4PLVA 3QJYA 3BQNB 3WGUA 3EGCA 4RS3A 2B8JA 3I30X 2G72A 1TJNA 3AEYA 5DNVA 1I3MA 2ODNA 3MOIA 5KNDH 2GHIA 3M6UA 1DO2A 1Y4DE 3Q5DA 3Q7QA 5ARBA 5KNCH 3OJ0A 1TM4E 2PMKA 3I72A 3ZX4A 1NQVA 5FI0B 5C51B 1JG7A 2FQXA 3I53A 3GMSA 1H2FA 1TFUA 2ZWVA 3QU5A 4IZHA 4R9NA 2XEDA 4BJ3A 1JLLB 4RA9A 4UE2A 3OESA 1UFVA 2E5FA 5A4JA 1YZFA 1T6YA 3IXMA 4HQNA 4JR2A 3TZBA 3U4HA 3AKEA 3V42A 5FWXB 2E4ZA 4QGFA 4K6OA 3PXDA 3TDKA 2XB2A 3ZI7A 4HX2A 4MV9A 5E2IA 1QWOA 2I3BA 2NM0A 5K1ZA 4C22A 4WLOA 2OYRA 3TQOA 1I2DA 1V48A 5TPZA 2RBEA 1CIJA 1G291 5B1SA 3CYFA 3V4RA 1R8QA 3BPSA 2H63A 2SBTA 3IVRA 1M6VA 5A62A 3WFJA 2W4QA 3B7WA 3SJ7A 4BZQA 4ZV4A 3ZS8A 4KH1A 1YI1A 1V16A 3KFXA 5CCDA 4C20A 3EGIA 2IXAA 2ZE8A 4HI0E 5B58T 2PSDA 5ERGB 4EA7A 2IW3A 1VE3A 5K20A 1E3WA 1P2FA 2XYQA 3IS3A 1I4EB 5AVOA 3RK4A 1IE3A 2VC2B 3EE6A 4HFRA 4D3FA 4F4IA 3GJ8A 4E30A 1YS7A 1WPRA 3F5FA 2XDWA 3EDMA 4PCLA 3TBFA 1Y42X 3H5WA 1H93A 3DCIA 2VOJA 1ECCA 1NMZA 4AJIA 5ECDA 5TMBA 2A58A 3KAQA 3P4XA 1KMCA 1J7JA 5ALLA 1L5LA 2XTAA 2Z5VA 2HJWA 5JEDA 2I3AA 5HUQA 5IMBA 1CRQA 1KEPA 1R0WA 4U3JA 2REBA 1TL7C 4MUXA 1FSZA 4Q39A 5HF9A 1N9KA 3S68A 3GFOA 5CFNA 1VKJA 2BIFA 3RO7A 5GIPE 1BQ4A 1WJGA 3NH6A 2F1OA 1JECA 2HLPA 2XUOA 3SHVA 1G8FA 2PVCA 4H4EA 3BHJA 3PQ3A 3CLUD 1D8TA 1LBEA 4H3VA 5EP4A 4B6SA 4C4TA 3MGGA 5IYZA 2B8WA 4LRWA 1QRDA 4IJKA 1QOQB 5AJXA 5DRYA 1ZH6A 2A9PA 3TQFA 1OXXK 1ZAYA 1G2OA 1P1KA 5KPJA 1E66A 4NBRA 3R7WA 1I7QB 4X6UA 2BFFA 1MW8X 3E3LA 4JODA 1CQXA 1XD8A 5TJ9A 1FDTA 1W44A 3QYJA 4K3UA 4PHTA 3G1TA 5BN3A 2GM5A 4II7A 4LE2A 5EP3A 1KFCB 1QO9A 3I83A 3HFGA 4ZYYA 1L5MA 3AHDA 4UU8A 4HC4A 3VNQA 2CZGA 5KWSA 4C7OB 5T4FA 1VJCA 5C7YA 2YZMA 2QGFA 3NBKA 1T25A 3QVWA 4CI9A 5FWXA 4F12A 1A2KC 5FEMA 1DIAA 2EKZA 4QYMA 3STVA 2AUTA 5JY1A 2IH2A 1ENZA 3QFRA 4EF4A 1VYTA 2WU3A 2H6EA 5F1PA 4UUNA 2YFKA 5IX8A 2AOTA 1BS1A 5ED0A 4D43A 4DSZA 3JW8A 1Q0HA 3V8VA 2DKFA 1IXYA 2XA1A 3EIXA 4E4TA 1UEIA 3WNCA 2ZUEA 4L5BA 2YS7A 2ZKLA 2QN8A 1SVNA 1ZL2A 1NR7A 3WL4A 1DTWA 1YZGA 2IYYA 1GPJA 4QL3A 1C1HA 1HSZA 2C1ZA 1JPNA 3A1WA 3ZKAA 1SM4A 1U2GA 2AW3A 2ZAMA 1ATIA 3JV7A 2ATIA 1GL6A 2PSJA 2A35A 2I4TA 4J1SA 4PO1A 4UATA 5DK6A 2GLUA 4XYBA 3WHPA 5DWDA 4N5NA 1MP0A 4D98A 4EG5A 4B6OA 4RKYA 3MJCA 2OBMA 5LBUA 1Q1EA 4D4LA 1JEOA 1P62B 2JI9A 1EWQA 4R51A 4P4SB 4INAA 4OJTA 3SC3A 4CQJA 1NBHA 1SO8A 5AVWA 1STOA 4C0LA 5BUCA 2H4HA 2PS3A 3M9WA 3HO8A 3T7DA 4CKEB 3DBRA 1I3OA 1YE8A 3RVLA 3U4IA 2XMQA 3R3ZA 3B82A 1Z7GA 4HQOA 2J9YB 3Q88A 5K4GA 2QY9A 4Y2SA 5CBPB 4HDKA 2QLJA 4RPGA 3KYCB 1IEVA 3OPVA 3FSRA 1H4SA 2HW8A 1XP5A 1TK3A 1G7SA 4WCFA 1QHSA 1SIWA 1JW9B 1PGPA 3BGOS 1PJBA 2EFEB 3CEMA 3Q3HA 3W2FA 4BZWA 1KZ1A 3WHLA 4QKQA 2HA5A 3BL5A 3CZ4A 3HPQA 1TKBA 2BFPA 1V9CA 1Q1GA 2YNMD 3L92A 4BO6A 1W4BA 2OLKA 3ZJYA 2WJYA 2XWQA 4YCMA 4AI6A 4I36A 3U7FB 1V6SA 3BCSA 3PE6A 2ZYGA 3JQGB 4UUQA 3GZ4A 5F1YA 3B9BA 4FD2A 5HOEA 2XRYA 2W6OA 4WXYB 4LYFA 1I0IA 4ZK2A 5LNK1 1FNSA 3ACCA 3R0VA 4LY3A 1QE5A 1AKQA 2EYQA 2HHAA 2X6TA 4WXMA 2AFHB 2GFQA 4L5AA 1VCNA 2C0QA 2QQFA 3G85A 1JLHA 3NHSA 4F6CA 1RT9A 2I2BA 2O20A 5JH7B 2V6JA 4CR7A 4XWAA 3VJLA 3ZYZA 4EITA 3LJKA 4L4ZA 1YKFA 1GKKA 2ZU6A 1L8QA 3JVEA 1QDUA 2F8MA 5TIIA 5C31A 1Y7PA 1RRMA 2UDPA 4V39A 2CVOA 3J7AC 2VNSA 3W8NA 4PHCA 3VJKA 4RF3A 1J70A 5KTNA 1GRCA 4TWZA 3R5XA 3KHSA 3OLVA 3ZY4A 1DX9A 3BJRA 4OLJA 3NCHA 1T3GA 4ND2A 4H7PA 2KYRA 4D0NA 4JJKA 4GE3A 5CG1A 3I9KA 1BEZA 4OXKA 1L6IA 2WT8A 4TXHA 3KWJA 3D1LA 2VJYA 1EH5A 1IULA 4DMGA 3KZXA 5IRCD 3DDWA 2ID4A 2RKOA 1DS6A 3ENZA 2O2JA 3ZWYA 1JPJA 1K5DA 3GGCA 4LXUA 4G6ZA 3LKVA 1Z4NA 4NE2A 4W7SA 5GONA 4YQEA 3CUUA 2R6CA 1L7EA 1FW8A 3GVPA 3UBTA 5F2OA 4A26A 3PQ2A 1SJ9A 4B34A 1IDN1 4F84A 1AMOA 1JQ5A 5DZSA 4YXWD 4HDMA 3SXPA 3TXXA 5BNTA 6AT1A 3ZBPA 1BCSB 1U3DA 4DBVO 4N3AA 4QDKA 1E20A 2PRKA 2B6HA 3AHFA 3HFRA 4MVJM 4YRPA 3UV3A 2WM3A 4BVKA 3RSOA 1VJ0A 2JA1A 1JEEA 2BD0A 2FYTA 2PRZA 4WNIA 4A0FA 2HKIA 4JB3A 4YO8A 1FFEA 1U3FA 1UC9A 3B1WA 1JPUA 3VU3A 1LRKA 3WMEA 2BONA 4BMNA 1OR8A 3VNRA 4Z2AA 1LC3A 1P1BA 3T7AA 3BWCA 3VO2A 3HUUA 4AKGA 3SR4A 1SBZA 3A31A 1GGNA 1CF2O 1I5OA 2ZRDA 4A0HA 5A02A 3CLRC 3B1VA 4REQB 3Q8XB 4LGYA 1CJMA 5HDQA 1F8YA 2WIDA 2Y3IA 3KTOA 4P5PA 1HT1E 4FCVA 3C3XA 3ZI4A 1XLTC 1VM6A 5K3OA 3FIUA 4OGKA 4ZCPA 3ONNA 2JFVA 2GJKA 1BDMA 4IIYA 1QCDA 4I4TF 10MHA 2XQJA 2FZLA 1D2MA 2DHRA 3B3QA 4GVLA 4OAQA 5DTRA 2FMUA 2P6MA 2OUKA 2V7BA 2XGMA 2QTVB 3K73O 1JI3A 3P0HA 2XT9A 4BP8A 1RAFA 1T8PA 1UDWA 3QE2A 4PQEA 4HAXA 5D5PA 4Z3OA 3EF3A 4PCUA 2YXLA 5L7YA 1C8LA 2PKWA 1DBIA 2YS6A 1XDWA 1VE9A 2ORYA 4XLLA 3DPUA 1RKQA 2QRZA 4G8BA 3ZDDA 2QTNA 2IH4A 1H9BA 4WZAE 4LDAA 3D8UA 2XVAA 3JD1A 3HVKA 1E2HA 1ZI8A 3IERA 1QIKA 4M9SA 4OBBA 1V41E 4BVGA 3BB4A 2O57A 3KP1A 2XWPA 5CGZA 3VSCA 4RFVA 1DDIA 4EJ0A 3LLCA 1I8TA 3RFUA 2CXNA 3KXKA 3LLUA 3GZTB 1G8SA 2A0WA 2BSQA 1W6RA 1M10A 1SCUA 1H94A 4DYDA 4EPRA 1PV4A 2IYNA 4K8RB 2IUYA 4CL8A 4ALMA 5ESDA 3NW9A 2UVQA 1TUIA 2DG2A 1JIVA 4O2BF 2NVWA 4PZPA 2G6TA 3TOCA 3PPWA 2PIDA 3HTXA 5CPFA 1OHHD 2O7VA 4JL6A 1V8BA 4TMKA 3ZTYA 4DAOA 2OR3A 4OP2A 3VNAA 2Q5IA 4M36A 2Z30A 4QQNA 4NWIA 2QENA 3RBZA 2BEVB 4JLKA 3UHJA 2EWVA 1TMKA 1U0JA 5JW6A 5YASA 1KL7A 3DLBA 3GLVA 5J9FA 1Z15A 5G1PA 1FVHA 2Q9BA 3MJSA 4BLWA 2EZ4A 3EGEA 4M3NA 3OJXA 3OU6A 3CW9A 1E77A 4DCTA 3TQIA 4LY9A 3K2BA 3CTPA 3L0CA 2JFPA 3VKHA 1KP2A 4MCAA 3QJGA 3USZA 2VQ3A 4IW3B 3WNVA 1C3EA 3QWHA 4BMOB 4CT0A 2YZGA 2WUFA 3KLBA 4BNYA 2Q5OA 1NVFA 4KWIA 2PGAA 4EYEA 1MVNA 4N47A 4BVBA 1C7RA 2OD2A 1SB9A 2BJWA 3A1TA 2JVKA 1CY7A 3LSYA 4V0QA 4KO1S 5ALOA 3REGA 3HXTA 4OAOA 1CW2B 3JQ7B 4U5QA 4ESVA 2GM3A 2DSTA 4YALA 4KNYA 5EIHA 4DB2A 1PR2A 1U0NA 3U61B 3KCNA 4IO0A 2ZI9A 2B36A 4MEJA 5EXDA 3RASA 3KJZA 1N92A 4MI3A 4F4JA 2ZS9A 4QFCA 3UA4A 1BDJA 1J06A 1G21E 3WGJA 3WB0A 4C0XA 1W5AA 1XD2A 5JHGB 4LWQA 3CO0S 3DF7A 4HEA1 5C2JB 4RAQA 4RMJA 2P75A 4A8TA 2W2LD 5IVPA 2O7SA 3JXEA 2BBOA 3KSUA 2P5SA 1X1DA 3DWIA 5AW5A 1QJ4A 1KE1A 4OHBA 3H65A 3TS1A 4XVUA 4UDXX 4N6NA 1T1GA 4PLTA 2V7UA 5EHZA 1G5HA 1ZY2A 4CN8A 5LJIA 1W4RA 1YSCA 2BKEA 2FWIA 1SCIA 3F49S 5A4KA 2AN4A 4UM9B 1P0FA 2XXBA 5C8XA 5K3CA 1VIAA 1UC4B 2I9KA 4ZAFA 2QVXX 3KB1A 1OBVA 1TGVA 4AIIA 4C78A 2FA9A 1C2YA 3K5HA 1L1FA 3WJ7A 1Z25A 2YV4A 5I48A 5ISMA 4HEHA 1EWTA 1KPIA 3ISTA 3KM0A 3W8RA 2YL2A 1OWLA 2F1IA 3K53A 1ODIA 2XOEA 3CF2A 3IMKA 5EZ6B 3WGYA 1SKYE 1TKAA 2Z4SA 3LF1A 4UCXA 1QF7A 4FCTA 5M34A 1EB9A 1RAEA 1Z6TA 1M5RA 1GPAA 5G0TA 4E94A 2DHCA 2YZKA 4O1MA 4P34A 2HPVA 2J6BA 2J32A 2JFOA 4TL9A 4TSFD 1CD5A 2CXHA 4WXPA 3RT7A 1VI6A 3BGDA 1MQSA 2R1TB 3A6DA 1U6JA 3BQ9A 4PC1A 1J5XA 4N3NA 4TYQA 5TQ2A 4ENVA 2VSFA 4DLZA 4OHYA 2ATXA 1EK6A 1V4VA 3STTA 2E7ZA 4A5OA 4BO5A 4TZTA 4HTFA 4PICA 3C3DA 4RY9A 3MJRA 3EGXB 1LLFA 4BPRA 4N3CA 3K6SB 1OIWA 5KB3A 5I9TA 1Z6PA 2Q1UA 4KVZA 4ZQIA 4MIKA 1OYVA 1MDBA 2AG5A 4NOJA 4Z8XA 4P4LA 2HQBA 1P29A 4AKSA 4O59O 3PNLA 4RSMA 3UYLA 4PSVA 5AUNB 5BRNA 5LLSA 3OSZA 2PGDA 1EJ6A 1XMIA 2F9FA 5LSAA 2GI4A 3SF0A 3CMCO 3L18A 1Y34E 2CN1A 5F7OA 1SA0B 3SDSA 1JXAA 2WJVA 1Y4SA 2RGAA 5E8JA 1KGDA 4ZDWA 4KVFA 4GC9A 4LRTB 2CLEB 5EZ5A 2YJ6A 1YTLA 3PCTA 3VPGA 2WC1A 3X1JA 2RHJA 1DAPA 4C3ZA 1KTIA 4DRXA 2GCGA 4JLSA 4UHHA 2OXFA 3DL0A 2YY6A 3FHLA 4I1SA 4TLMB 3OETA 1BDIA 3PXUA 3JVIA 2KBFA 1N2GA 4HWPA 4R8MA 3G79A 1EK2A 5KYGA 2IUFA 2OWEA 5FKJA 2FU5C 1CJSA 1RYEA 2AR0A 4D45A 5BVHA 2JAUA 3SJUA 3OPYA 4UNIA 6REQA 1K8YB 3LI2A 3S5JA 3I01M 1MOSA 3IQXA 3K0CA 5F73A 4HNUA 2GZ2A 2JIZA 3TRIA 1CRWG 1V0JA 2ZU0C 4FHCA 4QDOA 5JTTA 3CONA 1ONPA 5HJ5A 3DULA 1ZQ1A 4M87A 1LPMA 2A3NA 2C5HA 1JI0A 2GGSA 4FYVA 1Z28A 5E6SA 4BRWA 1EM8B 2P30A 4NYMR 5EXSA 4YPFA 4ED9A 2GERA 3D4LA 5EOVA 1WZUA 5JRZA 2B1IA 2AXNA 4TUYF 5BXQC 2M1XA 4JZYA 1NJ6A 5DU2A 3V6MA 2QQ0A 1LC0A 2CLFB 3FZEA 3OM8A 4LTNA 1Y6JA 2F3RA 2PWBA 2JAOA 1OWNA 2H1RA 1K9SA 2XVYA 2XR1A 5HIJA 4DRXB 2HIMA 1Z29A 4TVBA 3PFWO 3NS7A 3OKFA 4RE5A 2VH2A 3V1NA 1T3TA 1FNNA 2JAWA 3E9YA 1BWRA 3CF4A 4RDCA 3D3WB 2QU7A 5AH0A 3UWOA 3VC2A 3KRTA 1N2HA 1W49A 1WV0A 1UADA 3NX4A 2XRZA 4UMDA 3S4YA 3VOSA 3AVWA 5AVJA 5C18A 2OHJA 1UJCA 1G2IA 3B8HA 2GCEA 3CG0A 4QUBA 1WXWA 3QYAA 5E2BA 4CCYA 4ID3A 2Y67A 4R5HA 2Q1WA 5BOVA 2WZCA 2Z08A 2X9LA 3GRRA 4BO1A 4DJ5X 1HK7A 3B1XA 4Q3NA 4AULA 1XEXB 2VOEA 4OP3A 3PX3A 3S28A 4QT4A 3GWGA 4HNVA 3BUSA 1B00A 3SP1A 4J43A 5JASA 2VQSA 3TRFA 2WYHA 3H5IA 4YECA 1AH2A 2BAGA 2YOGA 2GH1A 4V2UA 3ZWPA 3OZ7A 2HSWA 1MTOA 4MYTA 2UVPA 1B41A 4JYBA 2V55B 3OM9A 2IBMA 4FK8A 4D9KA 3CWCA 1SBNE 5DT9A 5KNCD 4Y6OA 4GZMA 2QX4A 3AXSA 5EIXA 4EM6A 2OENG 4YACA 3QEOA 2XWJI 3NG1A 3M49A 1HDZA 1AO0A 2DUMA 5JYBA 1A9PA 1QYWA 1J24A 4BCDA 4LGVA 2GXAA 2EG5A 4OX9Y 3U48A 1N8KA 2C7GA 2NO7A 1XZFA 3SQMA 1OXSC 4OVKA 4B3XA 1IWPB 2WHPA 2OVBA 2DR0A 4C30A 5AW3A 2PS0A 1U4SA 3FUWA 4UW9A 3BZUA 3HSYA 4JC5A 4MVJE 3KQSA 2O5RA 1Q11A 2Y99A 3LFTA 2VYND 3HJGA 2FW9A 3T41A 3WKEA 5TS3A 1V6AA 1ZD8A 2W71A 4ND6A 4HB0A 3ZEIA 4A8HA 2RGRA 1YWGO 4JBGA 1V3TA 2JFHA 3EGDA 2MTBA 3DEIA 1CUJA 5EJIA 4DIFA 2QL5A 2CXOA 1C7JA 1NW4A 3TLGB 1HY3A 1P4AA 1J2TA 1LSOA 1KQOA 1P77A 3QKTA 4IY1A 1P2DA 1W85A 3E82A 1A8PA 3MC1A 3VPFA 3GCDA 4HXEB 4WK0B 3UICA 3IDZA 5NLLA 4X6YA 7REQB 1NMXA 1R6AA 4LF8B 2G9ZA 1FL9A 2YKGA 1T36B 2EW8A 1CR2A 1JR2A 1RBMA 3EGXA 1SUSA 2KQUA 4ZT5A 3WLQA 3DSRA 5ICMA 4L16A 3IB3A 3VNSA 2IY9A 3PSHA 5DM60 5K2MA 3D8HA 4N0PA 3W7VA 5LZ2A 1V8FA 4WFIA 4HDCA 2KB0A 3ZCUA 2NU6B 2AWOA 4G56A 5ICCA 3AETA 1S4MA 1DAFA 4MWGA 3S1AA 3FXAA 3K1AA 4ZZIA 2FXVA 2XJ4A 1PHRA 3EW9A 2X3UA 5LDDC 4M89A 2VKTA 3GLGB 2BRUA 4ND4A 3V7WA 1T4GA 3OHMA 1Q15A 2XYHA 2QRGA 4IZ6A 4FYWA 3TCKA 3AWIA 3PL1A 4HS9A 5JQGA 4MDFA 3S3TA 1NR1A 2UVPB 1KC1A 5LUAA 4PZUA 2BFBB 2O3SA 4RJKA 5I4CA 2BUBA 1KAHA 3WMRA 4IF6A 2XCLA 4CGYA 1OOEA 1NIJA 1UM9A 2PGNA 4ZDKA 1QDLB 3WRYC 1FP1D 2HWUA 2GPAA 2B98A 4RL4A 4R1OA 2BE9A 4C14A 4E4RA 2R00C 2D5CA 2NO4A 3IQFA 3WRWA 1NWHA 1NRIA 3ONFA 3OZFA 2D0IA 5CEJA 3QV1A 3IJEB 4O8ZA 1KZ6A 3H2YA 1MC8A 5HZHA 5DYYA 4BX8A 9GPBA 2BHSA 4LSWA 4AWXA 1AKWA 4DCCA 3F5SA 1X74A 4YCCA 2QNIA 4A8JA 2P9BA 3WNQA 4E07A 4QM6A 4DILA 3LE8A 5AW0A 4BNTA 1XD2B 2HNAA 4TYPA 3UQZA 1Q1BA 1R1DA 3ZZUA 1ENOA 1KFBB 2AN5A 4MKZA 2QXTA 3U5ZB 1JR3E 4NATA 3HBLA 2XVXA 1J2JA 3TJZA 1IN7A 1TZBA 5HQTA 2INGX 2IKSA 2HGZA 3RIHA 2QAGA 5EMNA 2C88A 4LKOA 4BGIA 4KB5A 1H05A 1XAIA 3N2IA 3O2QB 2RI1A 1L7NA 4V0RA 4BMXA 2W6ZA 1CZUA 3A7EA 3FPEA 1W19A 2NT3A 1TIKA 2NU9B 4MB0A 1G9XA 4AJLA 3JQAA 2I71A 4BC1A 2HZ7A 7YASA 2R9VA 3MT7A 3IUEA 4QGBA 3H4MA 3OTHA 3WYFA 5A5FA 1J5EB 3M33A 3L0SA 2E37A 1TMOA 1HFKA 1NKTA 3IR7A 3JSXA 1FS6A 5DNWA 4NEQA 1D2GA 2H1IA 2ID7A 3UYKA 5FDFA 2WYIA 2HMSA 1M8GA 5KOHA 1JP7A 4RC9A 1NL3A 1BHJA 1J97A 3FKQA 1AKVA 1KA9H 2CDAA 4LCEA 3LCCA 2D6FA 4M83A 4R2XA 3VAZA 3GC6A 1R4MA 5AHRA 1DWUA 3EX7C 3OT4A 3QX3A 3D5QA 3KJHA 5BV7A 3PDCA 4MRRA 2M6KA 4RK6A 5AW2A 1YAHA 2FW7A 3RSZA 2O59A 2VTBB 4G4JA 4CLEA 2CNOA 2C54A 4M55A 4QUEA 3TH5A 2H2FA 1P2TA 2Y2UA 3S8EA 3ICCA 3FLMA 2BFEB 3SC2B 1LPNA 4G0YA 5HTOA 3RRBA 1KI8A 1R4NA 1N3YA 3CKYA 4RKRA 5LQAA 5LU8A 3ERCA 4PC2A 1II8B 3HKBA 3GVXA 1C1XA 3I0MA 5EYPA 1UJ6A 1UZMA 4FINA 2YJNA 4FYJA 4FDAA 1E2QA 3FVVA 1F38A 1UKVY 2MMCA 3G0BA 4LZOA 1YCHA 5AKYA 3KOWA 1NXWA 4J07A 5D3MB 3A6LA 1Z22A 2Q2VA 3VR0A 1JR3D 1QZTA 4QTUB 2CV1A 1ZJYA 3IYLW 1NNLA 2AI3A 3FG9A 1D4FA 1GT6A 2A57A 3UOAB 3WHIA 5KWVA 2R3SA 2AOVA 3H8VA 4HBGA 4IIBA 3U31A 2O2DA 4DC9A 3F1KA 3C16C 1U8TA 2XUPA 4GE0A 3WTBA 4BEBA 5LOVA 1EFPB 3QBDA 3REFA 3W1WA 2GLTA 2QGZA 3X0DA 1XLVA 4WW0A 1AZLA 1E1YA 1WX1A 1Z0IA 3DWFA 4AYWA 2FPSA 1PJ4A 4J75A 1YZNA 1MOQA 3WB1A 2WLTA 4UE6A 4DUYB 1Y89A 1B1AA 2IZ0A 3RKUA 2XNDD 1ZOSA 4JROA 4KR0A 1RS0A 1QS0B 1BTOA 1P2BA 2XKBA 3CLSD 3KDAA 1E8DA 2HRCA 3D3WA 5F2KA 3SYMA 4BU0A 5CT4A 4ITUA 3K94A 4YJ2A 1J09A 1QKJA 3V1LA 5JZSA 2WKQA 1PWEA 1Z74A 3E03A 1CJVC 4RO0A 4XSHA 3SXUA 4KITB 3HK2A 2RGUA 1U8FO 3N6RA 2BSAA 2GVZC 4FOTA 4LJ6A 4DV3B 4MRSA 3ZD9A 1YD7A 4TLAA 3TFQA 5LQKA 1OJLA 4HS4A 4QJ4A 5A0FA 3TW8A 3KTAB 5DULA 1EFDN 2G5PA 4YNBA 1NA5A 4RH0A 4LZNA 4ZI3A 2BM0A 4PXSA 4NXNB 1IN6A 4KFCA 3K1JA 1E0SA 3AFNA 5BVGA 1E9SA 3KVYA 5C9ZA 2P6NA 3HJFA 3KLNA 1VG0B 2BISA 4B4OA 3DD5A 3M6WA 3HRHA 2IXTA 3FIJA 1YL5A 2V9CA 1EG7A 4JEMA 1JHAA 3BWEA 1TA4A 2OCDA 4ISBA 5B4TA 1TTTA 5DTIA 4RPLA 3IBYA 1Z56C 4MP8A 1FJ2A 3JATB 3WK5A 3U1BA 1F0PA 1T1IA 1ST3A 4RTPA 3RJ9A 2YXNA 5DX8A 3Q9UA 3FOAA 4PFSA 1XMVA 4X8HA 1JG3A 3R0QA 5KSOA 5B64A 3NTQA 4TTJA 5K0SA 2R84A 2WWGA 4QBFA 3RYIB 2Z8XA 2VBCA 3CQ9A 4J4HA 4EBBA 5E8RA 2H4FA 5LXTA 2ZSKA 3PEVA 4XGNA 1MV8A 1WF3A 4FYMA 5CYFA 4YJGA 1OQAA 3TLXA 4WERA 5T41A 2A5FA 4PSKA 1K8RA 2HRQA 2JBAA 4MMZB 1NV8A 2HL6A 2PV7A 2QRMA 4PBTA 1EB8A 2Y77A 2Z43A 2ZDHA 1RQ2A 3CT4A 3Q6NA 1OB5A 2AIRA 3S2GA 3NVKI 3ZV5A 2WOJA 5TV2A 1MXHA 4ARCA 2E1RA 5CA0A 2IHNA 2Q6OA 3BGIA 4LJLA 3CRMA 1JJ7A 2XOXA 3MILA 4DIDA 1VPVA 1DIHA 2QK4A 3K8OE 3LVRE 3O2JA 1A8UA 4YHBA 2X2PA 3TNJA 3V4VB 5JV5A 3OTWA 3ANLA 2GPBA 3Q7RA 1P6XA 1RMQA 3S29A 2IBTA 3ENKA 4P22A 1E59A 3IDFA 3L93A 5ENDA 1YUMA 3I3SR 1PUJA 1MT0A 4AN1A 4EDFA 5SYNA 5B3KA 3FOFC 1R9JA 2WWYA 5I4KA 5FBKA 1TTQB 1BZYA 4W7HA 1NVGA 2XMCA 1H1TA 4JCCA 4CUZA 3RQSA 2PDAA 1T9CA 3WDLA 5TT0A 4EUKA 1W46A 2R6DA 4KPYA 2O4UX 1NE2A 4IFTA 2NSJA 4XWKA 1X1BA 4DNOA 1CIPA 2F1JA 5EJ8A 4YDSA 3OO1A 4ZQCB 1SOWA 2G88A 4S1NA 3UUFA 1DRJA 1EPUA 2Z6QA 3TN7A 2C5BA 4KGXA 4PSDA 3C41J 3VH3A 3HADA 2VH5R 4UMEA 4F4UA 3KQUA 3F4KA 1HNXB 2FEXA 5BW5A 4MV6A 5J58A 4G63A 1VLJA 2BELA 4LVOA 3ZNQA 5U9CA 2D5BA 3EFHA 1J99A 3T4UA 1VJRA 4JUAA 3K8ZA 1QVRA 4JB8A 5JNVA 6REQB 2IK8A 1ZVMA 3SN6A 3ASVA 2EX1A 4HRVA 5T8KC 3V34A 3TI9A 4GBMA 1IH8A 1OBCA 1CJKC 3I0ZA 3IPXA 1FFXA 2QM3A 4NH4A 1C4OA 2J3QA 4OQDA 2GHRA 5U4QA 3WI7A 2YN0A 1EJ0A 1RRGA 1W85B 3EQ9A 1B2LA 1VL1A 1QFXA 2EFHB 3AP1A 2FVXA 4RVCA 3A4TA 4CU2A 4R98A 1NX9A 3L1UA 3GOHA 3P9IA 4FT2A 3GJRA 4FEYA 5JATA 1SEPA 1T4DA 4ZGWA 1GTG1 5GAJA 2LKDA 4B85A 2I8AA 4MPPA 3TQSA 4DCUA 4B46A 1PJ8A 4AVYA 4N7RA 2P2CA 3Q40A 3K7EA 2O7QA 1NY6A 4I3FA 1PEAA 4FB5A 3SHWA 1RLOA 3HNOA 3OH8A 4UULA 5HS4A 5EJ4A 1KEZA 4IIDA 4V0KA 3EC1A 3IOYA 1WHTA 1K4YA 2EKBA 1TYBE 2VN8A 3T3GA 3MTEA 5KTSA 3OY7A 1IEWA 3OOJA 3FRIA 1KAEA 1JDUA 1P0MA 3GROA 4NF2A 4TYNA 1KVSA 1U2SA 4KU4A 1OPRA 2C7PA 4LMAA 2HGSA 3CEPB 1KK0A 3A9UA 4QUKA 1T8RA 3PC2A 3EEBA 4REQA 3NBFA 2PFGA 2CVHA 1GAJA 5KTKA 4WLVA 2Q4TA 3WL3A 1LFAA 1O57A 2IEGA 5ILQA 2UXDB 3IB6A 4LZPA 4RNDB 3QKSA 4KE9A 4RV9A 2E48A 2CJXA 1GGKA 2CYAA 4QNNA 4U7GA 2PFSA 2Y4OA 1BMTA 4KQXA 5I01A 2DSNA 4JP1A 4KAFA 2QU8A 3AESA 4DSTA 1KSFX 4RSHA 1ESDA 3D7SA 4JSTA 5DWQA 5EJ9A 3AVYA 1O6BA 3X1ZA 4KQ2A 1ODJA 2PKXA 3KVNA 3N53A 3NALA 3ZY6A 2GTPA 3GV0A 3L1HA 1TADA 2CF6A 5KYTA 2BFFB 3LCUA 1CV2A 2IC5A 1YR2A 3WRXC 2YV2A 3QMVA 1YNOA 4NI5A 5B7QA 3MWJA 1Q20A 1WSBA 5JQGB 4OQLA 2DETA 5SZIA 4JX9A 5CJJA 1REQB 2IEZA 4KRYA 1BVUA 2CZCA 2YNMC 3QBJA 1RWMA 5G2OA 6ABPA 1M1NB 3I62A 3TBHA 2X13A 3MUFA 3EQ2A 4C76A 4DLPA 1ZR2A 3ZZNA 3VU9A 1Z5UA 3B7PA 1FLVA 2CFTA 1K8QA 4C0KA 1YZQA 1L7AA 1NR5A 3PWSA 4NKRA 4FSXA 5K3FA 5EWMA 2JG3A 4FEGA 1RKUA 2YWJA 3MJHA 3U39A 9ABPA 4NDAA 3ZUGA 4JI3B 4IV8A 4DRYA 2J3HA 3DOFA 4C7BA 2IRWA 1E9VA 2OC4A 5CDYA 1EWVA 2PGXA 1M67A 2C9MA 5GINE 1V8DA 3Q2OA 4WESA 1QZ3A 3OIVA 5K0BA 4JUIA 1RJEA 2JJ8A 1SVIA 2QNRA 1QHHA 3K0BA 3CSDA 4JLDA 5AI6A 2W0SA 2YC4C 2O2XA 2TMDA 3AFHA 3IUJA 1PT7A 1TJ4A 4PNEA 3KXIA 4G9BA 4ZAXA 2OV4A 3RFCA 4U4AA 3EEOA 1IHDA 4DABA 1PR4A 2VZLA 4QNMA 2LVBA 3QMMA 5A1JA 4MIOA 3BXOA 1W5BA 2Q6KA 3FNFA 3RFFA 1A7AA 1Q1QA 3KZVA 3LX5A 3AO0B 1VP3A 1EYZA 4QIHA 1Z5VA 3N2NA 3UMSA 1ND5A 2DFDA 1MB2A 2QT0A 2Y1WA 1LDYA 3JWJA 4C7MA 4L5YA 2PUEA 4LBYA 3WICA 3WGTA 1NUUA 3GNLA 2ONJA 1G3RA 1OVMA 2BC9A 2XNDA 3HYSA 3LC0A 4R68A 1KF0A 5FPTA 1KJIA 2GCOA 1LDGA 1ZIYA 4ZU1X 3UC5A 1H2EA 4TGLA 1JAZA 1H22A 1FMTA 2R6ZA 7MHTA 1MVOA 3AJAA 4F5WA 1E3QA 2Z9DA 3V8RA 2ZBQA 1CF4A 2RKWA 3L82B 1BFKA 1DUSA 4JLPA 1ELOA 1ZCAA 4OMDA 4URUR 5K0LA 1LK0A 1ILWA 1TZCA 2F48A 2OZKA 3LRTA 5EIWA 1LA2A 3NV9A 3B5EA 1UQTA 4B6JA 4JAVC 1ORHA 2FFQA 3G9XA 4HGRA 4MGIR 3MHTA 3U4GA 2YY7A 1YCDA 2VJPA 4BNKA 5FWYB 1WTCA 2Q4RA 2YXBA 1GYRA 1XMXA 1QYCA 3GRVA 4Q6BA 1C14A 2X5NA 1HTBA 2C5EA 3L7CA 1QGYA 3OFSA 4MJ7A 3UCXA 1KEEA 2YRWA 4D82A 5I3ZA 1QH9A 1U0SY 2BPOA 1L4BA 5IAKA 1ZINA 3IR5A 2DPHA 5C8ZA 2OSBA 4Y9RA 2FEAA 4BO7A 3PIDA 3PXXA 3O93A 1IOWA 1EFCA 1P19A 1RHRA 3RIMA 4BNGA 4C4ZA 2VO1A 1K3TA 5DT2A 4B79A 1ZPDA 1BE6A 3K0CC 3Q10A 3TPCA 1KNQA 3BBLA 3KB6A 3NORA 3O3NB 4KL8S 2Q41A 4KI7A 1U8AA 2VI5A 1ODSA 4ZI2A 5BN1A 3I5AA 2XB4A 1PQPA 2ZUUA 3EDQA 4GMGA 4LNHA 4UUBA 3I5YA