3QWBA

Crystal structure of saccharomyces cerevisiae zeta-crystallin-like quinone oxidoreductase zta1 complexed with nadph
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
330
structure length
330
Chain Sequence
IPEQQKVILIDEIGGYDVIKYEDYPVPSISEEELLIKNKYTGVNYIESYFRKGIYPCEKPYVLGREASGTVVAKGKGVTNFEVGDQVAYISNSTFAQYSKISSQGPVMKLPKGTSDEELKLYAAGLLQVLTALSFTNEAYHVKKGDYVLLFAAAGGVGLILNQLLKMKGAHTIAVASTDEKLKIAKEYGAEYLINASKEDILRQVLKFTNGKGVDASFDSVGKDTFEISLAALKRKGVFVSFGNASGLIPPFSITRLSPKNITLVRPQLYGYIADPEEWKYYSDEFFGLVNSKKLNIKIYKTYPLRDYRTAAADIESRKTVGKLVLEIPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable quinone oxidoreductase
publication title Structural insights into the cofactor-assisted substrate recognition of yeast quinone oxidoreductase Zta1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 118
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qwbA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3qwbA01
3N74A 4RZHA 2GF2A 3ABIA 3Q2KA 5GY7A 4CUJA 4XKJA 4J3FA 2B35A 3ZDFA 1SZJG 1H9BA 2AXQA 1NASA 1DIGA 1C14A 1FF9A 3WGOA 4BMSA 3KYDA 5L4SA 3IS3A 2CMDA 1CRWG 4BNKA 5JDIA 2HMTA 1MFPA 1R12A 2JAHA 2QZZA 3KVOA 4A7PA 1GUFA 3OEYA 3IAHA 1PWXA 4XB1A 4CMIB 4E32A 1U1IA 2O3TA 1PEDA 3VZPA 2D59A 1ZK4A 4P4NA 3DAFA 4NFSA 3TZKA 1ZW1A 5JMWA 2OBNA 4L73A 4UAGA 1MC5A 3TJRA 5COAA 4QEDA 4AJJA 1CWUA 5C7LO 2QIOA 3OIDA 3GEDA 1T2AA 3COSA 4M8SA 3RROA 1XG5A 2IEDA 3DBLA 3SVTA 4XR9A 4TRRA 2DLDA 3OJ0A 5G4KB 2POQX 2C59A 3M2PA 1H94A 4O1MA 3HZZA 4GX2A 4IJKA 4IDAA 4PGFA 1P77A 3MJ4A 3R3JA 4UREA 1N1GA 3ZU4A 2ZKLA 3CTMA 1C1XA 4BNVA 4CR7A 4F46A 1E7QA 4RLHA 6ADHA 5G4LA 1XR3A 1S7CA 1OMOA 1Z45A 4MJLA 1HYEA 1LQTA 1H6BA 1V0JA 4UEJA 1A71A 4NJMA 2GN9A 5ER9A 1UZMA 5KJCA 4N7RA 3FBTA 4BMVA 2X0NA 2CD9A 4XDYA 4DBVO 3JQAB 2EXXA 4Q3AA 4TRNA 2BH9A 2EGGA 3QHAA 2GYYA 1LLDA 8LDHA 1ISJA 1WZEA 1ZUD1 2P5UA 3L6EA 1MLDA 3MJVA 1KS9A 4OKIA 4CQLB 3I9MA 4Z0HO 2VZ0A 4ILKA 4R41A 4C4OA 1E3WA 2D8AA 2W2LA 3BHIA 1PQUA 3BYZA 3A14A 1ZMOA 1HLPA 1P1JA 4J90A 4XRGA 1OI7A 1Y8RA 3RBXA 1WWKA 4BKRA 4NHEA 1H2HA 1R0KA 1XELA 3FWZA 2PK3A 5DP2A 3K73O 3TRIA 4P8RA 5DOVA 2VWPA 3FNFA 3GNSA 5B12A 4WOJA 1NFQA 3GZNB 1U7TA 3EZLA 3ROMA 3U9LA 4KDEA 3W4JA 4UULA 2GERA 4XB2A 2OHXA 5IZ4A 2BRUA 4XYGA 3ANNA 1LRKA 4Z9YA 5HTOA 2D4AA 3GGOA 4M55A 4MVJE 1LSUA 5KJFA 2BHLA 2FPIA 3GOHA 1NQAO 4FFPA 4QT0A 3ZNQA 4YJGB 4BVAA 4S3MA 4DMMA 1P33A 3EYWA 1GY8A 5HS4A 3F4LA 4XR4A 2Q2WA 3WSVA 2FMUA 4U0JA 5A3VA 3TZQA 4R3WA 2IODA 3GQVA 3SJUA 2JAPA 4IQGA 2BGMA 3WGYA 2BLLA 4OJNA 3RKUA 2PTGA 5U4QA 3R6DA 3ZCXA 2QZ9A 4DC0A 4YJHB 2DFDA 3L07A 4J4HA 1U2GA 4FPXA 4BKOA 4ZRMA 4WCFC 3NGLA 2VQ3A 1UR5A 1EBFA 4CV1A 1BXKA 3DBLB 2WE8A 2WYWA 3DFUA 1I3NA 4YJFB 3WJAA 3UFXA 4G5HA 4RPJA 4RCVA 3VH2A 5JYDA 1ISIA 3VDQA 4IDDA 3WOHA 2EV9A 3PZRA 3C24A 5IJZA 1GQQA 3GNQA 1U3TA 4TZKA 4XGIA 1E6EA 4MP8A 5I8ZA 4E3ZA 4IQ8A 2R2GA 4IJWA 2BMAA 3S2GA 3UICA 2WEKA 4EJMA 5EIOA 2B4TO 1R66A 3AM4A 4UVGA 2I76A 1PS0A 3D7LA 2NM0A 4CLRA 1ULUA 4MVJD 2YV3A 1CYDA 1M2WA 2OGUA 4R1SA 1SCUA 3IKTA 3ON5A 4BGEA 4BNWA 1Y8QB 5TQVA 1NVTA 2UDPA 3K96A 3KHUA 3DZGA 3PGJA 3U49A 4DLLA 3LF2A 2WYVA 1EDZA 3D3WB 4E5NA 1RWBA 2JFGA 1IY8A 3DHYA 4ZQFA 1UP4A 2RH8A 3JD4A 3X2EA 4L76A 2A9FA 2QYTA 3PZBA 5EERA 2P4QA 1JAXA 1PGJA 1JLLA 1NWHA 1HDXA 5EMHA 1H6CA 3DC2A 3T7EA 1E6WA 1LRJA 1HDZA 5L40A 3ONFA 4P4GA 2PD6A 5TRTA 3H65A 1K6IA 1LDNA 3JV7A 5DZSA 1XSEA 4OM8A 3ANMA 4XYLA 3ROKA 4FIZA 4PLVA 3BTUA 3JQBA 4HP8A 3TZ6A 2AG8A 1Q1NA 2Q1WA 5B37A 1ZKMA 2ZQZA 4AJNA 4IUYA 3IP1A 2IDZA 1P3DA 2I66A 1SO8A 2VT3A 3ZGYA 4ND2A 1NXQA 3LK7A 2UUPA 1LSJA 2I3GA 3HE3A 4U8GA 1B8UA 3L6OO 5CP8A 4YDRA 5L4NA 1XDWA 4YR9A 3QY9A 4CL8A 3GDGA 2NSDA 5AXBA 3QVOA 4AFNA 2HSDA 1P45A 5H83A 5BSGA 4PG6A 2GZ2A 5BNIA 1P9LA 2TMGA 2WD7B 1ONNA 5KKCA 3D4OA 4D3DA 1FDSA 1B3BA 3ENNA 1WXDA 3QA9A 5KKAA 3GH3A 2DBZA 5I7FA 5KJ6A 3PQEA 5FI3A 2H6EA 1EFLA 4G65A 5C7OO 3DFZA 2IZ1A 3AJRA 2FZEA 1DFIA 4BNGA 1XEAA 2YDXA 3EY4A 4RL6A 2HU2A 2HRZA 3I4FA 4B7CA 4NBRA 2YZ7A 1XQ1A 2UYYA 4DPMA 1C0LA 1N9GA 4LRSB 1FK8A 2F00A 1IHYA 4PRKA 3VPHA 2XOXA 4M49A 1JKJA 2ZQYA 3RJ5A 4BGVA 3FSRA 4K26A 2XPCA 2WYUA 1F0YA 1ZIDA 3EVTA 4RVUA 2Q1TA 4P4LA 5T8KA 1ID1A 1BDMA 1PWZA 3I6IA 1YOVB 4IZHA 3AI1A 1Y8QA 2X9VA 4I8XA 5A9SB 3UGKA 2X8LA 1DIAA 1PZFA 3ZNNA 1H93A 3INTA 3WGHA 2O3JA 1QYWA 3D3WA 1U3VA 3KM0A 5COBA 5CG2A 1GCUA 1UAYA 4IPTA 5H81A 2QHXA 1KVUA 1PJSA 1LUAA 3I52A 3SLGA 3ZV4A 1OOEA 5DBIA 4L4RA 4DIOA 4XYBA 4EUFA 1DFHA 4CUZA 4A10A 1HSOA 5LC1A 2IRWA 4MIEA 3ZW9A 3B70A 1E7RA 1J4AA 4XYMA 4ZN6A 4EEXA 1E0DA 3M1AA 1JW9B 5A9SA 5ENVA 2J5RA 3BMNA 1ZK0A 1GEEA 3G1UA 4FFRA 4J4BA 3ANLA 1PR9A 3ITKA 5L51A 1E1LA 1NYTA 3LC1O 3V2HA 1DRUA 4OSPA 1ENOA 1UAGA 4CUKA 3LZ6A 1QYCA 3VVBA 4KOAA 4N54A 4A5OA 2WM3A 2YYYA 4CLXA 3C1TA 4YBZA 1YXMA 2B0JA 3DBHA 3I6QA 4TSKA 1VKOA 3U4CA 2AW5A 3W1VA 2WWRA 3WTBA 3BTSA 4C7KA 2ZCVA 3GC6A 4GAEA 2C7VA 4NU5A 3VDRA 2FPPA 1ZVMA 3TQHA 4R01A 4EJ6A 3H2ZA 4YT8A 4L4XA 1Z7EA 1PZHA 3ICPA 4MIOA 4RVDA 2PH5A 4WNCA 1ADCA 2CDCA 4ZU3A 3FD8A 1PL8A 1GCOA 1KEPA 3JQGA 4I5FA 5JS6A 5GZ6A 2A94A 4H15A 4UEKA 3EDMA 3GMSA 1B14A 4ITUA 1IYZA 1M6WA 4CM5A 3OA0A 2BI8A 4J0EA 4UVDA 3UF0A 1XYGA 4E12A 3B1JA 4QUKA 4EUEA 2JHFA 3GT0A 4J16A 4ZQHA 3K5PA 2AE2A 4UEOA 5HBRA 3IL2A 1CDOA 2PR2A 3L6DA 1E3JA 4DQVA 1JWBB 1YL5A 2HDHA 3CPSA 2C5EA 2R00A 4FJ0A 4DRYA 4D0RA 4E0BA 4WLOA 5EQFA 3UW3A 5K6AA 1DPGA 4AJLA 3E82A 4PLHA 1LJ8A 2AHRA 1DBVO 4PZCA 1AXEA 2A35A 2YV2A 4DBZA 1OBFO 4BHTA 2VYVA 2UV8A 1PJ4A 3HJAA 3L9WA 3P5SA 2NACA 4MIYA 5I8WA 3A4VA 3FI9A 4YYZA 2E4AA 3W8FA 9LDBA 2NTVA 1LC0A 2C20A 4CM8A 5BSFA 1EUDA 2PKRA 1GL3A 5L7YA 1XU9A 5A04A 4WLFA 5EQDA 5HWSA 4K28A 5JY1A 4K9DA 1T4DA 5DBFA 3SC6A 2H63A 2I67A 2VUSA 1VL0A 4GX0A 3AW9A 3EMKA 4TKMA 4HFJA 4JCOA 2ZCUA 1ADFA 2FHSA 3K31A 3OM9A 3QJ5A 4WGGA 5ER6A 1ARZA 1TLTA 1J49A 4NQZA 4AJ2A 4B79A 4MKRA 3PJEA 4WK6A 1NM5A 3A9WA 1A7AA 3FNGA 4WEQA 4HUJA 3I9JA 3UVEA 1YKFA 3TF5A 2BF7A 3INGA 1N8KA 2YDYA 1GZ6A 2ET6A 2DUWA 3GAZA 1ADGA 3ZV6A 5JPIA 5DOZA 4BO7A 1C1XB 2B36A 5A1TA 3EHEA 2SCUA 1VJ1A 3DB2A 4OO3A 5KVQA 1D4FA 5ENDA 3U09A 5TSDA 1MXHA 3ETGA 3FR8A 4U7WA 4GLLA 3L4BA 5THQA 3GUYA 3AY6A 1T1RA 3STHA 4R5HA 4PG5A 1KBZA 3D0OA 3IJPA 2HUNA 1NWCA 4DMLA 4BNLA 1ZK1A 2CF5A 3VOSA 1U5CA 3I9NA 4J9UE 4YB8A 3HSKA 3JTMA 4FN4A 1LNQA 1P0CA 4J0FA 1JDJA 2RH4A 4CL3A 1CERA 4WLUA 4D41A 1ZK3A 5T5QA 5CEFA 3V2GA 2IYPA 1FDUA 5ILGA 3ORFA 5C7IO 1HDCA 1PJLA 2JD2A 1RYEA 5JDCC 1UP7A 5HS6A 5C5IA 4E2WA 1IOLA 4EUHA 1FDVA 1NNUA 5BSHA 1K0UA 4R5MA 3G1TA 3OQ6A 4RF3A 1D8AA 3KYBA 3WQSB 4NBWA 2OZPA 4OMUA 3PHLA 4XZ3A 5GZ1A 3AUUA 4YRDA 5CG1A 5FEUA 3PQDA 2NTJA 3RJ9A 4G2NA 1CF2O 5CPFA 1CETA 2EGHA 2EWMA 3DAPA 1U4SA 1QXSA 3HQ4O 4E2ZA 4J1NA 1HXHA 3H3FA 4I9HA 4FB5A 1OFGA 3B1FA 1XA0A 2PKQP 4EGFA 5ITVA 4MKXA 5U9CA 3LC7O 5C37A 2GN4A 2I99A 1HDGO 1V8BA 1U4OA 1DC3A 1CIVA 3ONEA 3RUDA 3WX0A 2VTDA 2I6TA 3OF2A 1GFSA 1YS4A 1QV7A 3OEWA 5HM8A 1DXYA 3WYBA 1E1NA 2I5PO 4YCAA 1O94A 4J1TA 2PGDA 4YEDA 3WGZA 3ZH2A 4WASA 3OSUA 4M54A 1CJCA 1I2ZA 4LCEA 3S2EA 2HK9A 1JQBA 4FC6A 4UVIA 3OP4A 1YL6A 2VT2A 5JO0A 4E21A 2VTEA 1PJ2A 3AOEC 3I5MA 2DQ4A 4M1QA 3WSWA 3FN4A 3GNTA 3MJCA 3GFBA 4NG5A 4RPLA 3FTPA 2WE7A 5BQFA 3ADPA 3NGXA 4HFMA 5IG2A 1XQ6A 4JIGA 3B1KA 1UUFA 1O8CA 3LF1A 4HNGA 1C0KA 4QQRA 3GVPA 2ZB4A 3MEQA 4FFMA 2X4GA 4GLOA 3CMMA 4Q3NA 1I0ZA 2VHWA 3OFSA 5JE8A 3OA2A 2PV7A 4RF2A 5I7EA 1PL7A 2OP0A 3QVTA 5T57A 1YWGO 4FFLA 2Y1FA 5CAEA 3C7CB 1NHWA 3VZQA 1E3EA 1LTHR 1N92A 3OJOA 4TRJA 3V1YA 5A4DA 2R00C 3VC7A 4WCFA 1KEVA 4CQMB 4HKTA 1T24A 2EIHA 3GPIA 3RSHA 4PZDA 4WNIA 4DIBA 2CSUA 5FWNA 2CVOA 2G1UA 1I3KA 4PLZA 3LDHA 4YQYA 2IEBA 3KYDB 3BIOA 3FWNA 4HBGA 5AQ1A 1WDMA 3FBGA 3UOGA 4FOSA 4CMIA 2JL1A 1D1TA 1W73A 3PP8A 4KUEA 3Q3CA 2VRCA 1EEHA 3RBVA 2DKNA 4QFCA 4D45A 1GUYA 2GCGA 4CR6A 5CEEA 1LU9A 4YT5A 4CLDA 1GV0A 1I8TA 4NPCA 3AFMA 5F1PA 1UP6A 2VWHA 1B3RA 2NVUB 4BKPA 4YJFA 3GEMA 5JXWA 1HSZA 5JDIC 3DMTA 1E3SA 3I3OA 1DEHA 3GRPA 1P1IA 5LDHA 3JYPA 5K0ZA 1DHRA 1NR7A 1U2DA 4CMHA 4QFDA 2VZ8A 3VAZA 4J6FA 3FF4A 4QO8A 1DIBA 1SPXA 3L77A 3PPIA 1DJQA 2C82A 2IXAA 3UCXA 1B16A 3SLKA 1YDEA 4NK5A 1ADBA 2Z95A 3ZWCA 4ND4A 3DMYA 2DT5A 3A28A 4RDIA 1ZK2A 3FR7A 1EFKA 1SEPA 2B69A 2EF1A 3EC7A 4B4OA 4JJFA 4XWYA 1J6UA 2Q1UA 1F8FA 1NQOA 5IDXA 1YDWA 3OIFA 1ISGA 3F6YA 4BO5A 4MO2A 3E18A 2JCVA 1BSVA 1E92A 1MFZA 1KVTA 2GDZA 1X0VA 2QRKA 4II3A 4ALLA 3PHIA 1LRLA 5KVSA 3GGPA 1Q7GA 2JCXA 1I01A 2HRBA 2GZ3A 4AICA 3ST7A 4XRRA 3WYEA 1O95A 3BHJA 4IBOA 1JAYA 4RPHA 3TPCA 3ZHYA 3U0BA 1PJBA 1MV8A 5KJEA 2PA3A 1ENYA 4A73A 4CMJA 5KCZA 5KNLA 1T2CA 4CM9D 3BMNB 4YJGA 1SAYA 2X5KO 1A9YA 3DZKA 3KRTA 2BGKA 3OJFA 4CM6A 2YQ5A 1HYHA 5DCWA 3IUPA 4PLYA 4A03A 4A2CA 1O6ZA 3ZWWA 5ADHA 3K6JA 1ENPA 4S1VA 3B20A 1GYRA 3DEYX 1KOLA 1EQUA 4TROA 3U5TA 1Y8RB 4N5LA 1N7HA 4QSMA 2CDBA 2Y1CA 3JQ7A 3OETA 2BFPA 3O9ZA 2J6IA 4J7CA 2X23A 5T64A 4H3VA 3JD2A 1LX6A 3HDJA 1HYGA 2YUTA 3PTZA 4F45A 3SXPA 3ZV5A 3G3EA 4U6QA 2VWGA 3ZU3A 3WMXA 1QYXA 3DONA 5TS3A 4CV0A 3H9UA 3I4CA 3JSAA 4IGEA 3RAJA 1KC3A 3M6IA 1W6UA 1WDLA 3WQQA 3VPSA 5LDGA 5AOVA 3D64A 1M67A 4PZEA 4XDZA 3ZWOA 1Y1PA 1NFRA 3KOUA 5IDQA 3N58A 3WDSA 4BKQA 1NPTO 3H9GA 4OIMA 4MVJI 4HY3A 4CM4A 2EP7A 4J1QA 1WW8A 3QV1A 1GR0A 4WKGA 5BNFA 1WLYA 3U62A 4LRTB 1LSOA 2UVDA 1ML3A 3E5MA 3LSYA 1CQJA 4J4TA 3CZMA 3E9MA 3QP9A 1DLJA 3MJSA 1YBVA 2HKIA 1UXIA 4LN1A 3ZU2A 5TNXA 1G6KA 4YJHA 3ASVA 4L74A 2PFGA 2NU9A 1N2SA 1SOVA 1P1RA 4AJKA 2V7PA 3OMLA 4ZA2A 3GY0A 5A9RA 3O8QB 4YACA 3HUDA 2WTBA 2B37A 2C29D 2O3QA 3GA0A 3G79A 3JYOA 1KVQA 2XAAA 3O8QA 3PRJA 1PX0A 2V6FA 1ULSA 3P19A 4AJEA 4ESOA 2AEMA 4Z9FA 2JKVA 3H9EO 5CPBA 1HWYA 1F12A 2E37A 3UCEA 1R37A 1V6AA 4JP2A 2P9CA 4CM4B 1GZ3A 5F3RA 1NVMB 4ZQEA 4IMPA 4BGIA 1YL7A 4O5OA 4CM9A 4DPLA 1IZ9A 1DDOA 3GFGA 5B4VA 4O6VA 4YVFA 5K1SA 4PVDA 1ZSYA 2OL4A 1I2CA 3NDJA 3DZHA 1VRWA 5DULA 3E5RA 1IE3A 4BO2A 5K9ZA 1K5HA 1LSSA 2EW8A 2I9PA 2OFPA 4RPKA 2X1HA 2FPGA 3GLQA 4Y67A 2JCYA 3UKOA 2ZIZA 1AGNA 3GVXA 2PGLA 1PR3A 3ROPA 3Q2IA 3RFVA 3D4NA 6LDHA 2XXJA 2W2LD 5G0SA 3WIEA 2W98A 3BMQB 3U4DA 4CM7A 1DIHA 1H0KA 4E5KA 1HTBA 2PZKA 1YBMA 3DOJA 3GHHA 5I7SA 1U8XX 1QG6A 2VYND 4IS3A 5DDIP 1OAAA 2O7QA 1XLTA 1U5AA 2JFFA 2NU6A 2CF6A 1ZEMA 1Q0HA 1UZNA 5CHEA 3DZIA 3DBVO 3QW2A 2PH3A 4W82A 2Q46A 5TT1A 2UAGA 3UN1A 1I2BA 4LMPA 4FS3A 2ZB3A 3D3EA 4ZRNA 4DQXA 2AA3A 3WTCA 5J23A 3KYCB 5JLAA 4BO4A 2CVZA 3AM3A 4IM7A 3F46A 1DIRA 4IDCA 5JC1A 3I9OA 4OOFA 1LI4A 1TXGA 3VH1A 4XQ9A 1LDGA 1W0CA 2X7HA 1NAIA 3IIEA 4W7HA 4IJUA 1T26A 5ILOA 1WZIA 1YGYA 1PSDA 3PHJA 1Y6JA 3DHEA 4QTZA 3ZW8A 4BV8A 3R1IA 3V2UA 1I30A 1E1KA 3NT4A 2PZJA 4MKZA 3DTTA 1JKIA 3CUKA 4FR5A 1U3UA 2DVMA 3RC7A 5I9LA 4OKNA 4M89A 4R69A 3DQPA 2VCYA 4CMKA 4EYEA 4MVJP 4MVJM 3NDRA 4RPGA 4PLCA 4E31A 1AN9A 3M1LA 2C2YA 1R4MA 2DTEA 4TQGA 3E6AA 3LT2A 3VTZA 4CLEA 4YT4A 1E1MA 4L4SA 3PK0A 3GVCA 4ALIA 2P4HX 3GVHA 3OHSX 1Q7CA 1BGVA 4GBJA 1PZEA 3G17A 4ZQGA 3NTQA 4D7AA 2LDXA 3DHNA 1B7GO 2IZZA 3NT5A 2ZJ1A 2EKPA 2X9NA 2G0TA 3CXRA 4D3SA 2WSBA 5KIAA 1BRMA 3ZWBA 5JCJD 4Y6SA 4YXFA 1G0NA 3DDNA 3KB6A 2NV6A 1JVSA 1B8VA 2P91A 4HFNA 3LLSA 1HZJA 1JVBA 3A06A 3NTOA 1M6HA 3OH8A 1ZH8A 3EW7A 4OGWA 3DAGA 5H82A 3VVCA 4MVJH 2Y05A 5A03A 4UUPA 3SJ7A 1MA0A 4GGPA 4GL4A 1P0FA 1KETA 4IQ0A 4GVXA 3PYXA 2EW2A 1VSVA 3BMOA 4E2YA 5IXSA 1ZEJA 1I32A 1R0SA 2ZTMA 3HB4X 1L7EA 4OQYA 3I9LA 2YW9A 2R6JA 1W8DA 4TVOA 4DC1A 3BTVA 4Y8VA 4P38A 4B4VA 4MINA 2V6MA 4WCFB 3KZVA 4HNHA 5JSFA 1KY4A 1F14A 2PY6A 3PVZA 3OECA 3JQAD 4FCCA 3ZV3A 1T2FA 2CFCA 1BDBA 3GK3A 3EGOA 3C85A 3T7CA 3VKUA 2YFQA 2HLPA 2ZYAA 4NBUA 1QV6A 4J49A 1HE5A 3JQFC 4R16A 2DPHA 4N5NA 1V3VA 3GGGA 3D4PA 4Q3CA 3TOXA 3ZN2A 3D5QA 3K9QO 2Y0EA 4RO0A 1ZO8A 3RKRA 4Z3KA 3DBHB 3PJGA 3S1LA 4BNFA 4L9RA 5AXDA 3ZWXA 2VN8A 3C3XA 1PL6A 4OSOA 1LLQA 4L75A 2H1SA 1HE4A 3HHPA 4CQLA 2YV1A 4D0SA 2ZTVA 1H6DA 4BNTA 5A3JA 1I5RA 5IAAA 4J43A 4U0KA 2P9EA 3ULKA 2G5CA 3QQPA 3AUSA 1H6AA 1YRLA 3RUAA 4GKBA 1SB9A 4OHUA 3S2IA 3JCZA 1E3WB 1FJHA 4GKVA 5A5EA 4IS2A 5G4KA 2HMVA 3AY7A 1N7GA 4Y6RA 3PI7A 3BXXA 4RV9A 5IDWA 4R54A 5B1YA 1MX3A 3QWBA 4WE3A 2Q45A 4GQAA 3H4VA 1Y9AA 1ISMA 1PQWA 1O89A 3H9JA 3GZ4A 2GUGA 4PG4A 5A5FA 3LT0A 4CMAA 3HFSA 3FPCA 4ZQBA 1GDHA 4MOWA 4NNJA 4O59O 1HT0A 3RC1A 3WGTA 2F1KA 3WBFA 1L1FA 2E82A 1DAOA 3D1LA 4BB5A 2O48X 3WFIA 3FRJA 3RU9A 4BNNA 2O2SA 1PJTA 2OP1A 4DGSA 1DC5A 3MTGA 3RFXA 1Q2XA 4TMFA 1VE9A 3WNVA 4Z3DA 3TFOA 4K6CA 1KIFA 3AI3A 2P2SA 3B6ZA 3I23A 4GSLA 1BXGB 4KTTE 4BNZA 3RD5A 1ZZEA 3MTJA 1E3LA 2OXIA 3VPGA 3QSGA 3L9XA 3OQBA 4P22A 4RVGA 2AQKA 4CJXA 1FDTA 2Y1GA 1RPNA 5JC8A 4IMRA 2FOIA 1ORRA 1C3VA 3F4BA 3IDSA 5JMPA 4KQWA 3UXYA 4BNXA 5L45A 2FSSA 1B26A 4CQMA 5EINA 2VYNA 2BKAA 5U1PA 1SBYA 1QORA 4XA8A 5DBGA 4BKUA 2VHVA 4AVYA 1MXFA 3INRA 4OYRA 2J8ZA 1H2BA 3E9NA 4I5EA 1NX6A 2FP4A 2OO5A 4I08A 4J7UA 3HDHA 3BA1A 1M75A 1JA9A 1SB8A 2DBQA 2V65A 1UH5A 3V5NA 4CLOA 4DLAA 2D5AA 5TJ9A 1R16A 3QE3A 5L7WA 1ONPA 2PZLA 3U4IA 2JFHA 3JYLA 4TVBA 1HDRA 2DUUA 2NLOA 3FTNA 3KEOA 1D1SA 1DO8A 2AQIA 4CODB 1PQPA 3QLJA 3VPFA 3OICA 3EAGA 2Y0CA 4ZJUA 3HN2A 2W8ZA 3VHRA 4LGVA 1Z82A 3ZZNA 1NQ5A 4B8ZA 4Y6PA 3E48A 1GV1A 3KLMX 3MCVA 4IIUA 1BVRA 2V6BA 5ES3A 3SX2A 3PWSA 2RBEA 2IXBA 2J3HA 2WDZA 5BSEA 2GSDA 1MUUA 1CQIA 1K2WA 2G82A 3WWYA 3DO5A 3JYNA 5CFZA 5L9AA 1GYPA 1UXGA 4KDFA 2RIRA 3WYCA 4CM8B 4R4JA 1X13A 2XF8A 4BNJA 1P44A 3PEFA 3CIFA 2IYOA 3ICCA 4JBIA 4QO7A 3QVSA 1EDOA 4B3IA 1O5IA 3MJTA 4F6LA 1T4BA 5CDSA 1UXKA 5TC4A 3CE6A 3WICA 3FHLA 3GDFA 4DXHA 3NJ8A 3RCBA 3IC5A 4XGKA 5ICSA 5DNAA 4XQCA 4IGFA 2X22A 3HDQA 2YHIA 3RC2A 3KXDA 3PJFA 4YJDA 3DZJA 4YT2A 4JNKA 7ADHA 3WIDA 1SEVA 4MVJA 1J0XO 3O26A 4PVCA 3LLVA 2Q50A 3C7AA 4DQUA 1MC4A 3VTFA 2AG5A 3GDOA 2EEZA 1ZCJA 3KV3O 1NPDA 4HWKA 1SC6A 5ITWA 1E7YA 3S8MA 1A72A 4UVEA 3OIGA 2RHRA 2OORA 3N7UA 3V1TC 5G0UA 5GMOA 1PGOA 4JLWA 3WGIA 3ZWNA 1WVGA 5IF3A 2EP5A 5FF9A 4B4UA 3LC2O 4BIIA 1F06A 3RUHA 4AJIA 3TOZA 3QVXA 4XEHA 4X54A 3NRCA 3P2YA 1BHSA 1TI7A 4KUHA 3OJLA 1VSUA 3QRWA 4ZD6A 3W4IA 4BNMA 1R15A 1M66A 3O4RA 1A4UA 8ADHA 4NI5A 4XQGA 1YJQA 3X2FA 3F3SA 2HO5A 4IJVA 3EUWA 1VPDA 2PLAA 3LVFO 1QR6A 4RQUA 5C3MA 2FN7A 1AUPA 3ZHBA 4OL9A 3ADOA 4QXMA 4CLOB 3GUCA 4XIJA 2Q4EA 4GSKA 4AJPA 4L0QA 3ZI0A 4HADA 3KSUA 5AYVA 4FSHA 1TEHA 1EVIA 1NP3A 2PD3A 3WNQA 5T67A 3CMCO 1WMBA 4R1TA 3RFTA 2VHXA 4R9RA 5AXAA 1MG5A 3H5RA 3F47A 3DZBA 3VKVA 4JJGA 1KEUA 1XGKA 2D3TA 3PHHA 3WBBA 1Y81A 4HXYA 3E9QA 2G76A 3OQ1A 5L7TA 4QECA 4PG7A 1K6XA 4HFRA 2FY8A 2QG4A 4DIFA 1OC4A 1ZJYA 5I7VA 2J3JA 4WLNA 1FMCA 1I33A 4YAGA 3F5QA 4OQZA 4D42A 4J1SA 1Y9EA 4Q39A 1D7OA 3KTDA 5JCJA 3IUSA 3WFJA 4YA6A 1DC6A 4FQ8A 2OOSA 4ID9A 3AUAA 2ZJ0A 2Z5LA 3UCFA 2YQ4A 1I3LA 1HE3A 4BNUA 5DP1A 3JQDA 1VLLA 2BFOA 5L95A 1B0AA 1K89A 2JD0A 3AOGA 3HN7A 3PLNA 1E77A 3RUIA 3TL3A 2PKQO 2Q1SA 4Y98A 1DHTA 5I9NA 4WPGA 3RIHA 1HF3A 4XD2A 3K30A 4AJ1A 1T2EA 4CV3A 1UZLA 1DSSG 2RAFA 3FNHA 4URFA 3C7DB 3AOEA 3NKLA 5F1OA 2B5WA 2FWMX 4BMNA 4CLHA 1HE2A 4GWKA 2DU8A 4GVLA 5MGBA 1PGPA 4DREA 3EZYA 1JTVA 1N9GB 1BTOA 2EJWA 3TZHA 1KC1A 3I83A 1IPFA 2ZB7A 4WUVA 1QLHA 3DXFA 1DLIA 1ENZA 1V3TA 2EKQA 3T4XA 1LDYA 3A1NA 1AXGA 4GMGA 3WJ7A 4DL9A 4DPKA 4PIVA 4W7IA 1YB5A 4AG3A 1XU7A 3H2SA 4Z6KA 3JQ9A 2D1YA 5EESA 2CDAA 4EI2A 3ZWMA 4H7PA 1GYQA 4JQCA 4OXYA 4NU6A 3LU1A 3JQGB 3JQBC 3ZHXA 4NBVA 3ROQA 1PGNA 3HNPA 4RGBA 1LDEA 1U7HA 3GN1A 1K3TA 3ZNOA 3GG9A 1EK5A 1I36A 3O03A 1GQ2A 1PTJA 1WDKA 4R51A 4WLVA 3ENKA 4D79A 3E03A 1ZNQO 4GGOA 4LISA 4BO6A 1T1SA 1Z6ZA 1OZAA 2O3RA 1EUCA 1X0XA 3CEAA 3JD0A 4O0LA 4PRLA 3C1OA 1YONA 1Y5RA 3AU9A 2VNAA 4IY1A 1C0PA 2CNBA 2NUAA 3W8EA 1XHLA 3GHYA 3NEPX 3Q9UA 5T8KC 4OH1A 1RM5A 1P1HA 2GN6A 4CMEA 4ZHSA 2TMDA 3E1KA 3F1KA 1QLJA 1X1TA 3DZFA 3AFNA 3ZNPA 3OBBA 3PFWO 4R1NA 4FDAA 3QWAA 3AWDA 3GRKA 2Q2VA 1YE3A 4DYDA 3GG2A 1NHGA 4LSWA 1P1KA 1YVEI 3IP3A 1NVGA 4PFJA 3O38A 1DRWA 4ONEA 1H5QA 1IHXA 1I24A 1U28A 2O3SA 3RU7A 5FI5A 5BT9A 4RZIA 1HL3A 1MB4A 3P7MA 2C7GA 1ZBQA 4BB6A 1FDWA 3T4EA 4NZ9A 4F6CA 4CMGA 5G2OA 1GTMA 2HK7A 4J2OA 3H6KA 2Y93A 4FC7A 3P2OA 4XX0A 2Z1NA 4Q3EA 3NX4A 4LMRA 5G0WA 4TRMA 3ZWYA 1YOVA 4FJ2A 4HV4A 3JQEA 3R3SA 5JNLA 4XYEA 3UUWA 5A05A 1NPYA 3LT4A 3SBOA 2C5AA 1IZ0A 4GX1A 5IFLA 2C54A 2DBVO 3QVWA 1RYDA 4CQMD 4DVJA 5JAIA 3H7AA 4CR8A 2X5OA 3Q11A 5KVCA 2GGSA 3Q0EA 1EVJA 1KYQA 1R4MB 2E49A 2NQTA 1GAEO 3WLFA 3IKVA 1EUZA 2HMUA 3OJEA 5TF4A 1JWAB 3VH3A 3DMTC 1IUKA 4A26A 4E30A 4K6FA 4KUGA 2RCYA 1BVUA 4LK3A 4D44A 2B4QA 1ZXBA 2NTNA 4ALKA 1PU2A 4DTIA 4O63O 2NADA 4NIMA 3TZCA 1R4NB 2DPGA 4BS9A 5TGDA 5CDYA 3PYMA 1SMKA 5I9MA 1ONOA 3PWZA 5A06A 3H8VA 1YB1A 4WJZA 1TVEA 5JW6A 4RVSA 4W4TA 1RKXA 3NAQA 4FW8A 2NVWA 4PLFA 1IULA 2FZWA 3L0DA 4RF4A 2ZATA 1TT5B 5MDHA 3HADA 2GZ1A 1R6DA 1YO6A 2X5JO 3D5TA 4BNIA 3KSZO 3F9IA 1BW9B 3PIIA 4D46A 1HETA 3KO8A 1R4NA 3DBRB 2HMWA 1HZZA 3WLEA 1AE1A 4I9UA 1Z73A 3JQCA 3PGXA 3DBRA 3DWFA 5KTKA 1AHIA 3CH6A 3HWRA 4G81A 1NR1A 4U5QA 3WMWA 1KVRA 4D3FA 3KETA 1ISHA 3KLPX 2B5VA 1X7DA 1EMDA 1LQUA 4EZBA 1PIWA 4IDEA 4YAIA 2J3KA 4YAJA 1RM3A 3MOGA 3NYWA 1UDCA 1B2LA 3ZWAA 5JYEA 3ETEA 4YRAA 1NTOA 2EERA 2Q4BA 3HG7A 4OAQA 1N1EA 4J7XA 2DTXA 2HK8A 4NJMB 3ITDA 4FGWA 1WP4A 2DTDA 2PD4A 3PIDA 3BMOB 4RVHA 1G0OA 2X58A 4B3JA 4UVHA 3JQAA 3TSCA 1TB4A 5F21A 2Q2QA 1DJNA 4OXKA 3KSDO 2GLXA 4AL4A 1IB6A 2QQ5A 5DCYA 4R68A 1QYDA 1WPQA 4I5GA 4NK4A 4PG8A 1HKUA 2PGJA 3R0IA 3F5SA 3GF4A 1DB3A 2Y68A 3PHGA 5ICMA 1LLUA 2VRBA 5TLSA 2OMEA 3UH1A 5TIIA 4MDHA 1LDBA 1ZXLA 4DA9A 4N18A 4UUNA 1YJ8A 1Q0LA 1BMDA 1Q0QA 2OBYA 5HRUA 1YQDA 3K2BA 1V35A 4Z0TA 2NU8A 3VZRA 4I9NA 4FOOA 2Q49A 4JBGA 4KQXA 3PWKA 2FSVA 3ONDA 4GMFA 1YQGA 1GD1O 4L8VA 4JX8A 3DTYA 4GWGA 4W99A 4XGNA 4R9SA 3RQSA 5BR7A 2DM6A 1JKFA 4MVJG 1QP8A 2B83A 5AVOA 2GN8A 5F5LA 3TL2A 4LSMA 2Y66A 2O2YA 1PZGA 1BW9A 3I1JA 3JQ8A 4QX6A 3TFQA 3FPLA 4DYVA 4GH5A 3G0OA 1F8GA 3UHAA 3UAGA 4RORA 2HAEA 1U9JA 2WD8A 1KY5A 4FD3A 1T25A 2FR1A 4EJ0A 3KEQA 3QWFA 3AM5A 5COQA 3RI3A 2GRAA 1EZ4A 1XWFA 2CY0A 2VNSA 4J2HA 3W6ZA 3QIVA 4JGBA 2VWQA 2DBRA 2W2KA 4YQZA 1VKNA 2I3AA 1YB4A 2C07A 5JAZA 3EVNA 5LCXA 3QWIA 5JFOA 3JD1A 2X9GA 1ZMTA 2Y0DA 1GUZA 3G49A 1C1DB 1E6UA 2XXBA 4RLSA 3JQ7B 3PLRA 3KYCA 1PGQA 5FYDA 4TKLA 4E33A 4BO9A 5G0VA 1LA2A 4EBFA 2E6UX 2GASA 4DWVA 4FFNA 1N5DA 5K6AC 3WXBA 1UXJA 2ZB8A 3Q1LA 1A7KA 3WB9A 4ALNA 3FNEA 3NUGA 2BGLA 1MGOA 2HQ1A 1A27A 1U8FO 2AQHA 3AY3A 3V1UA 3GZNA 2Y1DA 5TJHA 1X1EA 1L7DA 5EPOA 2JD1A 3JQFA 3MJEA 1GQYA 3LYLA 4DUPA 1C1DA 3PDJA 2NVUA 3H9QA 4B8WA 2O23A 2HJSA 2Q99A 1ZSNA 1QKIA 3GAFA 5DT9A 4FGSA 1EVZA 1RM0A 2JJYA 3AU8A 4JROA 4BO0A 1DFGA 2C0CA 1PJQA 3RC9A 3SEFA 2HJRA 4MPDA 1DRVA 4TWRA 4E2XA 1LC3A 4EEZA 2B4RO 3V8BA 2ILTA 4M86A 3HFGA 2FRDA 5DCUA 4UUOA 3WQRA 4W6ZA 2Y1EA 3TN7A 3GVIA 4MP3A 2I65A 2X6TA 4J91A 3U3XA 1E3IA 4WECA 4ZGWA 5JO9A 5CEJA 2VHZA 4JP3A 1R0LA 4RDHA 4IIVA 3JQ6A 3WWZA 1AHHA 2O4CA 2X86A 4JK3A 4W9NC 3NJ4A 3EK2A 2VOEA 4BQRA 1X7HA 4XJTA 1X15A 4N5MA 3RUCA 2GPTA 5EL0A 2WMDA 2Y67A 3Q9NA 1Z75A 1UJMA 1UDBA 4NMHA 4A0SA 2PZMA 3K2EA 3MZ0A 3SC4A 5IN5A 2VUTA 2ZYDA 1PS9A 2YJZA 3W8DA 4IDBA 2RHCA 4M87A 1X7GA 4ZICA 2Y1OA 1SOWA 1EBUA 2AE1A 2DAPA 4PLTA 4WCDA 4YWJA 2O50A 3GEGA 1QMGA 5A02A 3GPDG 3M2TA 2D2IA 1T2DA 2EJVA 2OUIA 3JD3A 2D0IA 4J9VA 1NBOA 1O0SA 3GN2A 5B4UA 4K1LA 5T6BA 1TT7A 1GEGA 2O3UA 1F17A 5A9TA 3BTOA 1LXCA 1OC2A 4RJTA 1E7MA 4AJ4A 3AI2A 1DC4A 2A4KA 1I10A 1NQTA 2Z1MA 3C1AA 2VRCD 4BV9A 4C7JA 2NQ8A 4HX5A 2W4QA 4CMCA 3I9KA 3GMDA 1BG6A 3TNLA 4TZTA 3S2FA 3VH4A 1D3AA 2VOJA 1S6YA 5IDYA 4KZPA 1B8PA 1KERA 3KUXA 1WNTA 3LQFA 2E48A 4Z0PA 2JHGA 5THKA 1YH3A 3WS7A 2IZ0A 3NDIA 2ZK7A 1O9BA 3MWEB 3RBZA 2QW8A 3W4KA 3WGQA 1E5LA 1M76A 1IPEA 2HMSA 2WD7A 2H5LA 1E7SA 4YRBA 5JAQA 2YY7A 1LEHA 3DOOA 1LBEA 1Y7TA 3IJRA 4IXTA 5FFFA 2D5CA 4CM1A 3GR6A 4EW6A 5L53A 2V6GA 3IMFA 4JXKA 1YQXA 4Q3BA 3AK4A 4Q3DA 4E6PA 1ZFNA 1PS8A 1BWSA 1GADO 1QSGA 3H5AA 3HDYA 3RVDA 2EG9A 5JCXA 2IE0A 2WJPA 3L4SO 2W90A 1EVYA 1C0IA 3ETDA 5EN4A 1A9ZA 4ROSA 2A92A 2GD1O 4KP7A 1EE9A 3ZHZA 4CM3A 4BOYA 5JDCA 3JQ9C 1VI2A 1P74A 3LT1A 1ZJZA 3PJDA 4II2A 1VL8A 2GR9A 1FXSA 3PQFA 1VL6A 5HA5A 2X0IA 2AEJA 1A5ZA 2DFVA 1XCBA 4BO3A 1EE2A 1B15A 2EHDA 2FR8A 5CDGA 2X0RA 4JBHA 5GZ3A 2VUUA 2H9IA 4NH4A 1EK6A 1J5PA 1MP0A 2BI7A 1BXZA 3PFFA 4KTVE 4LVCA 4YAKA 4B7UA 3BZUA 4PLWA 1P1FA 2VHYA 2BFAA 3KBOA 1TT5A 4U6SA 3L4BC 5IZCA 2NU7A 1SNYA 1Z74A 4RQTA 5TX7A 1X14A 1RM4A 4XQEA 4XCVA 4GX5A 3C8MA 3JQ8B 2LDBA 1P31A 1XIVA 2ZYGA 3ZU5A 4Q9NA 5IZCC 2J5QA 3BHMA 1H9AA 4Z9XA 2GNAA 2PNFA 3FCOA 5KVVA 4NJOA 1GPDG 3F1LA 4IXWA 4ZVVA 4CLRB 1JU9A 3WR5A 5KJ1A 2AEFA 1UDAA 4RVFA 1RJWA 4CPDA 4GPD1 4IDGA 3TWOA 3DOCA 1VM6A 4NFYA 3MOIA 1V9LA 1Q7BA 4IINA 1GZ4A 1W4ZA 2EKLA 1HDYA 4R1UA 4EDFA 4GI2A 4BO1A 2C2XA 4OXNA 4IDFA 3K92A 3W6UA 5AXCA 4OOEA 4BO8A 3DL2A 3NV9A 3ZWVA 2FR0A 4BL5A 2BFMA 2Q3EA 4NBTA 2CVQA 2O4UX 3BMCA 3Q6IA 3WG9A 4MVJF 3CINA 4KWHA 5F1KA 4E13A 3WGGA 4B4WA 4E5MA 1MG0A 4PN3A 4JN6B 5CDUA 1LLCA 4CMEC 4LCJA 4KWIA 3IQDB 2VZ9A 4MP6A 4XIYA 4E4YA 2ZTLA 1E5QA 3H5NA 3JYQA 5G0TA 2NNLD 3QWHA 5TT0A 4LVUA 4AJOA 4W9NA 1QRRA 5CDTA 3CZRA 2QX7A 5DF1A 2P68A 3S55A 4LW8A 2P9GA 3ASUA 4H16A 4BQPA 2DC1A 3RASA 5KWEA 4XJSA 5EJ2A 5DN9A 4WLEA 5IXYA 2YHUA 1YBAA 2O7SA 1Y5MA 4B3HA 5JBIA 2YFHA 1VJTA 4Y9DA 4PLPA 5F5NA 3PDUA 5JY6A 2P5YA 3VZSA 5JAMA 1NFFA 2BD0A 2G17A 3RUFA 5L3ZA 4E5YA 4D43A 4IZIA 3ZWPA 4DLBA 3IOYA 3CKYA 4R3NA 4NFHA 4ALMA 4ND1A 4FJ1A 4I1IA 2YHIB 4I5DA 1V3UA 4YTEA 3DR3A 1U3WA 4JJIA 1K6JA 1KVSA 1ISFA 4CV2A 2CUKA 2QYSA 1EQ2A 3TDKA 4B7XA 2HCTA 2ZTUA 1IL0A 1HLDA 3MWDB 1QYVA 2AQ8A 4FBGA 1PJ3A 4PCVA 4INAA 4PLGA 1WMAA 3HB5X 4YPOA 2GO1A 4NR0A 3RUEA 5B4TA 4WEOA 4NDNE 1KEWA 1TA4A 2J5KA 3BMQA 2QRLA 2CZCA 2J3IA 4YAEA 2QRJA 9LDTA 1JN0A 1DOHA 4ALJA 4BNHA 4AJHA 3RWBA 2VYVD 4CMBA 1CEQA 1WAMA 4A27A 2X0JA 4BGUA 1G1AA 4BNYA 2UUOA 2PWZA 3BAZA 3PXXA 3K8ZA 1Z7BA 1HRDA 5BNTA 3CSDA 4E5PA 3E8XA 3AUTA 1PJCA 1E7WA 2NVBA 2Y99A 3NT2A 5IN4A 2BELA 4ND5A 4ND3A 3U4HA 4BUCA 4WOKA 5KOIA 1HEUA 1LDMA 3PYLA 2AMFA 1I3MA 1HDOA 7MDHA 1BXGA 3NTRA 4UUMA 1XKQA 3VPXA 4F3YA 1UXHA 1ZSVA 4KMSA 1GU7A 4FFOA 3BMCB 2W2KB 1VJ0A 4RF5A 5L4LA 1NAHA 2NWQA 1DAPA 4EITA 1A4IA 3H3JA 1GPJA 1VC2A
chains in the Genus database with same CATH superfamily
4CFYA 1ORIA 3WK4A 1YNSA 3PPYA 4R9NA 4ZQCB 2GF2A 2Q5QA 1T3LA 3Q2KA 3ADCA 1JJVA 5HQTA 1Q83A 1DAEA 4UHHA 2PZEA 3ZDFA 4ZZ0A 4EPTA 1H9BA 4BMSA 1NASA 4P4UA 1QYIA 4GOOD 1F1BA 1NLUA 3KYDA 5L4SA 1IHPA 5JDIA 2HMTA 2N1MA 4IHAA 1JHVA 2J0VA 4NMXB 2QZZA 1Y4UA 3OPXA 3OEYA 4CMIB 3IAHA 5SICE 1U1IA 2G5GX 2IU3A 3BX1A 1PEDA 2D59A 4B48A 4I3GA 4D92A 1RYFA 2ATEA 5DI9A 1J06A 4EB3A 3DAFA 3W7BA 5JMWA 1ZW1A 3TLYA 4NCHA 4L73A 1W19A 3TJRA 1WD7A 2P3SA 4AJJA 1DKUA 1NVFA 1VL1A 1XZMA 1XP5A 2NO4A 3T7SA 3RROA 4Y7DA 2O6HA 1XG5A 3I4LA 4FEYA 2X8JB 4O1HA 3FUVA 2C96A 1VHDA 4M0MA 5DXJA 4C0WA 1UOPA 2P2ZA 3MB5A 1KL7A 4EFDA 2GZMA 2GF0A 3OJ0A 1JFVA 1USKA 5J2UF 2C59A 4Q6BA 1H94A 2OZEA 4O1MA 4GX2A 4IJKA 2XZLA 1P77A 4UREA 4D6XA 2ZKLA 3K2IA 4BNVA 4F46A 3HXPA 2H2HA 4BJHB 1L5QA 2DRIA 1HYEA 1JIKA 1ZL0A 2F3TA 3ASYA 3HA7A 3KKEA 5IJ9B 2IHJA 1H6BA 2NG1A 4I50B 1DXQA 3FMIA 4UEJA 3JVVA 3OP1A 4RMJA 4P3PA 3V97A 1GHTA 4N7RA 2I8AA 2NSLA 3FBTA 3PFNA 4BMVA 5CA1F 2WU3A 1NP6A 1C4WA 2EXXA 1S8OA 4Q3AA 1WXGA 4L5BA 2BH9A 2GYYA 1NZDA 2QYHA 1DQZA 4KOEC 1MLDA 1R5NA 1KS9A 2ACVA 2LVBA 4LJ9A 4OKIA 4GXRA 3T99A 3E2IA 3VKGA 4D25A 1HV8A 3M5DA 1PQUA 4P3KA 4C08A 3BYZA 1CNFA 4TLAA 4A6EA 4D9IA 3PGLA 3TAUA 2TMYA 2VAPA 4OB6A 3I8SA 621PA 3C6YA 1WY7A 4NHEA 4LBZA 5HMLA 3UJHA 2GH1A 3L6CA 4ISBA 4KFTA 5B55A 2IS1A 2J59A 1OAOC 1NNI1 3ZCTA 4ZAXA 2VDRB 5ED0A 4BLRA 2XR1A 5GP1A 4EVRA 3PVSA 4IF4A 2JJ2A 4S12A 3HZRA 4YJ3A 5E0OA 4OGGA 1H3FA 2KX7A 3D3KA 4Q4AA 4LJAA 5E6SA 3TUJC 4A8HA 3RAGA 1LBHA 2I54A 3LW7A 3T06B 4PNPA 5EJIA 1NFQA 4B40A 1C8LA 2Q4OA 1FXWA 2QG9A 2V7GA 3EZLA 4UULA 2GERA 1NJ1A 4B09A 5AK6A 4F92B 1CUDA 1N2HA 5GOZA 1G59A 3ZBPA 1L7BA 3BMXA 2G9VA 3PNSA 3WZMA 3H4TA 2H51A 3LOPA 4Z9YA 2UUCB 1A8PA 3CSSA 1LSUA 3NNSA 4BYGA 1JMYA 3BA6A 4QT0A 3UKJA 3IUMA 4BVAA 4AG5A 2ZTSA 4S3MA 4DMMA 3ES9A 2V9PA 3EUFA 5B5SA 3VI4B 1TADA 1WKBA 3DFMA 4RYLA 3Q8KA 1M0EA 4KR3A 4GQBA 2FMUA 1T0JB 3ECAA 4U0JA 2G6TA 3HPRA 2EBHX 3CKLA 3E9RA 4NDZA 1ODSA 3GQVA 2QTGA 5SYMA 3MD0A 3B9PA 3RU3A 1KZGB 2JAPA 4IQGA 1QC5A 3EXHB 4GWLA 5F23A 3SQWA 4JBLA 3FE2A 1WXQA 2X0KA 1RJGA 4H0NA 4HMQA 2SKCA 2J6BA 4M8NE 1MDBA 2YWGA 2OWDA 1NXTA 4LC1A 1Q7RA 3RS0A 4EARA 5BRJA 5ALNA 1R9NA 2JLZA 2FQ1A 3N9IA 3L07A 3NETA 4J4HA 4FUQA 3VJLA 1PEYA 4P31A 2Z09A 3ROXA 2IH5A 3FY4A 5DBHX 1UR5A 4P98A 3CEJA 4I8IA 4ZI5A 1EBFA 4EMBA 1EWQA 2WE8A 3E81A 3WDLA 1KY2A 1UMCB 4YJFB 3VJRA 2H3HA 4D9MA 1GNRA 4LRYA 3EF1A 3UFXA 2WUEA 4RPJA 4ZHQB 5EQJB 4RCVA 3VH2A 4HT3B 4PO1A 2QRZA 521PA 4URVR 3MHTA 3DP9A 1ISIA 2AUMA 2HRQA 4IDDA 4UDYX 3VDQA 4MKIA 3LXUX 3WOHA 2M6LA 3LWDA 1JLRA 2HFJA 2XYPA 3C24A 3KTOA 4CKCB 1VIAA 2FPUA 5CGZA 3K05A 3VO1A 5AKGA 1DTWB 1U3TA 4XGIA 2QAJA 4MP8A 2XMQA 5ESXA 5IFKA 4IQ8A 2R2GA 4IJWA 2BMAA 4RXMA 4NF2A 4K03A 5AR1A 3S2GA 3SBEA 4ESEA 1E58A 3FKQA 4HATA 5GGXA 6CHYA 1E8DA 4IEFB 3MM4A 1R66A 1CJKC 2I4LA 2X2EA 5C18A 5I7HA 1PS0A 3WGMA 1G21B 2ZAYA 1W44A 1ZHFA 3HS3A 4RYDA 1WBBA 4U63A 1SCUA 1Z4LA 3S4YA 5D3MA 4LTNA 1A88A 3AC0A 2W48A 3L93A 3M4YA 3HACA 4FHFA 5FQNA 2NSJA 2QVGA 1TYAE 4NS4A 1MAWA 1Z0ZA 3OLCX 4FX5A 3DZGA 5JXHA 3NBQA 3W1EA 4C0AC 1N25A 3FAKA 4LZNA 1GVNB 4A8JA 3ZLJA 2ZANA 3LF2A 5CYGA 4P82A 4IFBA 4TZ0A 1RWBA 3D8RA 3JS5A 1KDZA 4V24A 1NVVQ 4ZQFA 3JD4A 2VDLB 3KD2A 4DLPA 4C6TA 5LUAA 1E1CA 2DFPA 1D8TA 2ZUFA 2DPMA 1I7PA 1U1CA 4GPEA 4I99A 3EPRA 5IDVA 5KNDD 2R3SA 2ZIFA 1L5VA 1PGJA 3C16C 1JLLA 3DZCA 2Z58A 4ZPXA 3U5ZB 3P4UA 3RNOA 1NWHA 1QG2A 5DMHA 1AQ6A 1EA5A 1HDXA 3ZK7A 4R9VA 3DC2A 2ZGVA 3CRVA 4UU8A 2C31A 3V00A 4XPIB 2PD6A 4UBMA 2V9CA 3GRVA 3H65A 1K6IA 3ABSB 2UVPA 4KXQA 1G17A 4LYGA 3EFBA 2NW6A 1A4XA 2IXTA 3ANMA 3BIXA 4Q21A 1CS4C 2HBRA 2IHYA 2P65A 2J7PA 1QONA 4KXVA 4Y30A 2VSNA 1NBMD 4FHZA 3RF6A 4CCYA 4EA9A 4QYIA 5IF9A 5K5EA 1TEVA 2ZB2A 3DE1X 3F6PA 2WIBA 4HGOA 1ZH2A 3R3UA 1Q1NA 4B44A 3AEUA 2B8JA 1GGJA 1EH5A 1ZKMA 1S2GA 4AJNA 4IUYA 3IP1A 2IDZA 1P3DA 1SO8A 2XWQA 4ND2A 3JZIA 3HY4A 3H99A 3TTVA 4B6SA 3WLPA 4EY6A 1N6LA 1VPLA 1YJBA 3A3YA 1FU8A 2X2PA 1Z2DA 3V6LA 2HWUA 3K53A 1XDWA 1A9OA 5AI5A 2HHJA 5EUCA 3ZXYA 2ORIA 2YQZA 2NSDA 4OCZA 3UPTA 1G9SA 2QE6A 4JEUA 1QO0D 4AFNA 2HSDA 3N2GB 5BSGA 3CKMA 3O8OB 5BNIA 2C7OA 1WPXA 1P9LA 3N2GA 2WD7B 4DZTA 1XTQA 2A30A 3SOZA 5C8YF 3NVKI 3PGVA 4D3DA 4RY2A 4WMLA 1X7YA 1WXDA 4J0IA 3RS5A 1NNLA 4IIXA 4RESA 1Y1QA 2P5SA 3NVMB 2QL5A 4UBJA 5K8CA 3ZJ5A 5ALWA 1SU8A 4F21A 2IZ1A 1YIDA 3K7EA 2FZEA 2R44A 3CUSA 1VSQA 2F9MA 2R86A 2IYFA 3FPAA 4NBRA 2A84A 1YI0A 3TW4A 1G63A 3D3NA 1IHYA 4PRKA 2PX6A 5H70A 3DFIA 3ZIAA 5K3FB 4K8OA 4TXNA 4BZQA 2YN2A 4F9FA 3RJ5A 2ZQYA 4ARZA 1AMNA 2C4NA 3FSRA 2XPCA 4FFDA 2XH8A 3NTLA 1N2EA 1KMNA 1ZIDA 3OZ7A 4BP9A 2NUPB 5LP6C 2AOWA 4O02B 4P4LA 2IU0A 4QG7A 5AJTA 1S01A 4L27A 4IZHA 3V80A 3B85A 2YVUA 2E4XA 1Z8HA 1ZD4A 4NBLA 4AD8A 1W2GA 3ZKAA 2X8LA 1FY2A 3PDCA 4M22A 1AZLA 4POAA 5FBRB 5HKLA 2QSYA 1T91A 3BXZA 3VU3A 1XQWA 2M32A 1N75A 1V3QE 3TBKA 4UXJA 3INTA 4IXDA 4RV5A 4UARA 4KNWA 1VRVA 2D74A 3D3WA 3KM0A 2HRCA 4I4TF 5EZYA 4MUJA 1L4NA 1UAYA 2P79A 3I0MA 3NM4A 3F8SA 1YJAA 1N3LA 3N0RA 4ER5A 3FUTA 2GEVA 5DBIA 3ZV4A 2ODAA 4BZXA 5BQ3A 7REQA 4B7ZA 1RYHA 1HSOA 3L06A 5LC1A 1U9IA 2IRWA 4Y2JA 1JKMA 2ZWPA 4MS3A 5DLQC 5CTJA 3ZW9A 1DZIA 2FG5A 1CXZA 2RHHA 1LPBB 1XHFA 1ZMRA 2VH2A 2B21A 3A6KA 3B70A 3L8DA 5EE0A 1HEYA 1NUSA 4XWTA 3I5UA 4LECA 1JW9B 3HDGA 2GZSA 3H2YA 5A9SA 5KHOC 1DMSA 1NRXA 4B6PA 5B7PA 2QE7A 2J5RA 3BMNA 1NM5C 3QH4A 3G1UA 5H9VA 4F9TA 4FFRA 4URZR 1VCNA 4JJZA 3ITKA 3T1TA 1LWOA 1UOQA 4HX9A 3H6GA 3I28A 1KOFA 5H8WA 2WAOA 2HQBA 3PQ7A 5EJ7A 1YVPA 3OUTA 4GPIB 1L5KA 4EW1A 3ZCSA 1V1JA 4ETMA 4N54A 3V33A 2F90A 3DXXA 2YN0A 4CLXA 3O8LA 1FP2A 5FNVF 2DLCX 2B0JA 4K9PA 1EFHA 1T4CB 3E0QA 1GTZA 4TV9B 4M9ZA 1JNXX 2AW5A 3T9FA 4AQ7A 3KJGA 3R0XA 3FDZA 4UOQA 4BRWA 4JGGA 4C7KA 3KKPA 4FDUA 3VU9A 2C7VA 1VBFA 1Z4MA 3AV3A 3VDRA 2FPPA 3UBTA 4EZEA 2Q3CA 4R01A 3RR2A 3H2ZA 4NZPA 2OESA 4L4XA 1WU7A 4DUGD 1PZHA 1RQRA 3O21A 3ZVNA 4KODA 4GKAA 1BYUA 3B6EA 2W83A 5F73A 1EWVA 5EXPA 4ZU3A 1UBKS 2CDCA 1DWPA 2UKDA 3FD8A 3GIWA 3QOXA 1GCOA 2CZQA 3JQGA 1DG9A 4D80A 1WABA 4I5FA 4C4YA 1O97D 1XRJA 3I32A 2A94A 2P6NA 3GFVA 3EDMA 1A2KC 2O0JA 1B14A 4JOCA 1YQWA 3LUFA 1OH7A 3RVOA 3C4QA 3OUZA 1FMFA 3OA0A 3DCNA 5JWHA 4OK3A 3LNCA 1KI2A 3UF0A 2I0FA 3U16A 1P75A 3BFPA 2JHFA 1M72A 4LF8B 1W4LA 3K9LA 4DAOA 2IYYA 1OPRA 5CNKA 2JS7A 1AGPA 1E3JA 2C7BA 2P78A 3CPSA 3WMRA 3AL3A 1Y1LA 3C3YA 4OFXA 1WMEA 4D8WA 1ZUNA 4K9LA 4ZWNA 3F71A 4D0RA 2G9RA 4X92A 1M74A 1OI4A 1Q3KA 5D84A 3OZIA 5DK4A 2PDAA 4DIDA 4RIGA 5IJ0A 5JNTA 5EQFA 1L4GA 5JD6A 2JRCA 2LZ0A 2WVJA 4X97A 2F8MA 4C0BA 2BBSA 2KLBA 2VF8A 4PZCA 3LPAA 4C3OB 1JDBC 2VYVA 1PJ4A 2A5DA 3QG1A 5K0GA 2NACA 4OQ4A 1RJ9B 3I61A 3MGAA 2ENUA 1XZNA 3FI9A 2PZFA 3NOOA 4MB2A 5LLSA 3WKBA 5L3SB 2F17A 1C41A 1YK1A 1VHWA 3QUCA 5GTDA 5TPZA 2RDMA 3UXHA 2R6ZA 4B2LA 4TMTA 5L7YA 4P81A 2AK2A 2EFJA 1GCIA 1RPAA 4EF5A 5BN4A 3VM6A 1FYXA 4K28A 3LE8A 5JY1A 1DL5A 1X70A 4K9DA 5KDOA 4YCMA 3E7XA 3EULA 2I67A 1F48A 4GX0A 2HQSA 3EMKA 3HJCA 2ZBRA 4JCOA 2X0EA 3DE7X 3CJQA 2PANA 4MS4A 3W2EA 1COWA 1A8HA 3PJEA 1IY2A 3A9WA 5PGMA 3TSAA 5AJXA 3FNGA 2HUPA 4HUJA 4ZC8A 3UVEA 1WIWA 1YKFA 3GB9A 3T7TA 2C0QA 2HV8A 1YR7A 2HWKA 1RJDA 4I14A 1N8KA 2PVSA 4NCBA 2BLNA 2ODWA 2HNKA 5KNCH 5CCBA 2XRZA 5JPIA 2IIQA 5DOZA 3WP0A 3LOQA 5KTRA 5LL6P 3NMUF 4DJDC 3DHVA 1C1XB 1RRFA 3PA6A 4MLZA 3IOEA 1T29A 4H08A 1EVLA 2HIMA 4YUXA 2LE0A 3CZAA 2JGIA 3VC1A 5K3OA 4OO3A 3GFOA 2XUFA 3LQ4A 5KVQA 4IWXA 3U09A 1NJ6A 1MXHA 1NJFA 4ODIA 3W7AA 1GPNA 3ETGA 2P4SA 4MICA 3TAXA 4REOA 4IDHA 2RHOA 4KU4A 1BEZA 3KDAA 1Z2NX 4EKNB 2AN4A 3O4VA 2HA2A 1T1RA 1FX0A 4R5HA 3IJPA 1F8XA 2C58A 5DTRA 2PSFA 3TTXA 1NWCA 3JQPA 4NJEA 4AO7A 2A14A 1KJIA 3U4AA 3DJYA 4I7EA 2WKSA 1L4YA 3JTMA 5EG5A 4US1R 5EXXA 4A0HA 1CERA 3Q4GA 1H4QA 1GXSB 3AF2A 4TN5A 3UJ8A 5CVUA 4EABA 2CHQA 4CE6A 5FTNA 3RRBA 2OHFA 2RKBA 1E2BA 2WD9A 1MABB 4JQOA 1XJ5A 1AURA 5C5IA 2BISA 4K7JA 4E2WA 1W85B 4H4DA 2HADA 4EUHA 1FDVA 2WUWE 4FLEA 2WVGA 3OOHA 3OQ6A 1D8AA 4C14A 1C2TA 3WQSB 3AUJB 1XVAA 4D99A 3PHLA 1G8YA 2NX2A 5GZ1A 3AUUA 4YJ2B 5FEUA 1F7UA 3PQDA 3OQHA 1X7WB 4NATA 1NLFA 1W34A 4G2NA 4UXHA 2ECFA 4E88A 1KFCB 2VQ6A 2GEKA 3SX2A 4FB5A 2XTNA 1RJFA 4MKXA 4ITRC 3EG9B 3THSA 2NZWA 4RMNA 1FUKA 2GN4A 3A1EA 3ZS8A 2A2ZA 5C37A 1Y3BE 4BLVA 1V8BA 1UEXC 3ONEA 1CIVA 3UK6A 5FBKA 4CWAA 3EWSA 1YKSA 2HA6A 3Q87B 1E2JA 4ZDKA 3ZOZA 3OEWA 4RIEA 2OLJA 2B1RA 1CSEE 4UTOA 4FBMA 5GVSA 2B3DA 4ABTA 1E1NA 4UMVA 2ZT8A 1IMJA 2CNNA 4YCAA 3IQGX 4J1TA 8OHMA 2ZI9A 4QICA 2ECOA 3MIIA 1E4VA 1VGVA 1VQ1A 3FOEC 1OWPA 1CJCA 2O0LA 2ZRLA 4JC5A 2HW8A 4MR9B 3JRWA 121PA 3V1MA 1RCTE 1RWQA 1C50A 4Y6GB 2CXSA 4X6LA 2QAGB 6ABPA 4PY2A 4E21A 2VTEA 3X1YA 3SP1A 2DQ4A 2BKEA 2FEAA 3QHQA 1QGOA 4G01B 3NHJA 3EGEA 4MQEB 3PTAA 3C2QA 4D4MA 2FSGA 4MWTA 3FTPA 5I9IA 5FOVA 1GXSA 2QTFA 2WMOB 3D8NA 5BN3B 1R4ZA 4LTMA 4O2BB 5IG2A 1AGRA 1XQ6A 4JIGA 3FHOA 4YP7A 5J47A 3KU4A 4JBNA 3FZYA 1FSFA 1U2EA 1O8CA 3EIQA 1XMPA 1CQXA 3LF1A 4HNGA 3PX7A 3I34X 4FDTA 5AJUA 2CKDA 3MEQA 4G41A 4GLOA 4Q3NA 3X2SA 2C88A 4F3KA 3K16A 2PV7A 4G86A 2AS0A 3QVTA 4JJEA 3LK6A 1XTPA 4KXWA 4FFLA 4X90A 5B1DA 1XRLA 1YBFA 5KNDA 2V5AA 1JJIA 4JP1A 4G1EB 4BJ3A 3LGAA 1LTHR 2GUWA 4IKEA 3RS9A 5AOCA 1QHNA 3UWDA 4DLXA 4RTPA 3OY7A 3M6MD 1KEVA 3AF5A 3RG2A 5L3VA 3HCPA 5EPUA 4CRWB 2EIHA 5A2QA 5CJPA 3UA4A 1UAAA 1K98A 2MSCB 5C7YA 4WNIA 2CSUA 1C3EA 3LWBA 5JH7F 2Z8XA 1A7UA 1I3KA 4R83A 4AF6A 2P4UA 2IZOA 2AOVA 3LDHA 3P8ZA 4XFJA 4YQYA 1K4KA 1KTIA 2H1IA 5KYKA 4U1RA 2ZRPA 2JASA 4FE7A 1T6YA 3QVVA 5AQ1A 3FBGA 1U2PA 3M3HA 1PE0A 4FOSA 4G0WA 2P3QA 4RTRA 5EJGA 2JIPA 3GLSA 4FQ5A 2JJ8A 3GCGA 1YJ5A 1O54A 3CR3C 4MR8A 2FFHA 2FEWB 3QEOA 5BMVF 1EEHA 2DKNA 3HLTA 4MUBA 3S40A 1RHJA 3V34A 4EYOA 3FOWA 1VCMA 2DFLA 3N6VA 2Z0MA 3K09C 1Y4ZA 2FW0A 1LU9A 1JHYA 5KU1A 3OIYA 4CLDA 4EKYA 1EG7A 1AZWA 2ZBQA 3ONNA 3KC2A 4NPCA 5HSGA 2VWHA 3M3PA 4CKXA 4Y2SA 1AHPA 1XNHA 4YJFA 4B5KA 3IIIA 1F2UA 2B7BA 4WK0B 2HB6A 3P2MA 5JXWA 1HSZA 5E1OA 2IDJA 3EZ2A 3V1LA 1E3SA 4I50F 4D8XA 3I3OA 3A27A 2O8FA 1FSPA 1AIPA 2ECPA 2QW0X 3RTCA 3VRHA 1GNQA 4D8TA 2PIAA 2V3WA 4DAEA 5K0ZA 3UGQA 5LDHA 3FLMA 1AT1A 3L02A 4CKCA 4EDHA 1KFEB 3AJDA 4J6FA 1ZWKA 4GQIA 1E9EA 4MAMA 1KBOA 1SPXA 3PDIA 3KPVA 4DLTA 4ETWA 2R4QA 3OLWA 1Z5ZA 4KQHA 4RHEA 1B16A 1WZCA 1YDEA 2Q7OE 3SLKA 1ADBA 1CLUA 2WHYA 1TLLA 4P4TA 4ND4A 4O0MA 3DMYA 4BEWA 6Q21A 3KB2A 1H2ZA 4RDIA 3EDCA 3FR7A 2VA9A 3D8TA 3R5TA 3GGSA 2EF1A 4G85A 4QYXA 2CLOB 4ZHQA 4B4OA 3ID6C 1J6UA 2R66A 1L7QA 1NNEA 1NQOA 2O0KA 3N2KB 4UNIA 1YDWA 3VYRB 5IABA 2XY4A 3EVDA 4QXPA 3H1AA 5KTTA 4Z4GA 1RXWA 4DMUB 4L08A 3B3JA 2ZPTX 1U8EA 1Z4IA 4FMCB 3K1AA 3ZY2A 4PX9A 3UUEA 3ZIUA 4DFDA 5JCPA 4K9QA 1CUIA 1X0VA 1FQWA 2QRKA 3N0XA 4XOIA 4N9QA 3SR3A 2W43A 4B84A 4FU0A 5I51A 5KVSA 5B36A 2OCDA 1Y4SA 3PPWA 3PC8A 1GSOA 3GGPA 4DCMA 4EO4A 5DHRA 4IO0A 1XLTC 3BWEA 3TRFA 4EWLA 1KYXA 2CCJA 1I01A 2HRBA 1JHQA 3AEUB 3FPSA 3WYEA 4D4KA 4IBOA 4IUDS 2QTLA 1P9RA 4RXTA 3TPCA 4D9FA 2W2PA 1XKXA 3VU8A 1Z6TA 2QM7A 2ES4A 4UDOA 2RIPA 1T0UA 1UQRA 4DUGA 1ENYA 4GPBA 1U9YA 2N9UA 1LF5A 2H2AA 4LCBA 1PK8A 3PD0A 3NIWA 4QVKA 3ZIDA 2E87A 4PPQA 2VEDA 2XV1A 1SAYA 3HKCB 2BMWA 3LQRA 4CBVA 4MA4A 5FPKA 4MULA 2VP0A 3SHWA 5CJJA 4EPVA 1N2CA 1U0LA 2YQ5A 4A03A 4GI1A 2C1XA 3DXYA 3HB0A 1O6ZA 2I3DA 3T7EA 3G0IA 4OX9B 4MX8A 4BEVA 2QU7A 3KNZA 1E5DA 5F52A 3DT9A 1QB8A 2OWEA 2Y3IA 3DEYX 4CCYB 5BVGB 4TROA 5FR2A 1E96A 3U5TA 2R1VB 1RABA 1P18A 1WCYA 2TYSB 1JPVA 1BMFA 4LXYA 4M1TA 4O4IB 1QDLB 1C3OA 2ANCA 2Y1CA 2C2BA 2A5FA 2D3WA 1E20A 3VR2D 2UXBB 3ANXA 4JODA 1MR3F 4D9HA 4V2UA 4OLJA 1W5FA 4B32A 4H6VA 3PTZA 4NCKA 4F45A 3AVQA 3VO9A 2Q4TA 4RD3A 2VWGA 1UKYA 4JT8A 5ALLA 2AMYA 1IN7A 3I4CA 1H1TA 3A58B 3M6IA 3RM3A 3JPWA 1YS1X 2A4MA 3ZE0B 3WQQA 3N8GA 5LDGA 4Q9JA 1RRMA 1F6DA 4EYKA 2GK7A 1Y1PA 2HX1A 4ZYZA 5LMNB 5IDQA 4W7SA 3D1VA 3WDSA 4BKQA 1WUYA 1IXYA 2IYTA 1K88A 3T4UA 3DDWA 3DKVA 1NPTO 2B8WA 4LHSA 1DQNA 1EI9A 3LBAA 4JR2A 2HA4A 1R10A 1C80A 4JI7B 4LRTB 3NVDA 1U3FA 2Q8NA 4LE0A 4OHWA 5BSRA 1BD3A 2WJVA 3RTAA 3E5MA 5AVXA 1CQJA 3OX1A 3CZMA 3E9MA 3P20A 5HE8A 1DLJA 3MJSA 1H22A 3LQ1A 1KI4A 3PUIA 4PM4A 4XX1A 3EARA 3JQQA 3ESCA 1EFVA 4MI1A 2BHTA 3NHMA 1G6KA 1JE1A 3LECA 4IFIA 5I5EA 4EYSA 4L74A 3WNCA 1N2SA 1TMKA 2NU9A 4NCAA 1ZNYA 2LKDA 2TMKA 1VB3A 2V7PA 1E6CA 2QR5A 3GY0A 4RPIA 3T7IA 3SE0A 3O2QB 4M36A 4QDUA 5C1IA 1VMDA 2WTBA 1MRZA 4ZJPA 4XXHA 2JGEA 2C29D 2O3QA 5GM1A 4ABYA 1T5SA 2XAAA 1YRBA 1YGPA 3PRJA 4OREX 3GJ7A 4HRYA 4AJEA 1P7YA 3RYFB 2VSYA 1DC8A 1JFFB 1O96B 2AZXA 3DEJA 3M49A 5DHUA 2I6FA 2GEJA 2JKVA 2ZW9A 3DYVA 3H9EO 4UAUA 3REFA 2DSNA 3B2NA 2E37A 2H4FA 1M34B 2H11A 3VDXA 2VA8A 5K45A 5F3RA 3T9BA 3MLAA 1ZDMA 4ZQEA 2IPXA 3F3MA 3WB1A 5I4CA 3OE4A 4CM9A 1FLDA 1IAVA 1PBTA 4DPLA 2C83A 3K6SB 5B4VA 1FQKA 2LIPA 2XB2A 3MTBA 5AM5A 3O8BA 2QT0A 2E89A 4JJ8A 4LZWA 4FOPA 3DZHA 5DB4A 1L0BA 4N0PA 5FJJA 3V8RA 5HKAA 1QU3A 5TV2A 1KP9A 1SPBS 1L9KA 2YN4A 3B3QA 1WSAA 3CX7A 3GLQA 3HRHA 5AJHA 4MRSA 2J1LA 5K0NA 2VQEB 1NUAA 3UKOA 1UPBA 2ZIZA 3HVRA 4UQLA 2F9FA 5LLTA 4YLEA 3GVXA 1TRKA 2PGLA 3E61A 4C1BA 2CVHA 4ZT2A 2BGRA 3HH8A 2VFAA 4UUQA 3AINA 1A69A 1HNNA 3DLPX 2XXJA 3CCCA 4BFXA 1RE0A 2DP4E 2J09A 1XRRA 3WIEA 2BIFA 4CM7A 1DIHA 3AJ8A 3ANSA 1E2LA 2VSOA 3GRUA 4HN9A 1L9XA 1WQ3A 4X44A 3SSAA 4IILA 4P53A 2NO1A 2A58A 5BWCA 3HGTA 1QCDA 1Y8AA 3EEBA 2OSVA 1MEOA 2P7HA 2VHCA 3Q41A 1JTFA 3W5VA 1KZ7B 2VYND 3HRKA 4ZT4A 2QMHA 1OAAA 4QPPA 5MN6A 5K2MA 3FLAA 3QPCA 2CF6A 1UPAA 1ZEMA 2H5EA 4H6XA 4JUAA 4LZPA 4BC0A 1KI3A 1UZNA 5ERYA 1ZGHA 3DZIA 3OCZA 4M1ZA 2QSZA 3T1NA 3UT5B 3W1WA 3A6GA 2HT1A 4WBNF 4DMFA 2AGVA 1KQ3A 5F7XA 1WUHS 4WKCA 5AVVA 3R6TA 5IEBA 2AA3A 5KC9A 3WTCA 1L1QA 5FBLB 5G41A 1TIKA 1L7RA 3OHMA 4M1YA 1VJ5A 3FOBA 4YFYA 3HTXA 4CEHA 1DIRA 2V6IA 1QZ3A 1AY0A 2PHZA 1QJCA 1PNVA 3B78A 3EA4A 4JJAA 5JC1A 3GJYA 1H9CA 2F59A 2KS6A 1W0CA 3IIEA 4K5QA 1NVAA 1MHPA 1GGMA 1T26A 2WV9A 1PNTA 2WJ4A 5ILOA 1WZIA 4NHOA 4F71A 3PHJA 1BVHA 1Q0RA 2IF0A 3TM4A 3HU3A 4QTZA 3DMFA 5BWLA 1BCRA 1TKRA 4B6GA 2ZULA 5C8VA 4H31A 3W77A 4C3UA 2PZJA 4RW0A 2EFEB 4MKZA 2QDXA 1OXMA 1OYYA 4LWQA 1IG0A 1X1DA 2VXCA 3OM1A 2JCSA 2DVMA 4FR5A 4UW9A 3G5AA 5HFJA 3AEYA 3G88A 3RC7A 3W2IA 2IS6A 4C4TA 2IEZA 4OKNA 1R0BA 1X80B 2AOTA 2ZSAA 4HLUA 2VCYA 4BE4A 3KSBC 1VJGA 3WLNA 1MDFA 1P62B 1NV8A 4PLCA 5HJ5A 2L69A 2VDVE 2F8LA 1VKRA 2Q0QA 2WU1A 3M1LA 4X00A 3N2IA 4QODA 2AD1A 3NTVA 1QANA 4RAQA 5K03A 3QEMA 1OREA 3K6RA 3LCJA 5EEGA 5FI1B 1T2VA 2ZSHA 2O7VA 1BHQ1 3FJOA 3PE4A 1JZSA 3RJZA 1HQYE 4CIAA 3OHSX 1ST3A 1Q7CA 4ENRA 2AUNA 1X7ZB 1XZ8A 4XWOA 2R62A 2MR6A 3WHIA 1TZCA 3QYPA 5EIWA 1FBNA 3DHNA 1B7GO 1TAGA 5AHRA 4P0PB 2AKEA 3VR4D 2RHLA 2ZRQA 3AF3A 5KIAA 1QPZA 4P35A 4OSEA 2IP2A 3ESXA 1G0NA 1KMQA 4WOCA 5AH0A 4PS1A 3BDIA 1NLZA 1U8UA 4I2VA 1M5TA 1Q0ZA 2FZ4A 2P91A 3LUGA 2ZZNA 3FM9A 1OY1A 1V47A 2OQVA 3G7UA 5LYJA 1M6HA 1NULA 5A5GA 3IEPA 2PWAA 2VYFA 4BP1A 1LTQA 4OGWA 5JZ9A 3BXOA 4PFKA 2AN5A 1BOOA 3LL7A 4Q48A 5A03A 3WC4A 4UUPA 2W9XA 4IOJA 1VDMA 2D7JA 3OT5A 4G0MA 5EWJA 5LQSA 2BJWA 1DWUA 1PFWA 4O4IF 4MUMA 4GVXA 2R96A 1VSVA 3BMOA 4D4GA 4RIHA 1ZEJA 4FGJA 3DV0B 2XNHA 2A9PA 2FUG1 2HJVA 4Z9BA 4A1OA 1NUHA 4DR7B 1W8DA 4TVOA 1NJ8A 3QI2A 5K05A 4A6DA 4B4VA 1W9HA 1O58A 3KKNA 2C8LA 1F14A 2PY6A 1SN7A 2I2WA 4HEJA 1QTIA 4KRGA 1Y3CE 4DNOA 5EIFA 4ER0A 2BM9A 1ZI9A 2CFCA 1SUSA 3AR9A 2G1PA 3OF5A 3EGOA 4JC0A 3T7CA 3LXXA 2YFQA 1QF7A 2R0QC 3EXHC 1Z6XA 2GZRA 2ZYAA 3MT8A 3QXSA 3PDWA 4NBUA 4UNPA 5LA6B 4UDXX 4E70A 4PZUA 3VC3A 1YI8A 5BUCA 1NLMA 1HE5A 2RI6A 2V1XA 2ZVQX 4ENTA 4R16A 1GDDA 2DPHA 1V3VA 3AXSA 2KM1A 3HVHA 3E4DA 4DNFA 1NU8A 3SJCA 1VKJA 4WFQA 3Q7EA 1HNWB 4KI0A 3ZLVA 4CIVA 1TYDE 1OIWA 2BL4A 2CLFB 3K9QO 4OTZA 4V02A 5LOVA 3RKRA 4ZIRB 3PJGA 3S1LA 4KLRA 3BD7A 4M9RA 3C8HA 1GT91 4JDPA 1NQWA 4OSOA 4L75A 5AWFC 2PE5A 4RETA 4CQLA 1X7WA 3WVNA 4EZIA 1H6DA 4GKKB 5A3JA 2GPNA 1H0SA 3FAZA 4J43A 4N8SA 4U5XA 2YWCA 3CUVA 3ZY3A 3AUSA 3L8HA 1TM5E 1H6AA 1YRLA 4F9GA 5LQRA 4H2DA 1AGYA 1GGHA 1U7XA 2OV8A 4HN2A 3MCTA 4F4FA 1O95C 4GKBA 4GYWA 4OHUA 3S2IA 6REQB 1X87A 1E3WB 1BO6A 1FJHA 1KHTA 2XMDA 3CRNA 4GKVA 2WJ6A 4PHFA 5A1JA 5G4KA 4MUYA 3WY9A 4WDQA 3PI7A 3BXXA 2B7CA 1KEEB 4YX9A 3FCUB 2IY8A 4WFJA 2VJKA 4R54A 5MHTA 1Z35A 4WE3A 2Q45A 1MGPA 3B8EA 1M1UA 1MU0A 4ZVPA 3ZCPA 1O89A 4D3XA 4X6XA 4Z3OA 3K72B 2A9RA 4TMWA 2ID4A 3HFSA 3TECE 1I4EB 3FPCA 2ENWA 1XFAA 3HUFA 4QRHA 4QOFA 2VP9A 4MYSA 1J70A 1R8QA 1ESZA 5LYJB 3DEAA 4G1VA 4ZV7A 3HZOA 3FSGD 1GZUA 2R5WA 4RCZA 2G04A 4B3BA 2ZBGA 3OOWA 1W76A 5K8IA 3WFIA 2G0AA 1N9KA 1B43A 3H5IA 1B0UA 2GN1A 2O2SA 3O74A 4IH1A 4WZAB 2ZJ3A 2QUKA 3IOCA 1CUEA 2CLLB 2VAWA 3T94A 5E1MA 1VE9A 3ROEA 3WNVA 3S2SA 4YMGA 4ME6A 3AI3A 1WF3A 2ZYTX 1BMTA 3EQ7A 3NRJA 3B6ZA 1RQ7A 4N41A 3PQCA 4QPNA 1ZN8A 2I4OA 2YC2C 3MTJA 4ZCLA 1CUYA 3NWOA 3VPGA 1ZNXA 5DKFA 1OR8A 5HJEA 3QSGA 3L7NA 1KO7A 4L57A 4OA5A 1F0PA 1PG0A 1IQUA 5JC8A 3T7KA 3LP8A 1ORRA 4OUKX 1JU3A 4LQCA 1RYBA 2GM9A 2J4FA 1ZHOA 5IXJA 4D5GA 8GPBA 2GRUA 4EO7A 2X3FA 3NORA 2O2JA 3FZQA 4JVLA 1U8AA 2MWMA 4L3OA 1M8FA 1QORA 1QZUA 2HD4A 3UO8B 4BQIA 3SZMA 3RYTC 1XO1A 5ARCA 3O9MA 1SUBA 3TVYA 1CG6A 2VHVA 4MKFA 4BKUA 1CNEA 3CUWA 4HCJA 4KXMA 1MNQA 4UUBA 5CR9A 4OYRA 1U8TA 4FYWA 2X0FA 2YZ2A 4XSVA 1NW4A 1NX6A 2FP4A 2OO5A 3FMFA 4J7UA 3HDHA 4ZVUA 5BUSA 3H2IA 3KQWA 4WNYA 1JA9A 1Q17A 1ECCA 1ZJ5A 3VNSA 3SZLA 1CHNA 2D5AA 2YRXA 2IBMA 4DLAA 3QNWA 4GO1A 5TARA 4HWTA 5L7WA 4CF5A 1ONPA 1RIFA 2O7NA 4TTAA 4W8HA 3OBIA 2JFHA 1YZYA 2NLOA 3E2PA 3NEYA 3T5TA 4PGGA 3E27A 4JLPA 1Z88A 3OPYB 1SZCA 2OAEA 3ADDA 1D1SA 1DO8A 2AQIA 3DUFA 3IEXA 2FW8A 2ZUUA 3PFCA 2QJFA 3QLJA 3QU4A 3W5HA 1GTRA 2J31A 1C7EA 1Z13A 3ZGLA 1JQAA 2Q5OA 1NZJA 2OCLA 3FB4A 4NZYA 5LVAA 5TR9A 1XAHA 4ZVNA 1Z82A 4B8ZA 1NQ5A 3ACCA 1IN8A 4Y6PA 1F2TB 2A1UB 1GV1A 2B98A 3KLMX 1LCIA 2V6BA 2X5XA 4FNAA 4LNUB 2AOUB 2MMGA 2RBEA 3DE4X 4U7TB 1EINA 2IXBA 3F8WA 3NM5A 4FDMA 4HQFA 4Q82A 2CK3D 2F1HA 2J3HA 4U6NA 5BSEA 3AVPA 4N3NA 4B31A 5I47A 1K2WA 4CKBB 5CFZA 3ZDAA 4HNTA 5L9AA 1O4VA 2ZSDA 1MB3A 2ZI5A 2D0PB 4M0UA 4CM8B 3DOIA 2R6CA 4L78A 2XEDA 1VLZA 4JX9A 4GYKA 4N8EA 4U7JA 4BNJA 1P44A 2R6DA 2Z2ZA 3PEFA 3CIFA 3E3AA 4PX5A 4X3CA 5EGNA 4KJZA 3GIDA 5DEIA 2X6QA 4I6JA 2VTBA 2LRHA 4A82A 3A8TA 2FQWA 2R1TA 2JZOA 3GDFA 2A59A 3IJ5A 3ACBA 3NJ8A 1NF2A 4ILEA 4CEJB 3K1ZA 4Z5XA 3OOEA 4QJ5A 1K7SN 4WHMA 3ZGNA 4UHJA 4YJDA 4Y6OA 3S2UA 3UANA 1LTKA 3VAAA 3HCDA 3DM9B 3HR8A 4H4CA 3UY4A 4YT2A 2X9LA 3O26A 4A8JB 1XCPA 3GT3A 3M89A 5EUBA 4YAUA 1TIBA 1SM4A 1GU1A 4MW2A 4OGLA 3RKSA 3C7AA 4AY4A 4D0GA 4DQUA 1QH1B 5JNRA 2V7EA 1C1HA 2GCIA 3GDOA 4NPHA 4O1IA 1E63A 2EEZA 2DWPA 1P6UA 1I5EA 3WLKX 2ZRBA 3NQ41 1YACA 2EIXA 1MVOA 3BFJA 1RWVA 1AUXA 1Z8FA 2IU4A 1Y3FE 3EOAI 3K0CA 4HPWA 1X1SA 1TZMA 2DLNA 2V8BA 3IVCA 4OUDB 4YK7A 5SZHB 2H4JA 4MVWA 4JLMA 5KTNA 3U48A 3KZOA 5DX1A 3UPDA 5J3JA 2K4MA 1ZVQA 2OORA 4DDTA 3N7UA 3V1TC 4JXJA 2XGMA 5GOTA 4JLWA 4L9AA 1KZHA 4OAOA 3ZWNA 3TQIA 2PUJA 4PYQA 4N39A 4EVSA 3WGIA 4N01A 1N2ZA 5SY6A 4C88A 5D7BA 3GUVA 3E1GA 4X8LA 3HBMA 3LX6A 1OFVA 2IS4A 3TOZA 4X54A 5AW7A 4X24A 4AKGA 2WA1A 1UMDA 2WTEA 4W5JA 3NRCA 3P2YA 1BHSA 3MWLA 2I3BA 3W4IA 1F9AA 2QM8A 4LDAA 4BNMA 1M66A 2PFSA 4C76A 4D74A 5K0EA 4IGKA 1STOA 2HF2A 8ADHA 2C8KA 2OPBA 4H3HB 5DNEA 1T9GS 4RK1A 2JAUA 2C2KA 2J9YB 4MW1A 3EUWA 1VPDA 3EHDA 4P5DA 5IANA 1YMVA 3W6OA 2NIPA 4LZAA 1ZH0A 2FN7A 1KZ4A 5AM1A 1AUPA 4ZCSA 1AC5A 3E15A 5JIBA 1T4CA 4TV9A 3MUOA 3U3OA 1H2YA 1DAMA 3LFTA 4YS6A 4KRYA 4RD6A 5LP6A 3NUQA 4L0QA 2E1PA 2XUDA 2YASA 2EHJA 1PR4A 5DHAA 5FP0A 3ZI0A 5A6VA 1ZM7A