5FDFA

Crystal structure of the monoclinic form of thermotoga maritima acetyl esterase tm0077 (apo structure) at 1.76 angstrom resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
320
structure length
319
Chain Sequence
FDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cephalosporin-C deacetylase
publication title An extended loop in CE7 carbohydrate esterase family is dispensable for oligomerization but required for activity and thermostability.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 124
structure length 319
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fdfA00
3ESCA 2HHAA 4ZI5A 1Q0ZA 3HXKA 2WFLA 1DU4A 5KWJA 3VJKA 4H35A 5AKEA 2GYVA 2XI4A 2JGIA 2EEPA 3G7NA 4LXHA 3IURA 1E66A 5AI4A 4HRYA 3D4LA 4U2DA 1ZI6A 2VT6A 3GBSA 1TCAA 3WYNA 5AM1A 2Y6VA 4FTWA 2JF0A 3I2KA 2Q0XA 1WB6A 2HU7A 5CH5A 3G0IA 1EX9A 1MN6A 1YSCA 3FSGD 1YA4A 2XQIA 3AZOA 5AKZA 4ZRDA 3W2TA 4IQ4A 5AI6A 4BBZA 1UOOA 2ONCA 2OGSA 1XKLA 1VOTA 2VEOA 2G63A 1ZD4A 3M82A 2CB9A 4J0GA 3SX4A 1A7UA 4H7DA 3ZI7A 2J4CA 5J3JA 4N8DA 4J03A 3HJUA 5JZBA 1J06A 4BVKA 1N1MA 4X97A 3BF7A 1LPMA 1UK6A 3C6ZA 3R0VA 4DTCA 3QPCA 4E46A 4OU4A 3ED1A 2V9ZA 5AM2A 3I6ZA 2XE4A 2Z5GA 1XZAA 1TKRA 5ALGA 2WU4A 4BRZA 4EY5A 3ZLTA 1AX9A 3QPDA 1XFDA 3FBWA 4Z49A 3O4IA 1JU3A 1DINA 2ZSIA 5AKKA 2D0DA 2I3ZA 2OAEA 5AKXA 4OYYA 4EY7A 2WJ4A 3QZUA 4X3CA 5FKJA 4PNZA 3T4UA 4WDRA 4CIBA 3BE8A 4NMWA 5JADA 4QNNA 2GBGA 4UFPA 2XT0A 3RM3A 4KAAA 5AOCA 2PSEA 1PJAA 3HI4A 2QUBA 4FLFA 3S8YA 4KE8A 4DMKA 5D3KA 3PICA 3W9UA 1ORWA 3LS2A 1Q84A 3EIOA 4BCCA 3DEAA 2J4FA 3ICVA 4F21A 3FWHA 3WL5A 3FSGA 2CJPA 5ALSA 1G5FA 5AK5A 2EDAA 3JW8A 3F97A 2UZ0A 4KEAA 3MUOA 1XZFA 1R9NA 1JU4A 2QMQA 3V1MA 1ETHA 3QM1A 4GI1A 4KRXA 1CUIA 4Y2JA 5EIAA 1F0NA 1H23A 3AUKA 4JUIA 4I3FA 4W1PA 3WZLA 1A8SA 4CIAA 3HSSA 3STVA 1LPOA 2DSNA 5DYTA 4BC0A 1WHSA 1F6WA 2DR0A 4QZVA 4FNGA 1YA8A 3ZWQA 2C0PA 4Q3OA 2QTBA 4QDTA 3D2CA 4C87A 4HS9A 5KREA 3WWOA 4K6HA 3G8YA 5JAUA 3IDAA 5HFNA 4U2CA 1XZCA 4FBLA 4EY6A 4J3JA 2JEZA 2DHCA 3O0DA 4UBNA 1YASA 2PKYX 1JJIA 2ZYRA 4QDZA 5EFZA 3DJYA 1G42A 2HFJA 3UMJA 2XUOA 4JH0A 1A88A 2W22A 1HBJA 1IVYA 1UOQA 5K3FB 4KAJA 4EBBA 4PO3X 4UHBA 4LXGA 4BTLA 1THGA 3DYVA 4Y7DA 2Z3WA 2WJ3A 3WJ2A 3WK8A 4J0KA 5AK4A 3HC7A 4IH9A 3G0GA 2DCMA 3G0BA 2ZYHA 3H17A 3A70A 5AKGA 3VKFA 5LP1A 1MX9A 1BU8A 5YASA 4QA9A 5JZSA 1L7AA 4GLBA 2OQVA 3H2GA 2JGKA 2ZJ7A 4F60A 1HL7A 2ES4A 3NOXA 3N0TA 3ESBA 1TCCA 3BDVA 3Q8WA 1QIHA 2B9VA 5DNUA 2WIFA 1CUGA 4C88A 4O08A 4G4JA 3H1BA 1EA5A 2AJLI 4BZWA 3R3UA 3OM8A 2YYSA 4UUQA 5DNWA 4MXDA 4KYVA 2BUAA 1RWQA 1N8SA 1CUDA 1YAJA 1THTA 4B7ZA 4QDUA 1LNSA 1Q0RA 3C87A 2HU5A 2CKMA 4X93A 4HVTA 1K6EA 3E0XA 5D7BA 3WJ1A 5K3EA 3WIBA 2XDWA 2C4HA 4FDMA 3FCXA 4UHDA 1XRMA 1MX1A 4FNMA 4DMCA 4KR0A 2WG1A 3ILSA 2HA0A 3IUQA 4Y2PA 4UFOA 3CXUA 2V96A 4AO7A 2C7BA 2GZSA 6YASA 1HDEA 1XLUA 4U2FA 1UZAA 4H7JA 2HRRA 1X2BA 4C4YA 4Y2QA 3PE6A 2WHRA 1ZI8A 3O4JA 2ZVDA 5H3HA 4G8BA 1UFOA 1EVEA 4FLEA 2GZRA 2VAVA 2VATA 1CUWA 3OTQA 2WIJA 5K5EA 4U2BA 4HAIA 5ALLA 4B80A 1H2XA 3R3XA 4OU5A 1FFEA 1UKAA 4Q1VA 1C4XA 1EHYA 5AK3A 4L72A 2XQGA 5EI5A 4W1QA 4G4GA 1VA5A 1IUNA 2AJCA 1TCBA 5DNVA 3W9BA 5ALVA 2BGRA 4K6KA 1N5RA 4GWLA 4UBLA 3FVTA 4DMHA 1XRRA 3WK7A 5LIPA 3L1JA 5A7FA 5AP9A 7YASA 4UHFA 1FFAA 4PW0A 4OSEA 1QIIA 1BN7A 4TGLA 4X00A 4RE5A 3DOIA 1AC5A 1B6GA 1JI3A 2I78A 2VSQA 3HZOA 3DLTA 4CI9A 5ALRA 3ESAA 4KACA 2QS9A 1J1IA 3OOSA 1BEZA 3WMRA 2XMZA 5BWCA 5HF5A 3STUA 1CUHA 4X71A 4BVLA 2B61A 4MJ3A 1YS2X 3NWOA 4AN1A 1T4MA 1JT2A 2C5GA 2XMCA 3KD2A 3G9XA 3DS8A 5LKAA 2HU8A 2WUGA 3SWWA 2WIGA 4P92A 2HDWA 5AI9A 5A6VA 1OXMA 4G4IA 2GYWA 4H7KA 2HIHA 1J07A 2RIPA 3GUUA 5CXXA 3LIPA 5CT9A 5AM5A 4NZZA 4BVJA 3W04A 3X3HA 1EB9A 4UHHA 4ZV7A 3D59A 4ARAA 1AGYA 5ALYA 2BKLA 3UUFA 2Z8ZA 1XZHA 4B83A 1MPXA 4H7HA 5AOAA 4B81A 1O6GA 2QJRA 4B9AA 4X7BA 1CUEA 1F8UA 2WTMA 1LPSA 5AIBA 1JJBA 3IVMA 1H2YA 3KOOA 3MUNA 3ANSA 4BDSA 1BN6A 4EY4A 1QE3A 5AOBA 1CUAA 4H7FA 4INZA 4GECA 1XZDA 1HQDA 1T2NA 1FFCA 2WUEA 4ARBA 1VE6A 4UPDA 5ALEA 3DKRA 4QE3A 1QFSA 3ICWA 3BXPA 3F9CA 2WQZA 3WWCA 2JGFA 5IKXA 1AKNA 2P8SA 5HK8A 3LCRA 4RNCA 1FSSA 1B41A 3CN9A 1C7JA 1GPLA 4L9AA 5DTIA 1TIBA 2RGUA 4ZWNA 3DDUA 2O7VA 5EHQA 3O9MA 2XMQA 2JEYA 2QZPA 3C70A 3U0VA 3NUZA 1JMYA 4PSCA 3FVRA 1IUPA 2WUDA 1WB5A 4RPCA 3G0CA 3F98A 3WZMA 3V9AA 1L7QA 4YPVA 1XZIA 2HADA 1IMJA 3H04A 5A7GA 2WG2A 2XUFA 5AIAA 3KXPA 4UBJA 1CUJA 4EA6A 3BL8A 3IULA 4RE6A 2GYUA 2AJDA 1QO9A 3WK9A 3F96A 4GBGA 4WDQA 1UK9A 5HZGA 4GDMA 4NVRA 3STWA 2PUHA 3C6YA 1E8NA 5AKIA 1EVQA 1E8MA 1Y37A 2XUPA 3I2IA 1ODCA 2HRQA 2FX5A 1XLVA 4H77A 1XQWA 2XMGA 2HA2A 4MQMA 5AI0A 2WFLB 3Q0TA 5IVDA 3MVEA 4B0PA 3G9UA 1QGED 1P0QA 5IVIA 5LKRA 4J0JA 2ORYA 3HABA 1Q83A 3WKCA 4UHEA 1S8OA 4JNCA 1TAHA 3WYDA 2CZQA 2X8BA 1NU8A 5DTJA 1ZD2P 5BOVA 4OB6A 2H1IA 3C5VA 2BCEA 4Y2YA 1ZJ4A 5JAOA 3EQ7A 4KE6A 1E89A 4AXBA 2XMSA 1MNAA 4GHWA 3LLCA 3R41A 3KDAA 1HLGA 1CQWA 2B20A 1QONA 2WFZA 1QIKA 1DT3A 4IH1A 4M0FA 1ZICA 5JATA 3U1TA 4G8DA 3AJAA 4MWTA 4BP9A 2CMFA 4J0DA 2VQ6A 2VA9A 2I3DA 3ZLVA 4DIUA 4E15A 4WFJA 4P9NA 2O2IA 3D2BA 1EDBA 1M33A 1WB4A 3DCNA 5JIBA 1QO7A 3WA6A 3W06A 3FYTA 5ALUA 4X92A 5AM0A 4E11A 1VXOA 1G4HA 1GZ7A 2VF2A 2E3JA 5E2IA 4K5QA 1XKTA 5SYNA 1R50A 3H0CA 4CG3A 3WQHA 1CRLA 3B12A 4FKBA 3AFIA 2PVSA 2R8BA 1ACJA 3DD5A 2JIDA 2OCKA 4C6HA 5HKAA 1GPNA 1SCIA 4Q82A 1U8EA 1WCYA 2WTNA 3O4HA 1BCRA 4D9JA 1KU0A 3FYUB 4B84A 2D5LA 1GPKA 3VVLA 1WM1A 2OQIA 1VLQA 1LZLA 2H7CA 1ODTC 5KWIA 1UOPA 3B3QA 5A2GA 1NU6A 1IUOA 1EK2A 5JAHA 3VDXA 3FOBA 4H7IA 5ALIA 3RK4A 2WILA 5T4HA 3I1IA 3JYHA 1P0PA 5AKHA 2QT9A 1QZ3A 2PBLA 5I8PA 4BC1A 1CQZA 2WHPA 5K3AA 3PF8A 3STTA 3A2MA 3WWEA 2ROQA 4OB7A 4J0CA 4Y9SA 4QEKA 5AH0A 3L1IA 3OURA 5IH7A 2J3DA 1YS1X 4NS4A 2ACKA 4W9RA 3VISA 3WKEA 1UK8A 3AZPA 2O2HA 5DLPA 2FJ0A 5A62A 2RAUA 2R11A 2BUBA 2QUAA 3WWDA 5ALPA 5JD5A 3QBJA 5IVKA 2XQFA 3BJRA 2HA3A 1VE7A 3M3DA 5JALA 2PSFA 4J0IA 3EF3A 4OB8A 5ALOA 3FLAA 2OCIA 2Y6UA 3BDIA 3VJLA 1DQYA 1K4YA 3R3VA 5K3BA 3WK5A 5A7HA 4BTVA 3TRDA 1DWPA 3QH4A 1WPXA 3DL4A 5E4JA 4M0MA 3AIOA 3QITA 1QLWA 2PU7A 3OC0A 5SYMA 4IHAA 4C4ZA 2HFKA 4W63A 3IA2A 4MQLA 5IVHA 3ZV7A 4FOLA 3I28A 1W4LA 2QXUA 4XX1A 1VJ5A 5EHNA 1QIDA 4EY8A 2XUDA 5HQ3B 5EHXA 1EB8A 3WL8A 4W1RA 5JD4A 3FLBA 1XRQA 1CUXA 4FMPA 4X6XA 2JGMA 2PX6A 5F4ZA 3WKDA 2X5XA 4BAZA 1GT6A 2QKYA 4YK7A 2BGNA 3G02A 4X94A 2BAGA 1EDDA 3KSRA 5KBYA 4A23A 1XZGA 2WKWA 1K5PA 5AKLA 2WLSA 3FYUA 2PUJA 1JFRA 1AQLA 2PSJA 4WJLA 5ALKA 1UXOA 5AM4A 1QIMA 3D3NA 1VKHA 4BZZA 4Q34A 1DTEA 2QJWA 1DWQA 2QVBA 3I2JA 3QVMA 4C01A 2QOEA 4FFVA 4L3WA 3M83A 2VTVA 4BP8A 1Z68A 1EXWA 4EZIA 4XVCA 2V97A 4BYMA 4MEAA 4ZGBA 2W6CX 4UHCA 3IB3A 1AZWA 3H2JA 5FRDA 5AM3A 4P08A 5D6OA 3STXA 1ACLA 1CUUA 4IH4A 1UK7A 1CUSA 1LLFA 2JGLA 3BJMA 4KJXA 1KU6A 3A6ZA 2CUTA 1W75A 4OCZA 4Y2TA 3A2LA 4TVKA 4UFNA 2FUKA 1CUVA 3D0KA 2XUGA 4CG1A 1ZI9A 5BV7A 1BE0A 5ALQA 2WHPB 4HTAA 3FNBA 1GQRA 5LZ2A 4ZREA 2G4LA 5ALTA 1XZJA 2XUHA 4B82A 4X6UA 1LGYA 3IIIA 3WA7A 4Y2RA 1R9MA 4QLAA 3WKAA 1WOMA 5JANA 1JMKC 2QR5A 5ALFA 2AJ8A 3E3AA 1XQYA 3LP5A 4BE4A 3HYSA 4X90A 4Y2XA 5JAPA 3O95A 1VXRA 3VXKA 1MAHA 1U65A 2XQJA 3WLAA 4ZXFA 1DWOA 3H18A 5DYWA 2OCGA 2FJPA 3FYUC 4U2EA 1OCEA 3WL6A 4FBMA 2VJDA 2C5FA 5FOQA 2JGEA 2Z8XA 3K6KA 4AZ0A 1LZKA 2Y1KA 2OXEA 5CH8A 4HZGA 4HXGA 2G5PA 2WM2A 3VJMA 5JZ9A 5K3DA 1R4ZA 3N2ZB 1GKLA 2H9YA 4WY5A 3W05A 4EB0A 1MX5A 4MWSA 4DGQA 1DX6A 1WHTA 3WK4A 1W6RA 2PL5A 1IZ8A 4X6YA 4G1FA 1Y7IA 1XQVA 2QM0A 3EQ8A 1LPPA 5AK6A 3SK0A 4JYPA 1YB7A 1QJ4A 3I2FA 3S2ZA 5C8VA 3SC2A 1Y7HA 1BROA 3T52A 3GZJA 1GXSA 4U2GA 4BRSA 1AUOA 3HEAA 3WKBA 1RP1A 4LYDA 3IUNA 3G0DA 5HF8A 2B4KA 4G5XA 4LHEA 3TJMA 4CCWA 3H2KA 2YASA 2JGJA 3PFCA 3G9ZA 4KE9A 4EUSA 3I6YA 4OPMA 5ALMA 2AJBA 3DNMA 3V1NA 3AILA 4ZV9A 1YR2A 3G9TA 2VJCA 3YASA 5ALWA 4UBIA 4P93A 3C43A 1XRPA 2OPHA 5AICA 1ZD5A 5EIHA 5A71A 1MO2A 3WI7A 1A8UA 5AHXA 1EK1A 4YASA 4LXIA 1G66A 1EH5A 2G5TA 2GBIA 4DSZA 4I19A 5JD6A 1FFBA 2PSHA 1MAAA 3BIXA 4BATA 5LYYA 2YH2A 3BF8A 4OD0A 5CTAA 4AMZA 1BCSA 5ESRA 4I4CA 3NGMA 3AIMA 3JWEA 2IIVA 2CBGA 4BE9A 4F5ZA 2RHWA 2ZYSA 5HF6A 4PQEA 1YAHA 3FCYA 1XRNA 2NW6A 2ECFA 3QYJA 3O9VA 4QDXA 2OG1A 5JYCA 3V48A 2WU3A 1MT3A 5LZ8A 1CUFA 1K8QA 4Q3LA 2YXPX 3A2NA 4RGYA 3BIWA 1QFMA 4BAGA 3TEJA 5HK9A 2XMRA 4GEGA 4G8CA 3LIIA 3GA7A 5C7YA 2RI6A 4C89A 5JARA 3C45A 4HXFB 3OPMA 4BCBA 1BS9A 4TPKA 4GW3A 4ROTA 3PUIA 1ZIXA 4V2IA 1RYYA 3B5EA 3PF9A 1PV1A 4DSAA 3C6XA 5DWDA 3WWPA 1I6WA 1W76A 5FP0A 4WFKA 4AZ3A 4PSDA 2CEKA 5JASA 1CIJA 4HXEB 4BDTA 4B9EA 3ESDA 4BAUA 4PF1A 1KEZA 2HA6A 4PSUA 2GBFA 1LPNA 2IX9A 2XUJA 3D2AA 2LIPA 5ALDA 3F67A 1HKHA 3AZQA 1QOZA 5C81A 2HA5A 1ZIYA 2XUQA 3DQZA 3ZLUA 2ACEA 2OLEA 3K9BA 3PI6A 5E4YA 4FLMA 1ORVA 5EHZA 1XRLA 2AXEA 1CUYA 3R3ZA 1CUBA 3WIOA 1XZEA 3PDCA 4JEIA 1E5TA 1CR6A 2V98A 1QIGA 4DNOA 1H22A 3EQ9A 4J7AA 4FFWA 2Y2UA 1VZ2A 5CBKA 2IITA 5I9IA 1TK3A 5HF9A 2Z3ZA 2XUKA 5T4EA 5FXMA 3OG9A 3L1HA 4N5HX 1YB6A 1NX9A 1E8DA 3GFFA 5AO9A 1A8QA 4G9EA 3PFBA 2XQKA 1F0PA 2DHEA 4AN0A 4WFIA 2RHTA 1AMNA 4F0JA 5HFAA 1QTIA 3CCBA 4UBKA 4KE7A 2HA4A 1UT6A 1PFQA 3QPAA 3M81A 2XB6A 1CVLA 4DNFA 4DM7A 3TGLA 4J0HA 4H18A 3D5EA 3QMMA 2XMBA 3QMVA 4XJVA 1LPAB 4AMYA 4QDOA 3DYIA 1XQXA 3VVMA 5ALXA 5FPQA 4W1SA 5ALZA 5LZ9A 3F8SA 4DYHA 1MNQA 4QWMA 1XZKA 1OILA 1UWCA 4S0XA 5CT8A 2WIDA 1GGVA 1J2EA 1R3DA 3P2MA 2PM8A 2WHQA 2XMDA 2HA7A 2BJHA 1U2EA 4ITVA 1CEXA 4LYEA 1CLEA 1SFRA 3C8DA 2VAXA 5CT6A 3FAKA 1JKMA 1WPRA 2J3QA 4H7EA 1SCKA 5ALNA 4BCDA 2DQYA 5AI8A 3GELA 4CCYB 5FV4A 1P0MA 2C58A 2OCLA 1X2EA 1QTRA 1BEEA 2HL6A 2PU5A 5CMLA 2VJAA 2DQZA 1VZ3A 4Q05A 1ODSA 2WUFA 1QIEA 4DLNA 1DX4A 4MEBA 4AO6A 2GBCA 1FJ2A 4LIPD 1JJFA 4X85A 3AIKA 3PUHA 5T4FA 2EDCA 1O6FA 4CG2A 4M0EA 4MYDA 4DNPA 1CFJA 4MYSA 4YX9A 4DNQA 4LKOA 3C6BA 3KWJA 4K2AA 4OUKX 2QXTA 1EI9A 3C8HA 3I2GA 2K2QB 3H1AA 1U4NA 1QIFA 4QLOA 4L0CA 1LBTA 2ZJFA 2XUIA 4KAFA 1ZD3A 4HRXA 1CPYA 5ALJA 2ZYIA 5CW2A 4Y2VA 4B85A 3V1KA 5BWBA 4UBOA 4ETWA 4GXNA 2Y2VA 4Y2SA 2QRUA 4N5IX 3BWXA 3AINA 3K2IA 5FDFA 1YCDA 3IUMA 3FLEA 3E4DA 5AKJA 5AI5A 5CRIA 1W1IA 1XROA 3UUEA 3V1LA 3HACA 4AX4A 3E1GA 1GQSA 3R3WA 4X95A 5K3CA 4G9GA 4CFSA 1VA4A 1EINA 1HPLA 4IO0A 4AQDA 2O2GA 3I1YA 1QIJA 2WJ6A 3R40A 1ZGCA 1LPBB 2WG0A 4Q3KA 1MU0A 1SOMA 4B6GA 2OGZA 3STYA 4A5SA 4JYMA 1X70A 3H2IA 4Y2UA 1USWA 3RLIA 3D7RA 3I2HA 1IZ7A 2BUCA 1ZJ5A 1K63A 2OGTA 1XZLA 1MTZA 3HRHA 1CUZA 4CCYA 5EGNA 2ZSHA 4WCVA 1XZBA 3IBTA 5HQ3A 2PPLA 1L7RA 4FHZA 5LZ7A 5D3ZA 1TRHA 1AURA 5E4TA 5CURA 4H0CA 3GROA 2WIKA 3IUJA 3QMWA 5DJ5A 1P0IA 3DOHA 1W52X 3DKKA 5CT4A 4PV7A 4XIIA 5ISMA 2C0QA 3HLKA 3KWFA 2VT7A 1LBSA 1TQHA 1SC9A 2H7XA 2RONA 4DMFA 5CH3A 5K3FA 2VJBA 5DYYA 2JBWA 2H7YA 2ZJ6A 3WK6A 1EDEA 1H2WA 5CT5A 2OAGA 2XUAA 2X76A 4OYLA 1ZOIA 4QWWA 3DL7A 1R88A 1D07A 1DT5A 2BFNA 4C4XA 2WSLA 1SCQA 5C8ZA 5FUMA 2HM7A 2WFMA 4AO8A 1BRTA 5I7UA 5C8XA 1FFDA 1DQZA 1H2ZA 3ZPXA 1ZGBA 1UKCA 1CUCA 1N5MA 3RARA 4A16A 5FLKA 3H19A 4WY8A 3CN7A 4KRYA 2PSDA 4E14A 5HCUA 1GKKA 1XLWA 2I03A 1C7IA 3C5WP 3H2HA 1MJ5A 1R1DA 4X91A 3ANTA 5AJHA 3MGAA 2DHDA 3I6MA 4FWBA 5LZ5A 5LZ4A 4BB0A 4UBMA 3CCCA 3EBLA 3O4GA 4N8SA 5CXUA 2O7RA 5T4BA 1E3QA 3R3YA 1UKBA 4K6GA 5EIEA 3RKSA 3WL7A 4AB1A 4B0OA 1ISPA 1CV2A 5LLSA 2XLBA 4EHBA 5ALHA 2DFPA 4N8EA 2XLCA 1XZMA 4XWGA 5HKBA 5AKYA 5FPPA
chains in the Genus database with same CATH superfamily
5K3OA 4FMDF 3ETDA 5D01A 5DRYA 2HHAA 1DBQA 3F6YA 4K0KB 1A7AA 4KMRA 1EVJA 1W5AA 1MIHA 3R23A 2VL7A 2N47A 4JIGA 4ZDWA 4ECEA 2LD4A 2GNOA 5DBEX 5B2EA 2IW3A 3JQBC 1QXSA 1U3VA 4EYOA 4YJ3F 5A6SA 2PUWA 3IQZA 1RRFA 4ODIA 1ADYA 4LNHA 2VNSA 1ZA2A 3LBFA 3BM5A 5HIIA 3A9CA 4U63A 4CG0A 1SC3A 4BLVA 3A05A 4OQDA 3U4DA 2R7MA 1FLVA 1I7PA 3ZGXA 2R1ZA 2AEFA 1SMKA 5FYQA 2HQ1A 4FCVA 4Z7OB 1Q0LA 3B6JA 1A5BB 1OBOA 4D45A 5BVGA 1N2XA 4MI9A 1T0IA 1VCNA 3IDQA 2FZKA 3BXHA 4O29A 4TV9F 8AT1A 3D64A 3EXEB 1Z75A 1D2MA 3KLMX 4BNTA 4F3CA 4GZ3A 4R1NA 1YOVA 4B4UA 3IURA 2YOHA 1Z5ZA 5KYYA 2W37A 2VNKA 3OE1A 1SVLA 3AXSA 4ENTA 1EJ0A 2FHPA 4I08A 2D2XA 1NJ6A 4U2DA 4AM8A 3PR1A 4W5HA 4KIUA 1SQSA 2VT6A 2QVLA 2ATIA 4C4PA 2WSSD 4HGQA 1GAJA 3WYNA 3GLFE 3FRJA 4JMLA 2ZIFA 5AM1A 5KTMA 4GDFA 1G2PA 1HYGA 3R77A 1CJSA 1JPVA 1MJFA 1BKYA 5EJIA 4FYIA 3B6KA 2GTIA 2Q0XA 2Y76A 4JP1A 1N2IA 3TLCA 2QTCA 2A0XA 3CR3C 3OX3A 3VO8A 4JGBA 4C0QC 4EMSA 3CJRA 1KYTA 1E1CB 3G0IA 5HMLA 5HUQA 5AW0A 3FSGD 1G20E 1ICEA 3AZOA 4GX2A 3OCUA 3IBGA 1WDTA 4ZRDA 5EQJB 5HS6A 3UHFA 4TMVA 5LSAA 3S1AA 5H80A 6NULA 1AV7A 2ICAA 4G5HA 4BQQA 1XKLA 2WIAA 1DG1G 4PWZA 3EDRA 3N3AC 1E63A 1EKXA 1P5JA 2Q3MA 3EVTA 4G3XA 2PZKA 2I4TA 1ZK3A 3MK31 2FP3A 1BGVA 4U9UA 3CKKA 1KZYC 2ODQA 4KRGA 4OXRA 2WWWA 2Q0SA 2CB9A 3G5AA 3NT4A 4U0JA 1P8AA 1SD2A 3Q10A 5HKLA 4Z0PA 2J4CA 3Q9SA 4DV2B 1XMPA 1HLDA 2QMOA 1J90A 3BMNA 4MS3B 3W3AA 2WMNB 2BGWA 1C8VB 4GM0A 2CDCA 3PNBA 4RF3A 4ND1A 2GXAA 3R5HA 5DM4A 5JZBA 3A1SA 1J06A 1N3IA 1NVGA 4WLOA 2ACWA 4CEJA 3FSEA 1N1MA 5SZKB 3NYWA 3IIMA 2PEZA 2P3SA 3TDKA 3WSVA 5FBRB 1AGRA 1VYVA 1GGNA 3FOCA 4YALA 2W6OA 3GA0A 2YWEA 3G7SA 2F43A 3KYDB 5JQWA 3OQJA 2PKWA 3R0VA 1TAGA 3S4YA 1FQJA 3PYLA 1BX0A 5F77A 3IAFA 5FBQB 2JFWA 5KKAA 1Z62A 2C7RA 3AVOA 1L7BA 3EW9A 3TW0A 3JD0A 2CK3D 3I53A 4W4TA 1DKOA 1YRLA 1R66A 1TVKB 2HNKA 2QN8A 4NATA 4C29A 4DUPA 4JXZA 4CODB 1JRLA 4I7EA 5AM2A 4PHCA 3SXUA 3MXOA 1J22A 1Z0KA 3KZMA 1NW7A 3T5CA 1TX4B 1T3LA 1J8VA 3LSYA 1Q1QA 3IE0A 4INJA 1H5UA 2AXNA 4B87A 2F67A 4RPIA 2RD2A 4O4LB 1CJCA 1NN0A 2Z3VA 2ZE8A 3UKOA 1OD6A 2C8KA 1JT9A 4FD3A 2NV6A 1T2VA 4N6OA 3SJ7A 4BRZA 1AX9A 4MV5A 4UZEA 1G0NA 2ZPUA 1HT0A 3ROTA 1XFDA 1E9SA 4WK2B 2HWUA 1GQFA 2DG2A 3D5TA 3ZEIA 4DCTA 5JSQA 5HCNA 5BN5B 3A1VA 2RG7A 3G8BA 1ECJA 1HE2A 1WEKA 3V7YA 2R751 2R85A 2D0DA 3K9LA 2OAEA 4JJZA 3RUDA 1ZONA 1I2DA 3WYAA 3W5JA 1ZRNA 1N8TA 2GEVA 4MAFA 4NE9A 3DP7A 4BQFA 2ZSEA 4IF6A 4EY7A 4XD2A 1CZRA 4X3CA 2ZXEA 4A7PA 3I9LA 2B34A 5ARBA 3GIDA 1XVAA 5SYAA 4ND5A 2ZJ1A 2I4OA 2PGJA 4D9GA 3HUUA 4UFPA 2HHLA 4RXUA 5F1YA 4MV7A 3UJ6A 5B5SA 3WYCA 3O1JC 4TTRA 1NOIA 1UDWA 4G41A 3Q7IA 4M7OA 5BW5A 1B8VA 1HLPA 1PJAA 3QJYA 4CNQA 1EHCA 2Q5EA 4FLFA 4X45A 2X0FA 3S8YA 4U3JB 3F9RA 4DMKA 5D3KA 2YWHA 3DZIA 1ORWA 4FONA 2IWHA 1AQNA 1OC4A 2IU4A 3SBXA 5KJ1A 3WLRA 1QRUA 3B1KA 4IILA 1YI0A 2FZVA 2V74B 3DHEA 2RGNA 1CERA 2CMHA 2J4FA 1ZJ6A 3EXIA 3LO5A 3OOEA 4R81A 3ZW8A 2BMFA 3VYTB 2PBRA 3X1MA 4F21A 1RU3A 1W4CA 2AW3A 1YC2A 3EODA 2X2FA 3FWHA 2QENA 3WL5A 3IQEA 3OZFA 4KXYA 2CJPA 3KD3A 2VWGA 5ALSA 4KR6A 1S0UA 5CHYA 5AK5A 3FI0A 3CWCA 4RACA 3EZGA 4QTUB 3A06A 3UV7A 1V39A 1L4HA 2CXOA 2G6BA 5DK6A 3ZD9A 1Z5NA 1CDOA 3G2LA 1YMUA 2WTAA 5EL0A 2C95A 1VL1A 4XGQA 2ZXUA 2NO4A 4S1WA 2X7JA 3R6TA 3WNQA 1E58A 2HAEA 1NUSA 2C7VA 3OQMA 2QMQA 4I1RA 3V1MA 4E1VA 4R0MA 1J0AA 1ETHA 1HYHA 2DJ5A 2F62A 2VQ3A 4GI1A 3DFMA 4HQ6A 3THWB 1QH9A 4NH0A 4P58A 5EIAA 1CZHA 1P75A 2W58A 4CKEB 1EP2B 3QKTA 3CLRC 4E70A 3AUKA 2EV9A 2VQSA 4DEYA 2WVHA 1GPUA 1ZK2A 3RS5A 5J2UB 4BFUA 3G5TA 2YQ5A 3VAAA 4KVFA 4KXFB 5LVAA 2AYXA 3SIWA 2LCIA 2NXNA 2X8AA 1S2MA 2ZEJA 1JR2A 1ODLA 3AY7A 4ER6A 1LPOA 2GILA 2DSNA 1ZG3A 3WYBA 4MCHA 2ZG6A 3AESA 2OBFA 4OGFA 1WHSA 3P97A 1U3UA 3S28A 4CF5A 1FY2A 1AH2A 2O8VA 1RTTA 4EGQA 1BXRA 4UARA 2CSXA 1AGXA 1GFIA 4DLLA 4N7MA 2Y67A 3WNDA 5JT1A 1JFTA 3DQQA 3ZWQA 2C0PA 5ARCA 3DE5X 3L01A 4AMGA 1V5EA 2QTBA 1U3CA 3IXLA 3CA8A 3KZCA 4QDTA 3T9BA 4AY3A 4DUGD 4CKBB 1KI6A 4IMPA 5E0KB 2WM8A 3OQ1A 4HN2A 3G8YA 2EFJA 3ND5A 5JAUA 2ZAMA 1E7YA 5HFNA 3DBHB 1EQUA 3MRVA 5SZHB 4QEZA 5KIAA 1EIWA 1NXOA 4IXDA 3AU9A 4URYR 3ZI0A 3AEZA 4EG7A 4DUZB 1CZUA 5E9AA 2ZOSA 1S9HA 4EY6A 3GD7A 1XTSA 1JW9B 2D1YA 3C8UA 4N9QA 4Q7QA 4AMVA 5LWQA 1QWOA 3RVPA 2I2DA 3ZNPA 1XD8A 1J21A 1UJ5A 3GT0A 3H1TA 4S1VA 1EP1B 4K9KA 2ID7A 1S2GA 2DETA 3NIWA 2VXOA 3LECA 5F76A 5C1DA 4TS3A 3I5XA 5CK5A 2J3JA 4Y9RA 5BR1A 3JZAA 3L6BA 2CMDA 3GG2A 3AQIA 5DX0A 1OIVA 2ZYRA 4QREA 3H65A 1H4TA 2R48A 1AKWA 4BKMA 2XUOA 1E1QA 2M6KA 1ZC4A 1I94B 1ODFA 3CKMA 4GQBA 1CETA 1Y9EA 2H6EA 4LE1A 5BWOA 1K6MA 4PZ9A 1VPVA 4QGSA 2CK3A 2HXGA 1QF9A 4XIFA 4XX0A 5DNEA 3TD2A 1JL3A 2OV3A 4HCJA 3RUEA 4CN9A 3K8YA 2PMWB 3JZFA 2ZRQA 4RCVA 3DL2A 1E9FA 4PO3X 1MORA 2I65A 5D1NA 4B75A 4C03A 5GADl 3UCFA 1QHEA 1M6HA 2Q6LA 3K9WA 3MTBA 1R6BX 4LXGA 4UCWA 4UHBA 1ZMRA 3RS2A 1YJCA 3PP8A 4XCXA 3TIFA 2IUYA 3DYVA 3H1PA 3QHQA 5HBRA 2AH5A 2XYRA 3UAVA 4DYDA 2PTGA 4WL0A 2QGZA 3WK8A 4J0KA 1DG3A 4CR7A 2EHJA 1AK2A 2XB2A 1C9DB 4IH9A 3H6HA 1YVEI 3IMKA 1KVSA 3ENKA 5HMMA 4LJSA 1TKBA 1T4CB 3G0BA 3AONB 3DFIA 5BO5A 4E12A 2DXIA 4MUHA 2IH2A 3U9TA 2WA2A 1G6KA 3A70A 1LTHR 1NGSA 4TKVA 2YN2A 3DDNA 3HZRA 1N2CB 3Q2IA 1D2AA 1U7TA 4MR8B 3LF1A 4S24A 5BR8B 5KEIA 3U26A 3HPQA 2HJRA 1TMYA 1HM5A 3CLRD 1BU8A 5YASA 4QA9A 2MYPA 4GLBA 2UDPA 3KQUA 1JECA 1XEXB 4GG1A 4D9HA 4H16A 1E0AA 2QW0X 4C0SA 4KUHA 3P2JA 1D4OA 5I7EA 1IPEA 1E2NA 1VC2A 4JHLA 4Q4JA 4XYEA 1LSOA 1G64A 1O94D 2ZIVB 4MUXA 1HL7A 1B1CA 2O52A 2Z4RA 4R6XA 1P31A 1SAYA 2AOXA 4PBRA 2FSVA 4LVUA 2QLFA 1DOZA 5JXGA 1EFVB 3BWDD 1TCCA 1Y6RA 3Q8WA 4A6EA 1G0OA 3T99A 4BJ5A 3CG0A 4JUCA 1NRWA 4TTJA 5FOSA 5JNVA 4TRJA 2XIJA 2A67A 3EPKA 1CUGA 5G0UA 1WEHA 2G8NA 3RADC 2EJVA 4EMTA 4C88A 3I37X 3Q11A 2DKOA 4O08A 4TMYA 4RBNA 1RKVA 2ZUSA 5FIUA 4AS3A 2YWBA 4WY2A 4BNVA 1CK4A 1AF7A 4Q3BA 5FOWA 3QX3A 2HOQA 3HXQA 1DRWA 3QFFA 4U3JA 3LVQE 1N5DA 1GQ2A 4UUPA 4D5GA 2O8BB 2NO9A 1O95D 4RTLA 2R6R1 3H8WA 1G4AE 4EECA 3SQMA 2AWOA 1VIVA 3KLPX 2EKQA 2I1LA 1R6UA 4IFEA 4HPJB 2V7EA 1KS9A 3B9PA 4QDUA 4C7XA 5ECYA 2GDZA 3OQNA 1WKBA 2OKGA 2RHDA 1UT8A 3BORA 4NHOA 2QRHA 3IEUA 4OHBA 4QU5A 5I8ZA 3ZQKA 4K05A 2QSJA 1PWXA 1QGUB 2HU5A 3L4JA 3T4PA 5ER9A 3MQFA 1V5WA 4PTLA 2W2TA 1U81A 1X9HA 4BB5A 3ZWYA 1AT1A 3ETGA 2DH6A 2F3QA 2QE7D 4QXRA 4Z4IA 2XDWA 2C4HA 2WJVA 3ZJVA 3EPLA 2CLEB 2ISQA 3QXCA 2YTZA 4UHDA 4M53A 4G0OA 5BQ3A 1SU8A 3DWFA 4HKTA 3L8CA 2R62A 4ISCA 4L95C 2BGMA 1TM2A 3G89A 3GLTA 4FNMA 4M7RA 2PUEA 1QNLA 1U1CA 1YVRA 4D57A 3I61A 4WUTA 3WTCA 1Z07A 4OP2A 4UU1A 4NMXB 3D3WA 1NYQA 2WG1A 2OTCA 4J4HA 1M7BA 2HA0A 1G7TA 2B5VA 4AN4A 4MITA 1O9BA 4TZ0A 1X0VA 3VAYA 4ICIA 5HQJA 5G0SA 5LJIA 3VKHA 2V4ZA 2ID4A 1G21B 3H42B 4KMOA 1P4GA 3CXUA 3NANA 4KTTE 1BE6A 5A5GA 2OO7A 3UHJA 2A1UB 3U7GA 1U31A 2RK4A 1QRAA 2C7BA 1ZCJA 6YASA 4QGHA 1AS2A 2DWUA 1IY1A 4H7JA 4PHTA 5C5DA 1AK9A 1TJPB 3EQ2A 4JY7A 3T8YA 4BNWA 3EF1A 1GV0A 2Y68A 3UB3A 4C4YA 3MJCA 2OP1A 3B9BA 4UZSA 5AVKA 1U28A 1JLSA 3M4ZA 1O94C 2PBZA 3UKDA 1CJVC 2NSJA 2PMKA 1IBMB 3ERCA 1ZI8A 5DF1A 4P3PA 3HKCA 1QO0A 3IQWA 4HXYA 2TYSB 3UFBA 1UFOA 3FWPA 1QH1B 2OBBA 2WWXA 3AO0B 1TVEA 2GJKA 3L07A 5FOVA 1WMAA 5TS3A 2OCBA 2YIVX 4LF6B 5T5QA 3KU4A 4CEHA 1E2HA 3F3SA 2FPPB 1Z18A 3GD5A 3OTQA 2BFCB 3OAAD 3CYFA 3C3YA 4CKCB 4RV4A 4EWLA 2RG1A 2H8GA 2QSYA 4HAIA 4JIMA 1KSHA 2AI3A 3DKVA 3DZJA 2AFRA 4C4OA 5DX8A 3VYUB 5K6AA 1RHJA 4RVCA 2Z2YA 3P4XA 1FFEA 4KLAA 4EQ6A 1J8FA 4EB6B 1XDDA 3MRXA 1DLIA 3SKYA 3HA5A 4L72A 2A86A 3OTGA 4F3RA 1FYWA 3EDCA 4R51A 1XD2B 5AHKA 3UA4A 4H1WA 3DVSX 4BO0A 1SXQA 1IUNA 4JUAA 1F60A 2AJCA 2A9KA 1W0KD 2D4HA 4AG6A 5ALVA 2BGRA 4OBXA 2HF2A 3N2IA 4OYRA 1ZBDA 2QMHA 2ILVA 2VDWB 2CE7A 3FVTA 4WPGA 2GO1A 5CNIA 1M1XB 2VYVA 1R6AA 4ZQFA 4XZ3A 5FADA 3KC2A 5U4QA 3WK7A 2PH3A 2ZULA 4FGZA 1ANKA 3HBMA 4YQFA 4IEFB 3CSDA 4K9NA 4BBAA 1MLDA 3IPCA 2CUNA 4GQIA 5K0FA 5DSXA 1IHOA 5AP9A 1UFRA 1FFAA 2BFBA 1IHYA 4RHTA 1TMKA 1BN7A 4JBWA 4D4HA 3E5RA 5TGZA 1N9GA 4TGLA 2RGAA 5KOJA 2QSZA 1R6TA 2H16A 4Q7EA 3HCRA 3F9IA 3M2TA 4X00A 4UMDA 3NC4A 2HMVA 5JH7F 4N9WA 4RE5A 3G2QA 1AC5A 3NV7A 4UNQA 4XD7A 2IEZA 4M9UA 2M6LA 3VR4H 2I78A 3OTOB 2VSQA 1E3EA 3HZOA 1M2JA 2FUNB 1N0VC 2NU6A 1XIVA 2RGGA 1AKEA 3M3PA 3CJQA 2M9MA 5CCDA 3D4IA 2ZE5A 3DZGA 4P3NA 3TQIA 3B7WA 5G1OA 5TSDA 4ARAA 1OROA 2J33A 2V4UA 1TPZA 4PRYA 1NURA 1Y1KE 3Q1KA 3AEUA 2WWGA 4KSBA 2P7HA 2V03A 1WZCA 3WMRA 5TPZD 2JFNA 4AJ1A 4AUKA 5BWCA 1WPQA 2ZBQA 1H8ED 3PPVA 4K88A 1NMZA 1J6UA 4L0QA 1Y7PA 4RK1A 3NIGB 2CXPA 3G17A 3GT3A 3TG2A 3UCXA 5H16A 4X71A 3R09A 4P31A 1IULA 4JBNA 2H4HA 3SHWA 2HK7A 4P82A 5FI1B 3KR2A 3K35A 4II3A 4RJTA 4XIGS 4URFA 1YS2X 3SP1A 2AS0A 2C00A 4NE2A 2CL0X 3CH4B 1FUKA 4IR7A 5EAIA 5FR2A 3AP2A 4QOSA 3OPNA 5JNWA 3L8HA 1JT2A 3L6UA 3OOWA 3PHBE 5CA0F 3W5BA 1VE1A 3SF8B 4ZV4A 5CNJA 3LUAA 3PLRA 1D1TA 5C4IA 1J0EA 2W2LA 1AKQA 1GYRA 3LKZA 2HU8A 4Q21A 4BBPA 4FXOA 2P35A 4OTZA 3EGXA 2QTHA 3AY0A 3ZHVA 2HSGA 4PSAA 2XNSA 3LUFA 5G41A 4YJKA 3IEVA 2HDWA 2PRJA 4GM1A 4XUDA 5J4LA 4KVAA 5A6VA 2XWPA 1WIWA 2PDAA 4C78A 3EFHA 5AXAA 1C9MA 2GYWA 3EHDA 4H7KA 3L8FA 3SEFA 1GAQA 1HEYA 3O94A 1FZTA 1J07A 2RIPA 3GUUA 3K0FA 1ADFA 1W2GA 5CXXA 3NBMA 5BW8A 3DLHA 3ASYA 1P29A 3TCXB 4P0QB 2YFHA 1Z7WA 1FJHA 1L6IA 1VLHA 2HMUA 3M9LA 3Q8XB 4NZZA 4P4GA 3T7JA 3X3HA 4BVJA 4URWR 3NYRA 3D59A 1U2PA 1Q1NA 1ENOA 1RLOA 2ZJZA 3FBGA 1TLTA 4O5AA 4XB1A 4C2UA 3PXUA 1YS6A 2CC2A 4K81B 4QBGB 3ZQJA 2PZAA 5CX1B 4ZHSA 1XQ9A 5EJ9A 3MJHA 3N39C 4N01A 2D0IA 2PKXA 2NSYA 3KT0A 1AUQA 1ZCBA 4H7HA 1YR6A 1PDOA 3Q3IA 3UF0A 1ZAYA 4KXUA 4HDMB 4EG0A 3E48A 4B3SB 4AK9A 4GX0A 5C7LO 2F1HA 3AI3A 3RVJA 3UAGA 5DMHA 2PUAA 4KPUA 3BRQA 2RHGB 2GMWA 2QYOA 2WTMA 2P2ZA 2REXB 4OQXA 3HXLA 1AXGA 5LD2C 4FZ3A 5MGNA 3N8IA 1Y7LA 4BDSA 3D5QA 4EY4A 4H27A 3X1WA 2E5WA 2XBLA 1ZISA 1Y3BE 5HPYB 1DBPA 4W5RA 1XDWA 4MGIR 2IP2A 3T7KA 4PZCA 1KGDA 2J5KA 4AQYB 5ULLA 4PIMA 1T2NA 3D6NB 3OFKA 1YRWA 2BZGA 4ZC8A 2GVZC 3GDHA 3HEMA 2ON6A 3P5BA 3PJDA 4L1KA 4QGFA 4LTNA 5EESA 3I73A 3OHPA 2DULA 2G1KA 4UPDA 5CUQA 3DKRA 4QE3A 1QFSA 3PSHA 2R6ZA 1QHNA 2FK7A 2VBCA 1DADA 3F9CA 3NDPA 2HUPA 4YJHB 3B3FA 2JGFA 3WWCA 3O2NA 4CU5A 3FIUA 3REQB 3K71B 1T35A 4IQGA 5GP1A 1KMCA 3USZA 4ZU3A 1KK3A 1JXQA 4I4TF 1E9BA 3W2EA 3EDOA 4OQZA 3CZ5A 3K53A 3DV0B 2OCDA 1Y3AA 4ZOLF 3U3OA 3E23A 4L9AA 4LPSA 1TIBA 2RGUA 4Q37A 4J1TA 3I05A 5EWJA 4NAHA 1RWPA 3PEUA 5D7NA 4YONB 3U4QA 3C70A 4JK3A 3U0VA 1YQWA 2Z4TA 10MHA 4FXPA 4NQRA 3K1TA 1JG2A 4GH5A 4QOHA 4IM7A 1H66A 1Y80A 4YI3A 4LRTB 1T5BA 4H0NA 2B2XA 3PQFA 4PSCA 2J9GA 3VJRA 5DNAA 1Y42X 2REOA 2P9BA 2NYRA 2ZT8A 5FQOA 2JI4A 3PVZA 1ESZA 3E8XA 3DA8A 5DLQC 4D81A 1Z16A 3NWEA 1WB5A 2WV9A 4RPCA 1EM8B 4MKGA 5KDLA 3RIMA 3IMFA 1BFUA 1PR2A 4ZI3A 2ZWVA 5JR3A 4EKDA 4V0SA 1SQ5A 4DYVA 4OHKA 3SBDA 2J31A 1GITA 1HFEL 1W4ZA 3K2EA 1L7QA 4ML3A 1TZJA 4LFCB 1XZIA 2ATVA 3K2BA 2HADA 1IMJA 1KEWA 2NQ2C 3H04A 2V9CA 5JECA 4O02B 1IN4A 4E1AA 2J3HA 3I6IA 4YRRA 2I6UA 4RPJA 3H11B 2QD4A 3QSGA 4LOLA 2JLYA 1MIOA 4EA6A 3D7LA 3O2QB 3VO2A 2ZTUA 2VHEA 4NJEA 3W8RA 3GPCA 2QV7A 3OY7A 4M54A 1VE9A 2CHFA 2OUIA 1JKJB 4DS3A 4IHJF 5EGSA 3WK9A 4PNPA 3V42A 3S5UA 3WLIA 1NDHA 1YZKA 2X0KA 3DBRA 2PLRA 4GBGA 4CV2A 2VUHB 2Z9BA 2WJHA 2I4RA 2W6QA 5BYJA 4EGSA 1AIPA 3AB8A 1QLHA 1XCBA 3S7ZA 2I7DA 2JH9A 3PUKA 4FZRA 3U4GA 4TYPA 1QZXA 2C7QA 3N8NA 2X0JA 1UKZA 2Q1TA 3A1NA 1ZYUA 3DEHA 3LY7A 1TVMA 1I8TA 1LBIA 3QA9A 3VZPA 4KXMA 4B3GA 3K0CC 1VG9B 2AZ4A 4Y6OA 2EAUA 4BNHA 1E8NA 4Z1MA 5AKIA 2PVCA 1Z13A 4ZGWA 1EVQA 2OY0A 3NOOA 1XG5A 4LDQA 1NVVQ 4QBIA 3WWZA 1L7VC 1Y37A 4ZEOA 1IB0A 4M49A 3I2IA 1C7QA 2CHEA 5DDIP 4R9UC 1RI2A 2OZPA 4DIMA 4F85A 2HNAA 2XXBA 2XEDA 4H77A 5A4KA 4FU0A 1IMOA 4FYHA 3AMVA 5DCLA 3KEMA 3IP9A 2Q8QA 2XMGA 2Q3BA 1NBWB 4GOJA 4JI8B 3PGA1 1FCJA 3PU6A 5FTKA 3ABQB 3KE9A 4ETIA 3LX5A 3Q0TA 4FOTA 4JJFA 2IOQA 1GYQA 3KOZA 3O2SB 1W4BA 4IS2A 4ZOEA 4B0PA 1QGED 1WQ4A 4L5AA 4IVQA 4WBNA 3IAXA 3HKDB 2Q49A 1T8YA 4IIJF 2ORYA 4PFQA 1QHYA 3TR0A 5KOYA 1J8MF 4GD3Q 3HABA 1Q83A 3HCDA 3VSDA 3KJFA 1N9KA 1MO5A 1NT4A 3A9UA 1OBFO 4JNCA 4NCJA 4B7XA 3GLGA 2B4AA 4MJ7A 3V5NA 4XA8A 5JBQA 6GPBA 1NFRA 3ILHA 4TN5A 3U4HA 3OM1A 4TQ9A 1XTUA 5BOVA 4ESVA 2EGGA 3K8ZA 1ZGAA 4JLKA 3C5VA 3RTEA 2JKVA 5FFFA 3L0OA 3GCDA 2KI5A 4RGBA 3V8QA 2GAIA 5JAOA 3EQ7A 3QELB 4OM8A 3FZEA 2GPSA 5L51A 2VZ9A 2Z6QA 2G0AA 4C07A 4JB3A 3E81A 3INTA 4YRJA 2XMSA 4BFCA 1N6PA 3IRVA 2QJFA 1BGXT 5EUCA 2GZ2A 3TNJA 4ZAVA 4HEJA 3B6MA 3RVNA 2WZCA 3R6WA 1WP4A 4G5SA 1BHSA 3GOHA 2II6A 1ENPA 3T3OA 5TT1A 1J24A 3RFUA 4N65A 1Y63A 4EB3A 4RJKA 1F5NA 3ITKA 1NBME 1P2UA 1QIKA 2WICA 1MDFA 2FA9A 2H1VA 2OHOA 3EQZA 4MIOA 4MHOA 2ANCA 3KKOA 2H1FA 3WLMA 2ZE7A 2FW1A 4LQDA 3U1TA 3UAZA 3H99A 3LKDA 4FI3C 1XNQB 2Q2QA 4MV0A 4DHEA 4DRXA 2H4WA 2JFBA 2XZLA 4AZSA 1NP7A 4ZJUA 3RRBA 1M2HA 5B3JC 2DX7A 3UXMA 3SZRA 2VQ6A 3WGYA 3PA8A 5FI3A 4HHEA 3VFDA 3PG5A 3A27A 2C3PA 4C14A 2ZYVX 3I1FA 1JG1A 5FOXA 3ZLVA 3C97A 1KFJB 4JLVA 5KQSA 3FIJA 3CEPB 3WP0A 1NBOA 1M9NA 1YDEA 3IIEA 4DEVA 4C7KA 3RC3A 1DEKA 4DSOA 3E2MA 4H6VA 4XDYA 1TM4E 4KQJA 3V80A 4IIYA 1EDBA 1F14A 2HC9A 1WB4A 3G6WA 3PITA 1JKXA 2NUPA 4GOMD 4DQUA 3BMQA 4PN3A 1QO7A 3EGOA 5E1MA 2JD1A 3REGA 1E0SA 1S2IA 4L5BA 5KCZA 3K7EA 3HCBA 4DF3A 2LV8A 1YBVA 3H11A 3HVJA 3ELYA 1TK2A 5ALUA 1ZN2A 3DW1X 3CM0A 3UMFA 3VH2A 4E11A 1BFDA 5F35A 1G4HA 3Q9NA 3C3PA 1Z17A 1CY4A 1Y1LA 1MF7A 4K9OA 2COKA 4ZJZA 4F6CA 1A8HA 1LJ8A 2ZXFA 3H3JA 2GEJA 3INRA 3OIYA 4MUFA 5E2IA 5EERA 4ZVVA 3D6HA 4F3NA 3RIEA 4G0UA 4I50A 1GLNA 1X1DA 4BNDA 3K5HA 4DDUA 4FNAA 2YVLA 3E9YA 3K5WA 4RV5A 3ZIUA 5AVWA 2P9QA 3AIIA 5T6MA 3TZLA 2WM3A 2IS4A 1F8GA 1RWKA 3GZNB 4WOKA 4UOQA 1NJSA 4Q9JA 4ZVQA 3WQHA 4IFTA 2ZTVA 4P4LA 2M1ZA 1X74A 4LJYA 4MYUA 2CUZA 3QYAA 1K4KA 4BUCA 5FJJA 2ZCJA 2Q2VA 2AYZA 2PUGA 2X1MA 2NVUA 3AFIA 1M1YA 2PVSA 3Q0IA 4MQ6A 5DNDA 1I5RA 1YWGO 4NV0A 5KYUA 3VKWA 2QX8A 1ACJA 5G4KA 4EENA 1JIXA 3D1VA 3EIFA 4RZHA 2X8JB 4FEAA 4IO1A 4HATA 2WW8A 4FC6A 4RMGA 4D9EA 5JCJD 2IUEA 3BCRA 3DBRB 1RWOA 4RD6A 3VRHA 1JZTA 4IIFA 1GPNA 1SCIA 2GLUA 1DUSA 4Q82A 2PJRA 2EJWA 1WCYA 2DJIA 3SLKA 1S3IA 4OHOA 2R6FA 4IIJB 2ODPA 2P68A 5HKOA 4IIDA 4OGLA 1ZVVA 3FYUB 4B84A 1MVOA 4F5ZA 2WWFA 1BDBA 2O8BA 1Z06A 1LX7A 4TWAA 1FNSA 1ML3A 2WD9A 3OEHA 3PRHA 1WM1A 4K40A 4TLAA 3EYAA 4F71A 2GESA 2IP1A 4M1TA 4J1SA 1J56A 3TLZA 3NLLA 2PMFA 4E7PA 2IPMA 1L5WA 1TYEB 1MAUA 1MOZA 1DCKA 1UOPA 2Q6IA 3B3QA 3EDQA 5A2GA 3A11A 3PCTA 2UYHA 3BKXA 5EE0A 3ZK7A 2O9JA 3HLTA 3ZWBA 2J3KA 1NU6A 4CTMA 1R8XA 1G3MA 1SA0A 1F51E 3QE2A 1T5LA 4XWYA 5D85A 1XK7A 2FEMA 3BAZA 3S2SA 5JAHA 4Y1RB 4C20A 3VDXA 4X84A 3E1KA 2NG1A 3WISA 1FIUA 5BVGB 1G19A 5JMOA 3JVDA 5IG2A 5T4HA 3V8BA 5C4MA 2UKDA 3I1IA 2ZWAA 1F8FA 4MI6A 4BO1A 2JBAB 4QVGA 3E5MA 3DZCA 3JYHA 4KCGA 5DK4A 4ZT4A 4E31A 1WJGA 1LQUA 5FTMA 2VQDA 2FN7A 4DJAA 4B6SA 3MYRA 2WV7A 1QZ3A 5KOJB 5D00A 2LKCA 2WLTA 2RAVA 2ZTLA 3BQMB 3DB1A 3GY0A 3IELA 2ZYDA 3E70C 5EKUA 1T6NA 4BMSA 4CPDA 1E5DA 1UDAA 2GHQA 3ESQA 3IJ5A 4WERA 4CMAA 3FNIA 4RJ2A 2ATXA 3BSFA 3ORSA 3HVHA 3L0BA 1I6KA 4J0CA 4BTEA 1U2GC 4UEJA 4O59O 1Y1RA 4HNSA 4R68A 4DR2B 2P1ZA 1A04A 4YRTA 1S89A 4ZU6X 4YJGB 1W581 4B73A 3BK7A 4W9RA 4YT8A 4YCLA 3DNFA 1HETA 1NTRA 1OVGA 1JEQB 1AU9A 2ZAYA 2QG4A 1Z7GA 1ZVKA 4N6GA 2CBXA 3TTSA 3HCEA 1PJQA 5IAAA 2OZEA 2V6FA 2SKDA 3R6GA 1PBNA 4X8LA 5A62A 1XV5A 3VAZA 3TZHA 2R11A 5DVZA 1G21E 1TKCA 5ALPA 2FQXA 1UOEA 3D0OA 5JD5A 1DEAA 4KMSA 1RXYA 2ZQ5A 3GJRA 3LLMA 3QBJA 3QVWA 4ES6A 4C7MA 3BJRA 2HA3A 3GO4A 4NSNA 4M86A 4F8JA 2JS7A 2J0EA 4F2PA 3BMXA 5KYWA 3M3DA 4GI3A 1OT5A 2PQ6A 4J0IA 5IASA 3JQFA 2PG3A 2FPPA 1X3LA 4PR3A 5ALOA 4AY6A 4MVJP 1BE8A 1DBWA 2OCIA 2Y6UA 3KSAC 3FUCA 1TYCA 2CKDA 2XCOA 3IFSA 3A6FA 1K4YA 1V6SA 3K0BA 1TEHA 1VRVA 2B4YA 2V65A 2E1PA 5LMCA 4E32A 4JX8A 3CRRA 2QX7A 1VL0A 4BTVA 4QFBA 5IYZB 1QPZA 1PEDA 2EJCA 1SWWA 1DWPA 1PWZA 1Z8DA 2JJYA 2Z2IA 3I9JA 1UKEA 2BEVB 1SBQA 3FUWA 3GR6A 3KKKA 2OXFA 3QH4A 4MUYA 3DBHA 4RYDA 3T1NA 4WKBA 4DN6A 1JX6A 4FX2A 2XF2A 2VI5A 3OC0A 3COJA 1BHQ1 1R4MB 1ZLXA 2GA8A 3NG1A 2EYUA 3MIZA 4QODA 5KNDH 1ZCAA 3E7WA 2O57A 4PPYA 3PFNA 2P0YA 2HFKA 2WHEA 4HH1A 4XKJA 4C4ZA 3THXA 1ZUNB 4C04A 5JC1A 1XVIA 4YUWA 1X7ZB 4MQLA 3PGXA 2N1MA 1GKUB 3GCGA 4IXNA 3ZV7A 5JWRA 2XSZA 4FOLA 2JJMA 1UPFA 3G1WA 3ZD8A 1KJQA 1DC4A 1CZNA 1HNWB 1U2RA 1J1UA 2PBFA 2VT3A 4US1R 3OFND 4A6DA 1W4LA 3IV7A 4JCCA 4S1OA 2BM1A 2QXUA 3TOCA 2PZEA 4CXMA 4I1PA 1TYAE 2OQRA 4TXNA 3THXB 3ZW7A 1JH9A 1I1OA 1TECE 1WZEA 2CVHA 1TCUA 3DGFC 1UPTA 3EY4A 5HQ3B 3ABSB 2CBZA 2UXCB 2NVUB 1AQIA 1UBEA 3P7MA 5LQRA 2Q21A 2IE0A 1QCYA 4EVQA 2Q5LA 1U99A 2XE8A 2BONA 4IVRA 4Q12A 3W5AA 3B9RA 3F74A 2JGMA 3MUEA 3R5TA 4LCEA 5B1IA 2ZJ5A 3KRTA 3RC9A 4DCNA 2BLNA 3JQDA 2Q5FA 1D04A 2FZEA 2I3AA 4NK4A 1FRVA 3CZ9A 1VYUA 4GPZA 2G72A 1RYBA 4PHFA 2QKYA 4WEQA 1SCJA 4KW7A 4M60A 4A0HA 2I8CA 4CL2A 2BFDA 4QU8A 2BGNA 4X94A 4EG1A 2BAGA 3OP4A 5JZVA 1EDDA 1NJ1A 3KSRA 1XTBA 1APBA 2R68A 1RPAA 4HFRA 3HN6A 1MR3F 4I4TB 2EP5A 4CT5A 3EASA 4M1QA 1HT3A 1K5PA 4EPVA 2OECA 1N2CE 1NA5A 1YXMA 1LA2A 5AKLA 1UODA 5JSZA 2H5LA 1ISFA 3B1YA 1JTVA 3T1OA 2OZKA 5HTKA 3NIBA 2PSJA 1N2BA 4MLCA 5ALKA 1UXOA 3LC7O 1OC2A 5B3LA 2N3ZA 3IP7A 3RSGA 2CNWA 3LUCA 2B2CA 3AETB 1QIMA 5AM4A 3T3MB 1L3CA 2QBYA 5EMJA 4PO1A 4UAUA 4ZYZA 2Y05A 1X9GA 4D80A 5LNK6 1DTEA 1U0EA 4XQ0A 2DUWA 4V0ME 3NNSA 4ZOCA 3TZEA 3V4FA 4A8JA 4H3SA 4BMDA 4C01A 1OAOC 1JYSA 3T54A 3H83A 1EMDA 3U5TA 2JJ2D 3N2NA 4WUVA 4U7PB 3BG5A 4FGSA 3GFOA 4L3WA 4PRZA 3SEQA 2YZ2A 1EFVA 4QEDA 4AWAA 1CJUC 4LHYA 5TVGA 1V3QE 1Z68A 3RODA 1Z36A 3S7TA 2CCGA 2HLDD 2QUZA 3LK7A 1R3UA 1ULZA 2VJNA 4DAOA 5AUOB 4R54A 2V97A 1EWQA 4B35A 1RXEA 4M55A 5COBA 3AY6A 1VI2A 3DR3A 4U6SA 2UYCA 1IG0A 3VR3D 2IZZA 1T0HB 4HO1X 3TCNA 1DC6A 3K9GA 1Q7TA 4FWIB 3DE3X 5LQSA 2XAUA 1VGVA 3ZQ4A 4IDQA 2X0IA 1LLFA 3KJEA 1KDOA 2JGLA 2HO5A 1AKUA 1CNFA 4KJXA 4BX9A 1V25A 3OVMA 2Z6AA 3PQ8A 5HSGA 3KUKA 4GR5A 4CMKA 3N59A 3I9V6 3A6ZA 3QXHA 4RVOA 4CKBA 2CUTA 3NAMA 1MABB 2EWVA 3DHWC 4BPBA 1W75A 3CZCA 1LQ2A 4D9BA 1CDZA 2YIMA 1GKYA 4Y2TA 1AKRA 4TVKA 2Y1EA 3EPPA 1PZHA 1IH8A 4UFNA 4CMJA 2B7CA 5F64A 1R6VA 2BFFB 1CUVA 1VJRA 1QZZA 4NRDA 3UN1A 1YFLA 4NPAA 4CG1A 1IXKA 1KDTA 3EIQA 2B99A 4NARA 4Q3CA 2CWWA 2VO1A 3WIDA 4KXWA 1RTKA 1TNDA 3CZAA 4XLZA 5K8JB 3PFKA 4P86A 5JPCA 5LZ2A 1HX7A 3LRXA 4YMHA 4ZREA 2G4LA 4Q19A 3GPLA 1FVFA 1ZR2A 1L8XA 2PXXA 2W8ZA 2ZJ8A 1NY5A 2V0CA 3N0WA 3R7DA 3RC1A 1GN8A 4BEVA 2A1UA 4HNAB 4LDJA 1PJCA 1JIKA 2QRZA 2ZUTA 1U9YA 4B82A 4D9MA 3ELWA 4OHFA 2GRUA 1H6AA 1LGYA 3IIIA 3RU7A 2GOYA 4Y2RA 3GLHA 3WSWA 4EA8A 3VR6H 1R9MA 3IC5A 3ZW9A 1XNJA 4DRYA 3OSUA 3WKAA 1HE1C 2JGRA 1RJGA 1Q0QA 4QLBA 3F5QA 4Q7KA 4YJ2B 2P78A 5FNVB 1L7PA 2PZLA 3A32A 4UAGA 5DHPA 5ALFA 5I4CA 5JRDS 2E21A 3OQHA 3Q3HA 3QWAA 2XXAA 2J5XA 1IWOA 3OJCA 1T9CA 2FRXA 2WU0A 4IZIA 3IQXA 3R9XB 3FX2A 4MQEA 1UINA 1Q0SA 4X90A 2C4TA 2GHTA 3AF0A 3IOEA 3HB1A 4TMKA 5JAPA 5EUBA 5JNSA 2PFSA 2NACA 2DFTA 3AG6A 1GA1A 1MAHA 2AN1A 2XQJA 4MUAA 5E4FA 2DFLA 1DKLA 1ENYA 1RM4A 4I9UA 5BSRA 5KSOA 1P2GA 1KAEA 4RSHA 3CUVA 3WYEA 1S2DA 3PEFA 3RJMA 1YZHA 4FSDA 3K73O 2WF9A 4BVFA 2GAFA 3FVVA 3H18A 4HBZA 3ZKAA 2OCGA 5IDVA 1EFAA 1KJWA 1NBMA 4RGVA 4RZIA 4ZYVA 2J5RA 3EX7C 1SIBE 2R5FA 4B5LA 3NOQA 1HE5A 4U2EA 1T9AA 1OCEA 5MN5A 2YXBA 2LVBA 2YJ4A 4IRUB 1A82A 4L2IA 2V6JA 4YT5A 4R3UC 1X39A 3DT8A 1NY6A 4ALLA 2JGEA 2Z8XA 2JIOA 3X1XA 9LDTA 4UTNA 2C2GA 2QROA 1KZ9A 2RHOA 3Q85A 3DF7A 3UG7A 1PEKE 4ZN6A 1IIRA 1E1MA 1T6XA 4FDUA 2P4SA 1LF0A 5AUQA 4HZGA 5DWVA 4URVR 3UJDA 1RRKA 4BQOA 1H3EA 2WM2A 3U44A 5JQGB 2PZ8A 4XAQA 3E9DA 4PCLA 1LRKA 2O0JA 4FGWA 3QQ5A 3H2ZA 3PHIA 3IPYA 3W05A 3BEDA 3D7KA 5DYNA 1E98A 2ERYA 1MX5A 4EB0A 5KNCD 1FJXA 1FC0A 1FXWA 3PJEA 1BKDR 3C1UA 4YDSA 4C7BA 2O0KA 3RC7A 4W6ZA 3SIRA 1DX6A 3ZS8A 2I4LA 2OCAA 3FD8A 1XPJA 2IJGX 2NGRA 4YP0A 4Q1CA 4JL8A 4Q7JB 3VO1A 1YL5A 1P7YA 1RCTE 2P67A 2ZJBA 4LXUA 2G3YA 4DLRA 5A5EA 5EZYB 2VWPA 3MMZA 4YLEA 1XQVA 3JD4A 3KT3A 3NBYC 1ISIA 3GUVA 3ND8A 3QKRA 3LUBA 3QLUC 1IQUA 4XOUA 3LC2O 3TGWA 5KC8A 1EJ6A 3L0ZA 3ZWCA 4BGDA 1SKYE 1XAGA 1FLNA 1BJKA 4G5FA 3SK0A 1EUQA 4GOXA 1USIA 1YB7A 1ZESA 3SPXA 1SH7A 3MHPA 4D0NA 4YUAA 1QJ4A 1RJ9B 4I1IA 1UBOS 4YPVA 2J1LA 1R5BA 1CF2O 1GJRA 4RELA 5IK2A 1XNRB 1MFPA 1Y7HA 1L7EA 1UM8A 2RH4A 3P9PA 5CXSA 3KZXA 3SKXA 3EGEA 1PI3A 1MB3A 4NKRA 4U2GA 4IDEA 3AF5A 4G36A 1XQ6A 3K09A 5TE9A 2W2XA 2ZIZA 3G0OA 3KBBA 4M37A 4PGGA 4YP7A 4QT0A 3HEAA 3RB8A 1K2VN 1SVSA 1KARA 3KKLA 4LSGA 4JX9A 3JQRA 1KRHA 1PF7E 5A3QA 4LYDA 4Q4HB 3A31A 4RCYA 1NT2A 1KO8A 5JSUA 1I7SB 4DT1B 3TI7A 1A5SB 4LMAA 2E4YA 5AJWA 1U90A 3KKQA 3C7KA 4LHEA 4CCWA 3MJVA 1JHUA 3U6KA 2XWJI 1CJMA 1QYVA 2YASA 1GPMA 1V11A 3PFCA 4KDCA 1Z5PA 3I6YA 3OKCA 5FLEX 5ABPA 3MBKA 2AJBA 4MEJA 3V1NA 4RK0A 2QLLA 3REOA 2PWYA 4NYMR 1P7ZA 3D3WB 3G79A 1JG6A 3G9TA 5DHAA 3YASA 5ALWA 2EW1A 1UBNA 3C43A 4P93A 5FWYB 1XRPA 2XRZA 1L7OA 3ENWA 3ND9A 3WGQA 1JYFA 4PYQA 3BJEA 3PC3A 5EPEA 4WXHA 2IODA 4JLUA 5JJLA 1MJGA 3HYCA 1GRRA 2BH9A 3OOYA 3PC7A 4XSGA 2Z8YM 5KB3A 3D8BA 3GRUA 4YASA 2NSLA 3UJNA 4WACA 4YMGA 1TVCA 1ADBA 2HJWA 2EATA 5BSHA 3LT2A 1Y1TA 5JVDB 3W1WA 4YLYA 1BCRB 4AWXA 4XYMA 3UC9A 3C5HA 5I5EA 3K0HA 1YTLA 2O2DA 4OF4A 2TRSB 1OPXA 3HR8A 2R6CA 4DLTA 4KN6A 3KQKA 1FU7A 2XGSA 3I3SR 4YCNA 1CY6A 5LYYA 2YMQA 2KM1A 2YH2A 3QFRA 1AKTA 2I1WA 3RAEC 1C0IA 1BMQA 1RYZA 1Y9JA 3DMYA 3EFEA 1JHAA 3LMKA 4RMJA 3RC2A 4QO8A 3SYTA 4E33A 1I4WA 3VKVA 2UYQA 3AUAA 1QFZA 1RQNA 2N9UA 1UMDA 1QVVA 5EP1A 3AIMA 3FTPA 2H11A 3GXBA 1DXHA 1KI3A 2CBGA 1R37A 3BZWA 4BE9A 4ABYA 4CWAA 3MCTA 4ND2A 3HJCA 1RRPA 3JAMA 4JN6B 1TC2A 5B1SA 1P74A 1OIXA 5LN1A 2QN3A 2KQUA 3DMHA 3K96A 5HF6A 4DPKA 4PQEA 1YAHA 4EO9A 1XA3A 2EJTA 2IW1A 2ECFA 2IU3A 3QYJA 5A3VA 3GVXA 2I5PO 3VNVA 2JFPA 2YWFA 1Q0UA 1WSWA 1PP4A 1NLZA 3DHVA 5EKXA 2BTQA 1X7YB 2WR8A 5LZ8A 5HIAA 1WUYA 1CUFA 2L17A 3M5DA 1EAYA 1K8QA 1XX6A 3O2JA 4R1PA 5LCXA 1W36B 4BWGA 1DMRA 1PZMA 3C14C 4IEIA 1Y8ZA 1JDTA 1H0RA 1N3BA 1OX6A 1YFKA 3CUTA 1IJEA 4PFSA 4QYIA 4BAGA 2D5AA 4DIKA 5THQA 5A9RA 3FOZA 4CI0B 1U0NA 3AVYA 1IN5A 5T3YA 1OXXK 2PKCA 1U04A 2PIAA 4JLPA 5EIWA 5DTEA 1FSGA 3WLNA 2D1FA 2ST1A 5LBUA 4JZKA 4ZZIA 1BIFA 4C89A 1US8A 2JAHA 1DC7A 2C84A 3F90A 3C41J 1ECLA 2CFTA 1NMSA 2YBDA 3C45A 4XDHA 2YZGA 1OFVA 4BCBA 4WMLA 4E5MA 1E0JA 4Q93A 3WDKA 4F45A 4GW3A 5HKKD 2IS6A 3B3AA 2Y66A 4UCXA 3CTMA 4ROTA 4P7GA 2VDLB 3M6XA 3KYIB 2QMUA 3IVRA 3LX8A 4V2IA 3KVYA 3WE7A 1N25A 3LG2A 3W3ZB 4DCUA 1D3AA 1D9XA 1XWFA 4GVPA 4URUR 5KYNA 1O03A 4FFBB 3I58A 2ZBDA 3ORQA 5JXWA 2QW1A 5EE5B 1C14A 2EJUA 1J8YF 1JYEA 4UM8B 3PDIB 3PXAA 4OAPA 4V0KA 5IU6A 5JDIA 2GD2A 4DR3B 3WWPA 4XH9B 3QUQA 4AJ9A 4EG5A 3JD2A 1A7KA 1W76A 4ARVA 4HDRA 3GCXA 4J91A 2IYTA 2XB8A 2H4JA 4RU1A 4HUTA 4LXTA 4PSDA 1DBRA 5JLJA 1KC3A 3DBIA 4PPGA 1AG9A 4BAUA 2PGIA 1JIIA 1GGEA 1L4KA 2RCYA 4PF1A 2BMAA 2Q0QA 2XJ9A 1FRQA 3TK1A 4MGHA 2MCFA 4U4AA 2Q6OA 5FEUA 4JA0A 3P0RA 5K99A 2XUJA 4BKQA 1CY7A 2LIPA 1L5RA 3KJGA 2QTLA 3LQKA 3LPMA 5JYBA 1X7HA 1HKHA 3A6GA 2NSHA 3CEMA 1Y7TA 3IO3A 1EFTA 1N7JA 2HA5A 3CG4A 3QKRB 4BVAA 2OAQ1 1KK2A 3ISTA 3MINA 4MW5A 3PKJA 4HP8A 3HN2A 3DQZA 2PAAA 3G82C 4G84A 3HUFA 1NVFA 1P1CA 3OZ7A 2OLEA 4B3BA 4OQMA 3EWIA 2JLVA 1RI1A 2D8AA 5KSYA 3TECE 3B1XA 4LRUA 2H85A 2PX4A 3MWKA 3QF4B 3REQA 3G6KA 4I66A 1KNXA 5SZJA 1SXJD 4BMCA 1X7XB 3OFVA 1EUCB 1PWEA 3NEYA 4D3ZA 2IQ5A 3X1KA 3EIWA 5JSZB 3ROQA 4YCMA 4GWKA 3WIOA 4XB6B 4ND7A 4F2HA 4JB0A 1XZEA 3PDCA 2FPOA 3S1AB 5LQUA 1ZOSA 1DNPA 1ZL2A 4HX2A 3LCUA 3QVGA 5LDGA 1JKJA 3H5LA 3CUKA 4MW6A 3GPBA 1KY2A 1WD5A 4YJ3A 1CR6A 2PPVA 3EEBA 3QF4A 4YCSA 2BGLA 2X9VA 5ESXA 1VMDA 5IBCA 1I24A 4O3MA 1WRBA 3GWZA 4D3FA 4A8PA 2QRNA 3QA3E 2FCRA 4M1YA 4X60A 2IITA 5I9IA 1ADGA 1EJ2A 5GJVC 3ZY5A 4X8HA 2I4IA 2ZWOA 5HF9A 1J2JA 5DBHX 4M22A 1A9XA 2JFHA 5AESA 3OG9A 5G1PA 3L1HA 1IL0A 2JFQA 3SFZA 5JAIA 5FAKA 4BVBA 2IT1A 1I1HA 3UV6A 3ZQ6A 2PTHA 4C9BA 3L02A 4TMTA 2YV5A 3H5OA 3G8AA 1RM3A 3HDVA 4CHTA 2G4CA 5BSMA 4KLZA 4TLLB 2FFAA 2VIIA 3GPDG 1ZH0A 4UDXX 1JR3E 1Z08A 3N7AA 4K46A 2HEIA 1UM9B 3IXMA 1CF9A 3RVQA 4FYJA 1PR4A 3W1VA 4LOKA 4BQRA 3IQGX 5JVDA 2O2XA 3RV3A 4MTCA 1GRQA 4CKYA 3TB4A 4AN0A 4G1VA 1CHDA 1DIAA 2RHTA 3QYPA 4WFIA 2BL4A 2FZLA 2XDAA 4JP8A 5BNFA 2NPFA 2EKZA 3KEOA 4LQ4A 4NESA 3FFTA 3WRYC 4C4SA 2FWPA 1KIMA 4F0JA 1OTXA 1S01A 5JDIC 2BR4A 3LBYA 1T4DA 4ER0A 3ZWXA 2KMLA 3R44A 1QFXA 2HA4A 5C35A 1JA0A 4GFDA 4JGIA 4NYJQ 5HJ5A 1J7JA 3DMRA 3NTVA 2NXWA 3ZHYA 5JPDA 3QBTA 5HIKA 2WYVA 3ACCA 1I80A 2HBZA 2Q7DA 3ZJYA 2Z2JA 4ZQBA 5TVKA 3GMIA 3ZWNA 1F7VA 1FMFA 4N49A 2I7XA 3R5JA 4NNPA 2C9BA 3MLEA 1WZIA 2ZRBA 2BJVA 2XB6A 2FW8A 2P69A 5J47A 4DM7A 1OV4A 1I3LA 1U7XA 2OENG 1EWKA 2R1VB 4IOJA 5CA0A 4NCAA 3WLLA 4J0HA 3WSTA 4GYYA 1EGHA 4R7GA 3UHAA 4CQLA 5TQJA 3FVQA 1XL0A 1X1SA 4M87A 2BFPA 2IBSA 4IVPA 4K3UA 4K03A 2SICE 2P0AA 1UQTA 3HJBA 3OKFA 3Q2KA 1FRFS 3DTVA 4U8GA 5I9BA 4C0JA 4Y3UA 3IAM1 2BBWA 5F2OA 5GZ3A 4U9HS 3USES 1OLOA 2EXXA 2H9AA 3M5PA 3NUGA 3KJQA 3LA6A 4LXXA 5KSPA 4ZT3A 1AMUA 1FYDA 3AEQB 3KQWA 4U6NA 2LUOA 4W1SA 4EL5A 3ICCA 5JRJA 1JIVA 1I30A 2GF9A 4BO6A 1I4LD 3IVGA 4DYHA 4PC2A 3IE1A 1ZINA 3H9BA 3AX6A 2J3LA 2Z56A 2ZBEA 1UXHA 5GJWC 1QQBA 2OSVA 1XTIA 5B7NA 5K09A 1KC1A 2F8LA 2C42A 2HMWA 4CYMA 4S0XA 4MRSA 5CT8A 1MGPA 1DC3A 3BULA 1Q1ZA 1Y4SA 3FPGA 4JJ8A 2Q5QA 3L2OB 3TTTA 3CNBA 4CMEC 1J2EA 1R3DA 4F38A 5IZ4A 4OOEA 1JEAA 3PL1A 1LWNA 3R4VA 4ISBA 2BJWA 4RABA 1E4OA 2IUSA 1SK9A 5HRUA 2BJHA 3DZFA 1W2HA 3K6SA 1U2EA 3NTQA 1G41A 2GA9A 5HX7A 2GB4A 3F5MA 3IS3A 3NAGA 3NEPX 1UC4B 3O26A 1CEXA 4ITVA 5T64A 5EXEA 3C3XA 1XZ8A 1IRIA 3FCSB 2MMCA 4DR7B 1XAJA 3UAWA 1YQDA 4LHVA 1DDGA 2ZREA 3NTOA 3SE7A 5I45A 1KRWA 3TSYA 1SFRA 2YOFA 2VAXA 3BMNB 4G89A 1F5SA 1LU9A 4YV2A 1OH6A 1SBZA 3JTMA 1H1TA 3I9OA 1P1IA 3IQIX 1WPRA 4CDNA 4H7EA 5HOQA 4ZO8A 2XWBF 4KXLA 4TKUA 2ZCVA 1EK5A 5BOSB 3PTZA 4HYYA 3F3MA 5ALNA 2FPMA 4WV3A 2ZTMA 4QGGA 1YFJA 2G8LA 3HCAA 4CM4B 2XB9A 4QYWA 2VEDA 3LLUA 1RC0A 1CEEA 2C58A 2EWMA 2OCLA 3ICPA 4YBRA 3OZVA 5FEMA 5LB2A 3JAWB 1Z4LA 3O6VA 4G1BA 1JG3A 2HJHA 1BEEA 4X24A 2ZBUA 3LBHA 1KA9H 5CMLA 1F2TB 2GSDA 3UQYS 5AW1A 1WTAA 2BPOA 1TM1E 1VZ3A 1ZMOA 1PL7A 3KUUA 3L8YA 1A1VA 2I91A 2CD9A 2PK3A 3M6UA 2WUFA 1OLXB 1M7HA 2YR0A 2ZRCA 1FB5A 4EJ2A 3MTQA 3H4IA 4CF4A 4ABTA 1NR7A 4S05A 3E2IA 3A3NA 3OPYI 2C3MA 2ZIEA 3GBVA 3EFOB 5DP1A 1NI4A 2OXTA 4ZDJA 5BXQC 3AIKA 3PUHA 2JGNA 4XEUA 3K0AA 4QU9A 1Z9BA 3DDOA 4XXHA 2ZYWX 3F5SA 4YMLA 3FE2A 3PTLA 2DYKA 1DQRA 2FMUA 1Q7EA 2P77A 3OZSA 3WRWA 4BL5A 4GKAA 3U4MA 1Z8NA 2VDWA 2IPAB 1YBHA 5EZQA 1X9IA 3JVEA 1XJ5A 1CE8B 1IFXA 2D8MA 1MX3A 1NVTA 3T5TA 1P9OA 4HT3B 2C3UA 2BWJA 3QIVA 4MO9A 1TRKA 5BSUA 3PFWO 3G2OA 3DXXA 2FGJA 3BMCB 1TUBA 3GPIA 4H1HA 5DZSA 1NM5A 2JANA 3E3OA 3E15A 4R05A 4LG1A 4B31A 1JA1A 4LKOA 1HZZC 3W7BA 4JR2A 3HPRA 4BB9A 1JIJA 1NZDA 3E9MA 4FT4A 4IS3A 4ATNA 2PNFA 1CRWG 1H6CA 3WHIA 4RVHA 2H65A 1EE1A 2X4IA 3H1AA 3L4BA 3ABRB 2H29A 3F8TA 2Z43A 4L0CA 3AHDA 4C43A 1LBTA 4KAFA 2GDJA 5CFPA 4ARSA 5T7BA 4YP1A 1XN1A 1Z3IX 4IYJA 4RKQA 2NTJA 3U56A 2QPTA 4BNFA 3FDJA 4ZU1X 2BKUA 2XA9A 2HQBA 2YJTD 5CW2A 3BXFA 4Q6WA 1V8BA 4IIEA 3S2UA 3VUEA 2E48A 2EBWA 3TTYA 5FL3A 5TQVA 5CB0A 2I9PA 4C76A 3OHMA 3QBEA 1J9EA 2BHRA 4Y2SA 1U5AA 1JF8A 3C3BA 3JXEA 1NJ5A 2KX7A 4N5IX 5LUBA 3OJFA 2PCJA 5FDFA 1CNMA 2MHCA 3BK1A 2R47A 4FR2A 3WO0A 5KPJA 3OEEA 2R6HA 5EKTA 2AFVA 3DMGA 5EWLA 1KKMA 2RB4A 1GL6A 3E4DA 1BXKA 1EZZA 5I7HA 3BGOS 4EI2A 3LHDA 4N41A 4DKXA 5BMVF 1ORTA 3JRNA 5ED4A 2UXBB 1QO0D 1I2BA 1J8DA 1KTVA 3V2IA 3ZWDA 3CVOA 1E7RA 4CL8A 5A4IS 2YJGA 2FPIB 3BXZA 4IQ0A 2J6IA 2ZI4A 1E9VA 2ALJA 3HUDA 4DQKA 3HACA 1L3IA 4HB2A 2XYPA 5J2TB 3WLJA 1EJBA 1IZ0A 1Z39A 3R3WA 3R74A 2JD2A 4X95A 2QLJA 2PUBA 4C08A 4WVFA 4K6MA 4F2DA 1BX3A 3KLNA 3B2NA 4DDKA 4A8JC 2IYLD 2V8BA 5DHQA 4ID3A 2AZTA 1DUIA 2WZBA 1Q1GA 2I33A 2VCYA 1FSFA 1QIJA 3LXUX 2CCKA 4RANA 4DZRA 4WBNF 2WJ6A 2BBOA 3N87A 3NP7A 2Y27A 3HB4X 1T6BY 2DQSA 3R40A 1W25A 1J2RA 3D6VA 4D4MA 5HZHA 1F7UA 3C74A 1SOMA 2AFHA 3COWA 4B6GA 3D2LA 3P2KA 4Z9BA 3AL0C 2GCEA 1K3TA 5AOVA 4OVKA 3STYA 2R4QA 1RIIA 1GAWA 1K88A 5FL7A 1BW9B 3AKEA 1NG1A 1S2LA 3HY3A 1W8IA 2W48A 1TJ5A 3D7RA 2QP9X 1IZ7A 3Q12A 1OZGA 1DRJA 5JNTA 3ZE7A 2DECA 1ZJ5A 4MARA 1K63A 4ENQA 3BL5A 4RVGA 4B40A 1XZLA 4KXXA 5BOSA 3AW8A 1OWPA 2QNIA 4N3BA 5I9MA 4EGFA 3EMDA 2BYTA 5I01A 3HRHA 2OQ2A 1NNI1 1Z4IA 4HWPA 4ZO9A 1PJRA 2IRWA 4PLPA 3BDAA 2YRXA 1DAHA 1RC8A 2PH1A 721PA 3BXOA 2PPLA 2JNWA 3NAQA 3U3RA 4YDHB 3HN7A 4EFDA 1W44A 4PWYA 4QFDA 3WLTA 2B4RO 4FK8A 3UO8B 4EF5A 4H0CA 4EAAA 1AV6A 2QMZA 3DKKA 1OV6A 3B6EA 3QRWA 3FFXA 3KFLA 5COQA 3S2EA 3GLHE 5IMSA 5ISMA 2VDOB 4IWYA 1XGKA 2QL5A 3WJ7A 4YJ3B 5CH3A 5K3FA 3VI3B 3ZY2A 3QVUA 3U37A 4W5WA 3CFYA 2RI0A 2WE8A 4ZEVA 1ZJYA 1G3UA 2XYVA 4HC4A 4JT4A 4GL4A 4OBEA 2Y1CA 5FUYA 1V0JA 1OLUB 3AGQA 3WR5A 1KHHA 3WK6A 3T3DA 3V34A 1QU3A 5D3MA 1ICIA 3QVSA 4GP7A 1ZUD1 4PE5B 1ZNXA 4IX1A 4BMPB 3W5SA 2OAGA 3UJBA 3R5SA 2X76A 3HJHA 5B4VA 2VDNB 3RCBA 4QWWA 2VUTA 3E9ZA 4OHZA 5KNDA 4EEKA 2C2XA 2PGDA 3DL7A 3NBXX 5T57A 1JSZA 2ZPTX 3ZDCA 1TA4A 1GR1A 2J3IA 5HNKA 1DEHA 1JLRA 2BCGY 1N0HA 4MSUA 2IYFA 1H94A 4KIJA 4TKVB 4XJSA 5ITZB 3JPYA 4J9VA 3KTAB 3L0PA 2WAAA 1T8TA 1SCQA 2RHRA 3EGDB 4E5NA 5C8ZA 1Z15A 2VP5A 3RKUA 1B3RA 1GXSB 2GZMA 2Z5FA 2YMMA 3G59A 1K97A 2YHSA 5EQTA 1MHTA 1FOEB 5BSTA 3K0AB 3AVPA 3QVGB 2RI1A 4KUEA 2F1OA 2VUUA 3INNA 1VG1A 4C22A 3AGPA 2B3TA 1DL5A 3DFKA 4JJ4A 4DA9A 1RJDA 2VK2A 3EZ7A 5HIMA 3UUWA 2WD7A 2QW8A 1IXRC 3HP7A 1Y3IA 3EY9A 1DAIA 4BOYA 3FOEC 5LYJB 4BJ3A 1Z0ZA 2CFIA 1GGHA 3DOOA 3W78A 1HH4A 4Y9DA 3PQ2A 1OLSB 2VCEA 1WBDA 5KNCH 1M2EA 1JR4A 5FLKA 1J09A 1E2GA 3H19A 4IXWA 4ZIRB 4AI6A 3LQRA 2BR3A 4WY8A 4W8HA 5AXBA 2V45A 4Z4GA 5D51S 3VPGA 1WXXA 4M7PA 5ILGA 4KR9A 2ZZNA 2XYQA 5I51A 3A6EA 5K2OA 1C7IA 2NZWA 2A9VA 1U0JA 1I3OA 3D8TA 1M2OA 1II8B 1T36A 1ZK0A 1W4AA 4Z99A 2DHDA 4FWBA 4GLLA 1K5HA 2YY7A 1LRJA 1HE8B 1G7CA 5BVHB 3AU8A 1GLGA 3PEEA 1MC8A 3QWBA 5CXUA 2O7RA 2QV0A 3RREA 1GDHA 1RW4A 1MA3A 1NV9A 3V2HA 4K86A 4Z3DA 3R9IA 5K0EA 4A10A 3MNFA 4AC9A 4NFLA 3RYHB 4B48A 4LWPA 5DHFA 4F84A 5AJYA 3T34A 4AZTA 3P96A