1RC0A

Human gar tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
publication title Human GAR Tfase complex structure
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1rc0A00
1MENA 4S1NA 3LOUA 1RBMA 4ZYXA 2YWRA 4Q12A 2GARA 4QPDA 4ZZ3A 1GARA 3TQRA 5J9FA 4ZYTA 4ZYUA 4ZYZA 3AV3A 3R8XA 4TTSA 3GARA 1GRCA 1CDDA 2BW0A 3AUFA 3OBIA 1S3IA 5J63A 1MEJA 1C3EA 4EW1A 1ZLYA 1CDEA 4ZZ1A 1NJSA 1MEOA 1RBQA 4YFYA 4ZZ2A 4ZYVA 1ZLXA 3N0VA 2FMTA 2CFIA 3TQQA 1FMTA 4ZYWA 1RC1A 1C2TA 3P9XA 4TS4A 1RBZA 4EW3A 4IQFA 1JKXA 3O1LA 1YRWA 4PZUA 4ZZ0A 4TT8A 1RBYA 3Q0IA 1ZGHA 1RC0A 3W7BA 4R8VA 4YFVA 2BLNA 3KCQA 4DS3A 4QPCA 3DA8A 4NV1A 4EW2A 3NRBA 4ZYYA 3DCJA 5CJJA
chains in the Genus database with same CATH superfamily
3BAZA 2A9KA 2ZYHA 2LBPA 3BYZA 2NVUB 4M8KA 2X2EA 1SU4A 3AHHA 5CYPA 2EOAA 4G9GA 5A02A 3UCXA 5EYPB 1FTNA 3CCFA 3I05A 4ZO4A 1EP9A 4MJXA 3JWJA 3AM3A 3RJMA 3ZJ4A 3DNPA 2DLCX 1A9TA 3L3BA 4D4KA 3ABSB 1QFJA 5FBRB 4YAOA 4TSFA 2C3PA 1ZN2A 2MJLA 4QXAA 2NTNA 5K8IA 4E2ZA 1NW4A 3K15A 2UZ1A 4AUKA 5EP2A 2NIPA 3OI7A 1YHYA 1YR8A 4KRGA 4EF5A 4YIKA 3RRFA 5JZMA 4UBMA 1E2EA 2Z95A 5CJJA 2Q2QA 1N4AA 4ZAXA 3V8EA 2WSSA 2Z8XA 4KPUB 2LR0A 3EK2A 2QYSA 4DEYA 5BWLA 2X8LA 3HVJA 3A25A 4IIFA 3H9EO 3W8EA 2HK6A 2HDWA 3M5WA 1TE2A 1Z6AA 4KGXA 3DHNA 3ZS8A 1TVKB 2PX0A 4RY0A 4XEUA 1RAGA 4D57A 2FEXA 3DE2X 4F2HA 1FUUA 4ENPA 4IHJB 1TKCA 4RZXA 2AI1A 4I55F 4RX1A 2IP2A 4ZAWA 3WZMA 1S02A 2M9MA 5G1PA 1N3YA 1R0RE 3OUTA 3KVYA 1ZSNA 2HMUA 4NENA 4Y2TA 1PFVA 1ZH6A 3SJCA 1ZH2A 4N9QA 1K75A 3LQFA 4YRKA 2WUWE 1RYHA 2HU7A 4OMCA 3UNXA 1M8KA 1M7HA 3ELBA 4NYIR 5IABA 3UBTA 3IMEA 2OYRA 1KFBB 3EXEA 4RVDA 3LXMA 5ILOA 1TLFA 2CLMB 3EG9B 4G5SA 4H7HA 1RFLA 1BH6A 1WMDA 1T9AA 5BT8A 3WHLA 3GO4A 1X7YB 1EGMB 1IZ7A 2ZI5A 3EY9A 3IPCA 2AEMA 1ZINA 4G01B 3KTAA 3HYSA 5EXEA 5EC8A 2QN2A 3SEAA 3D8HA 3AR9A 5BWNA 3CQ9A 2XSZA 3JR3A 1CQZA 3KXPA 1GWNA 5A1JA 1TQ8A 2AUNA 3JWGA 1R64A 1RM3A 4G0UA 5K3DA 5JG7A 3VJLA 4YRAA 2CNWA 2QL7A 3NEAA 2OFOA 2JLRA 3KNZA 4BCDA 2BHSA 4RJTA 4XX0A 2XNKA 2AOTB 1G7RA 1RJFA 1U0RA 2EZTA 4R2MA 1Y4UA 4TROA 3IIIA 1KFCB 4DSOA 4G81A 5KNCD 3PNKA 4MWZA 3INNA 3WMRA 2HO4A 2ZITA 3UJDA 4CDMA 3SQLA 1DLJA 1LLDA 2CHGA 5LBIA 1QUFA 5BV1A 2H3HA 4MI9A 4TMWA 2J87A 2ZCJA 4KIJA 1HDGO 4GPTA 1Z82A 2YRWA 3A1EA 3WLTA 3ZOKA 1WB6A 2GHRA 3RR2A 1C9YA 3ZWDA 2BZ1A 3CSUA 4EPTA 4ZVNA 3U7IA 4LUCA 1YCHA 2OC9A 4DILA 1SOWA 4RETA 4AS1A 1PWEA 3OHPA 1LPSA 3MS4A 4IJMA 1EK6A 1FDOA 1NMSA 5EEHA 5JAMA 4CEHA 1EFVB 4KI7A 2BGGA 1I33A 3L6RA 3P52A 2JLYA 3K1ZA 4TUYF 4HN4B 5HFNA 4K0KB 4KLZA 2VZEA 2H5EA 2YOGA 3KCNA 3RIHA 1A9QA 1QTNA 1Y6JA 1HLGA 1ZCJA 1JDZA 1W1WA 4I99A 4LJ7A 4Q19A 4JI1B 4BLWA 1E5DA 4B17A 1Y1PA 4JS0A 4OKSA 2ACEA 4INJA 1OQAA 3B1YA 3L5OA 3HWSA 2YUIA 4G5HA 1NVUQ 4J90A 1JTFA 4C4ZA 4DLPA 1IJKA 5DHRA 4UFPA 2AC4A 1BXZA 2HXYA 1U8YA 2H59A 3EAQA 2HSWA 4OQFA 4GM4A 4L0CA 2WF8A 1R6XA 4UM8B 1HNWB 1UAYA 1W0KD 3V34A 4LX8A 1OXXK 1N8NA 2CYBA 5DBGA 2P4UA 1KP3A 1NMXA 2O5EA 1Z22A 1G2PA 3GD5A 3MGCA 1KIFA 1LZKA 4P4UA 4WCFC 4DUZB 1P0QA 2PGAA 3F3MA 3OKAA 2ZPUA 2V7PA 1UBOS 3SC4A 3D43A 3OFSA 4CKCA 1SWWA 3U49A 2OO7A 4HDRA 1AKEA 2Y2UA 2JJ2D 1NYLA 3QWBA 4FHZA 3FI9A 5CB4B 1OXUA 1JAYA 2NU8A 4ROTA 3RYCB 1YAHA 2CEAA 4Q9AA 2Q6LA 1GL7A 1B41A 4CGYA 4CT5A 3QLTA 3QPAA 2ZJOA 3UB4A 5B4TA 3OTHA 5ICCA 3STYA 4LSWA 4R98A 1NZJA 4PPYA 2J6HA 5LZ4A 5ALHA 5ALDA 4UBOA 1RKVA 2ZIZA 3R5SA 4HDSA 3SY8A 3T3IA 1NBWB 2WTBA 4CTKA 3K0FA 5HZKA 1WKBA 4B3XA 4KZPA 2BHTA 3TZKA 4KDFA 4LXQA 4RFVA 1DC7A 1PYGA 4KLRA 1R4AA 4O4LF 3LYUA 5AVVA 2ZJ6A 1RSZA 2C2ZA 4RIEA 4NAHA 1P7VA 1G9TA 1N1EA 3MINB 1CHDA 4N5HX 2GPYA 1V48A 2O1XA 4NQZA 4JKIA 3RYHB 2O8EB 3W1VA 3F5QA 5T3YA 4Q9JA 3PRHA 1TUIA 4E46A 5JEDA 4U00A 3VTKA 2QTHA 5IBCA 3IR6A 1BG6A 2V6FA 1GGEA 1OBHA 2J9ZB 4FNGA 5BVGA 3R3YA 1RWPA 4EJMA 1G59A 4HH4A 3RUDA 1G5HA 1TZCA 4KR3A 3PNVA 2H9YA 5DT2A 1QR6A 3SP1A 3FROA 4O0LA 4CMHA 2XLBA 5TMPA 3KPYA 1Q21A 2VWGA 2J6IA 3SHTA 3Q88A 3G88A 2QQ5A 1JA9A 1OBCA 5CYGA 1PV2A 1RYEA 1PSWA 2REBA 3CNOA 2GPTA 2R47A 5TLSA 1NTRA 2Y8EA 4LC1A 3HXQA 2A0XA 4AN1A 1I2CA 5KQSA 4JOQA 1NN0A 2H48A 2OE2A 2PM8A 2ECKA 3RVLA 5FBLB 3HKDB 4ARUA 2HM7A 2LIPA 3C45A 1JEYA 1K7YA 3O6VA 4JQCA 3NJ8A 4IICA 2D7DA 2IYPA 1C3LA 4UU1A 3L8ZA 4Y1RA 3OUUA 3A6LA 4Q7KA 2Q99A 1EEHA 4RH0A 5IC5A 2EBWA 2ZWMA 3CONA 4DV4B 2Q6VA 1SM4A 3PHBE 2XDQB 1JJVA 1OX5A 2O5RA 3GEBA 1U2PA 3BKWA 3RQIA 2XBUA 5KAPA 4H2DA 3OQVA 1TJPB 2BR5A 4KGDA 4EG7A 2XF2A 3DBVO 1A7JA 1J49A 3TLGB 9MHTA 2P3QA 1GZHB 1J0BA 1YBHA 3B89A 3F96A 1SUEA 5ABPA 3ZK8A 5AVSA 1NM5A 3LUGA 2AUTA 1YB2A 1ZZGA 4WUTA 2XMDA 4LG1A 3OQIA 4DQKA 3J7TA 3UK6A 4U8GA 2NNWB 3P9PA 1JHRA 3VNSA 4A23A 5SZJA 4RSMA 3JX9A 3NDRA 5B7QA 4OXIA 2XDYA 1L7BA 5MFPA 1E7SA 4TWBA 5ESDA 1EAMA 2J6BA 3LCUA 2JGDB 1XK6A 3WI7A 4ZJUA 1NPDA 3JRXA 4BBJA 1PR2A 1XQ6A 3OE5A 5A62A 4JJFA 4PAMA 2HSJA 4LK2A 1H65A 1EFCA 1PFUA 2YX1A 3LX5A 4Q1BA 3U4AA 6YASA 3U61B 1AB5A 4RA6A 2GO1A 5JSQA 1I4OA 4M7PA 1I5OA 1X1EA 4D7AA 4OK5A 4B75A 3ACBA 3AHIA 2CUZA 3DBHB 1M34B 2QX6A 5FBKA 3SCZA 4ZOEA 2EZ8A 5CHEA 3OQJA 5CLFA 1H05A 5J4VA 4HBZA 4I9GA 5AHXA 5A0FA 3UMGA 1RMYA 3UFXA 5MGNA 3T9FA 4WY2A 4HMPA 5LLTA 4MYSA 4J0GA 1WDMA 4R1QA 3RS8A 3PQ4A 4BQIA 3RS3A 1XF9A 3ZU5A 3VHXB 4E2YA 2NT4A 2WIDA 1WQ1R 3H75A 4R9UC 5H9WA 2MSNA 1USKA 2XUQA 2XOKD 4CBVA 2YIJA 4IIDA 4ZOAA 4OB7A 4TMVA 2I65A 5LB4A 3F5FA 4LF6B 1CY6A 3WWZA 3FWNA 3BBLA 5EZYB 3R3JA 1XXHA 4BO1A 1VE9A 4WVLA 3AH8A 4ZYLA 3IDSA 5CFRA 4GXRA 1J1IA 2X13A 1EUQA 2BH9A 3HEBA 5CB6A 4BDSA 4A0FA 2F3RA 3W34A 2Z8ZA 4BO6A 3NIGB 4IDNA 1GQ2A 1KOJA 4GMKA 2GPSA 2PDAA 5ALNA 1KQGA 5JECA 2VOEA 5EWLB 3HCEA 2DQYA 1XWWA 1TZJA 2J5RA 4KDRA 2OD2A 1FRNA 4GSYA 4GLBA 4QG7A 1K8YB 1M6VA 3RAJA 4XYEA 3LWZA 4C0JA 1W52X 4LNUA 1IVYA 1Y8RB 5CEFA 4ZDKA 4H7DA 4JHLA 4KQ1A 4OH1A 4ENVA 1N5DA 1XDZA 4FYMA 4Y2SA 3GRCA 2QG4A 5KX5B 2ZG6A 3OECA 2PT5A 4YQYA 1DPFA 5ALZA 4CF5A 2MIIA 3AZPA 3BA6A 2H08A 2BGKA 7AT1A 4LQCA 1E2LA 1HQKA 2WFLB 1BO6A 2PHZA 5AM2A 1L4HA 1TAUA 4R01A 2I2WA 2PFGA 1EVZA 5DLYA 3REQB 3DCIA 1UAGA 1YJCA 1S2DA 3VYWA 1W59A 1E3DA 2HA2A 4OPMA 2I4TA 4KGZA 1JU4A 1VSUA 1QFMA 3IT3A 3M1AA 3NYQA 4PHCA 3VZCA 4NAUA 4ZGWA 3OFNA 1FE8A 3OP1A 3UXHA 3RC9A 1AUQA 1XU9A 2XE6A 3NT2A 1KZHA 1GFWA 1JQJC 1M10A 5IT5A 2KMLA 4UBLA 4HQ6A 2QB5A 5LXTB 1VB3A 4ND1A 5DTRA 1CS4C 1GPWB 2AQIA 1PW5A 3R9IA 1A5TA 4TV8F 3GWZA 5FNZA 4TS3A 1P2GA 4FOTA 2HK7A 4H1WA 3UTDA 2L0XA 5BSEA 2ZYTX 3LK6A 1CUAA 1VGRA 5IPFA 5ADHA 1VE7A 3Q3HA 4KAJA 4HRXA 1UPBA 1WOMA 2QXTA 2MSCB 3VDXA 5LC1A 4Q9IA 4FR0A 2BMFA 1CY8A 3FGZA 4IUBS 3SR3A 2WU4A 2VK8A 2A5DA 1QE5A 4GOLD 4GM1A 4GRDA 1EXWA 4QREA 2BFDA 3NATA 4N01A 2EHDA 4FYWA 3ZIAA 3VRHA 2GBIA 4MRSA 2RBEA 3WLKX 4H6PA 1FYXA 4PYQA 1B0PA 1EDZA 3OCJA 3R3ZA 2DH6A 3CRRA 3CX4A 4YCMA 4R1PA 2BFNA 2VT2A 3D3JA 4YUXA 5H8WA 2PXHA 1T1EA 4Y2HA 1E2FA 2D1FA 2WW8A 3OEHA 4YFYA 1L4NA 3LPCA 3RVRA 3WYDA 1QU2A 1T36A 1EUDB 3TK1A 1GILA 2HJVA 3U7FB 1WSWA 2BM9A 1JQAA 4MW2A 4B6FA 1I4DD 2VI5A 3D1VA 3VMMA 1YQEA 2WFLA 4OAQA 2LGJA 3WBKA 3SZMA 1UK9A 5KZMB 1EAYA 1E1YA 1E3EA 3OOEA 4L9WA 2V6MA 1V4NA 2P27A 1RPTA 2Z56A 2P9FA 1A8PA 3BWYA 4MQFA 2QLJA 4MVJM 4S1NA 1VXOA 4C0QC 1OI4A 2IP4A 2ZJ7A 4J3NA 4IRXA 3CLRC 5A4IS 2AC2A 3A1NA 4RXUA 1IRIA 4WH0A 1TKAA 1OYOA 2GCOB 4J1QA 2ZKIA 3AI3A 1W5TA 3DFFA 1KPGA 1TK3A 4AECA 5LZ7A 5FD8A 3VO8A 4KFCA 3EDOA 2HRBA 1JIIA 3R5TA 1DUSA 2VDWB 4OKNA 5BN1A 5TJHA 2QAIA 4GH5A 5A0TA 2OP1A 2EZ9A 3G8CA 3AW8A 3O9VA 2WM2A 3ZZ0A 3QP9A 4DHWA 1MOQA 3GOHA 2PXCA 1CR1A 5EKTA 4YPFA 4FM9A 4OQ4A 2X8JA 3MMNA 2XITA 5DX0A 1KAHA 1A9XB 2V98A 4OGGA 1H2WA 2VT6A 2FRDC 4U39A 2ZCVA 4NCJA 5G41A 4XIJA 2G8LA 5KTSA 3HMQA 1NBAA 2EG5A 4NCAA 4QGHA 4KR6A 2G5CA 4Q7QA 1GAWA 1XEWY 4OLHA 2C2GA 1VI5A 3HBJA 4FN4A 2NTVA 4IBOA 1WEKA 5ARDA 2KJQA 4FMBB 2X9LA 3P9KA 1Z7BA 3H9QA 4RA6B 1GLNA 3SXJA 4EHBA 5BN5A 3K6SA 1KH2A 5GZ6A 3VOBA 1A9XA 3GLIE 5AXBA 4HVLA 3T3GA 3S5JA 1UBNA 1IOWA 4F4DA 3OF2A 3WGMA 1ZW1A 1IEXA 1ZGGA 1JTEA 2ZQZA 1OH8A 3WRWA 4GWGA 2O9JA 1JSZA 1Y80A 3DKVA 4KO2S 1M1UA 3G2QA 2ARKA 4MYTA 4L5AA 4O4LB 4RLFA 3CF4G 3RGGA 1KDOA 4GR9A 3UJ3X 1N75A 4GR5A 1KDVA 3KKLA 3NTOA 4LVNA 1P4SA 1YK0A 2C77A 2ZBEA 2GAJA 1M3SA 1WZUA 1XZFA 3NP7A 2JANA 2PCJA 4TL9A 5AW6A 4PZ9A 5KVVA 2C59A 3EWSA 1V6CA 2MR5A 3GYGA 4TL8A 3FDFA 2UZIR 1SVUA 2HN9A 1GYQA 1QB8A 4LRUA 4PLPA 4E5MA 3V80A 2AG1A 3AETA 4YUYA 5C8VA 3LHIA 3VKFA 1IBKB 4J7AA 1R0XA 3X1JA 2HU2A 3D6JA 3PCTA 1Y9JA 1MXHA 1BVUA 2ZTMA 3MBIA 5GAJA 1SCIA 1E5QA 2VJMB 2B35A 2XH8A 2R60A 2ROQA 4TMZA 3VNUA 5CA0B 3TAUA 2F7SA 2QDKA 4BFVA 3EZXA 4WXMA 2JVIA 3T0FA 4DRYA 4GOND 5KTOA 4LOLA 2R1ZA 4DUPA 3LCVB 5JE8A 3H1EA 1VSBA 4H3VA 3HNRA 2G72A 3CHYA 4RMNA 4WKBA 3U26A 4OREX 4OQMA 2X15A 4J75A 2FETA 5TQ0A 3M8KA 5E2BA 1SZDA 3H5LA 1E2DA 2EJTA 4ZMBA 1QE0A 4OMUA 2JJQA 1ESNA 1RWQA 3QITA 1QNFA 4ZRDA 1WDTA 4KQ9A 2W98A 4UDOA 1FDTA 3L0ZA 5HCUA 3TL2A 1NNI1 4TOIA 3NCTA 4XGIA 3SIWA 1GZVA 2DKNA 5JO0A 1IUOA 3WKEA 1XHFA 3SLGA 2NZXA 1FQKA 3KC2A 3WNZA 3E4CA 4M1QA 3FNIA 5AKKA 2ZZNA 4HYQA 4JLVA 4R2XA 3ZJ5A 4NJEA 3W5JA 2PKWA 1N5MA 3MLEA 1A72A 1BWPA 4BGVA 1SHTX 1YWGO 4DLXA 1ZISA 5K6AC 1KBZA 3D8RA 1KZ9A 3QVOA 1XEAA 3AR5A 3CO5A 1W2GA 3F2IA 6REQA 4RO0A 5BNIA 2PO7A 1W4ZA 4MHOA 1YB5A 5B30A 2R1TA 1IQPA 4HGOA 1KVSA 1REQA 2H2AA 1SXJD 1RYZA 3F3YA 1CR2A 1TD9A 3N2GA 4NBUA 3DMRA 5ER9A 1Y82A 2WC1A 1E8NA 1RVV1 2XVYA 2PUVA 1U1CA 5HUHA 2QUBA 2N75A 4DLTA 1GL3A 2WHQA 3B5EA 1ZI9A 1H2HA 2QSZA 1XRRA 3MWKA 3GQVA 4HAWA 3TJMA 1O9HA 2CCKA 2HSEA 2OHVA 2XRZA 4ZI7F 4GP7A 4RPCA 4DRZA 1OW3B 2J0QA 5JQWA 3PWTA 3VKHA 721PA 1F5SA 4O4JA 4BNWA 1E66A 3I5UA 1KMMA 3I2FA 5K3SA 1LNQA 3AT1A 3ZV7A 4PZEA 1WS6A 2VZ0A 4Z1MD 3EVEA 1DHRA 3EEOA 2ZZKA 3MJ4A 3DLAA 3BXZA 5DH9A 1EP1B 1QGDA 3HZRA 4Q4JB 4YMIA 1ODCA 1GVHA 5EE5B 1QHXA 2PAAA 1NBIA 2V96A 4AFNA 2Y1CA 2AZ4A 1O94D 3PPXA 1HG1A 4FMDF 3DPSA 4RL6A 2J85A 1E3LA 1QANA 4N8DA 3CLUD 3WL6A 4E2WA 1Y1SA 3EQ9A 3RYFA 3QKSA 1WF6A 4WX2B 1ZITA 4WKGA 4C0WA 3TYXA 3THXA 3OQBA 5L7WA 1Z0SA 1M1NA 1UDWA 4WJKB 3CJQA 3LRXA 5EXPA 1UBSB 5F4BA 2QRZA 3AJAA 3BILA 3ODPA 4CMEA 3F73A 1P7YA 3KOUA 2J08A 2HIAA 4BEJA 2P2CA 3PX3A 4F3NA 5I4KA 4OQDA 2LKDA 3ONWA 1M0SA 2BSQA 1R10A 3H99A 1G8PA 2JCVA 4LGMA 1UBFA 1ZHFA 2YV1A 2XD4A 4PSDA 4AWAA 3TTTA 3JVVA 3KYIB 4LPSA 2ZJ8A 1Y34E 3DEZA 5H4HA 5I7UA 1DBWA 2FW8A 2RG1A 3JQ8B 4B43A 2VAXA 1ODTC 5K8VA 1JIVA 4G84A 1ZH0A 2HA0A 3G7SA 2J31A 5DRTA 5HF5A 3U2QA 1A27A 1C80A 3IAM6 2PMDA 1TU4A 2NO0A 4D43A 2HWXA 3H5RA 5DGTA 3ZWPA 4PVCA 1HE8B 2X5JO 1B3RA 1FP6A 2XMPA 3M4NA 1DXYA 3EGXA 1L5GB 4AXBA 3SDZA 4KKXB 3OAAA 3CX3A 1I7LA 3G0CA 3R20A 5GM2A 1RWWA 3PUZA 2QQ0A 5A2QA 2VG8A 1JIJA 2C83A 4RE6A 1ETHA 3FNBA 1E2GA 2P4SA 4R1SA 4C2TA 1EWKA 1WL8A 4CWAA 5LWHA 3VAZA 3RARA 5TARA 1VJRA 3T61A 1UOPA 3IELA 4UHFA 4EAQA 4WASA 1SD5A 2B0JA 2ZYVX 5ESXA 4FLEA 2SICE 4LEIA 5EIOA 3ZBTA 2VPPA 2O4CA 4FK8A 3QY0A 1QTRA 1OH6A 3H2YA 3NNNA 1YI1A 3P8ZA 2YCBA 1BXKA 4FQ5A 3E8XA 2CC2A 2D59A 1ICEA 4I5IA 1UBGA 1G2IA 2XKAA 3WO1A 1NSTA 2P2ZA 2XNDA 1RM4A 4RIHA 4WESB 3OU2A 4E2XA 3DKRA 5TF4A 3BZBA 2XBMA 5H83A 3LHDA 5KJFA 4CQMA 1F1BA 5H0IA 3MF4A 4Y9UA 5CYFA 1U0LA 2C3UA 5K4GA 2NUPA 3YASA 1LPNA 2G9UA 4Q5IA 4TWAA 2Q0SA 3VSDA 4DQ0A 5FWDA 1OXBB 5COAA 5DE3A 1GDHA 2BW0A 2GBLC 1LFDB 1H85A 2QTBA 4N0EA 4ND2A 4U7FA 3UT5B 4D9MA 4JBYA 1GLGA 1UKYA 3N0TA 5HIAA 3KQUA 2DUUA 3AZQA 4TPKA 1EVKA 3IE2A 3MSCA 1UFQA 2F9LA 4XQEA 4YV7A 4ZDJA 2W70A 2W6MA 1RDFA 4JBLA 1MGOA 1C0IA 2BIFA 5TSDA 4IZHA 3W5VA 3H2ZA 3WV5A 4EEKA 5CFNA 1V2HE 3HUDA 1Z68A 4WAUA 4IVPA 3IYLW 1Q0TA 2FQYA 2HL6A 3IJ5A 4F5ZA 1KDZA 3AUKA 3MGGA 3KD3A 1F14A 1X1AA 1UPXA 3PKZA 1X8LA 5C0OE 5F2NA 5DGHA 1G2OA 2R1UA 2FY8A 2ZJ1A 3PA6A 4BVAA 4OFZA 1XLUA 4QA9A 1E1DA 2PZEA 1ZIYA 3MW8A 3H2KA 4MLZA 3T3MB 4BMYA 3KZOA 1JH8A 2OAEA 3OZTA 5DWQA 4EUSA 1ZK1A 3GMTA 2C5BA 4GKAA 1NFRA 2QMOA 3R5HA 5E2IA 4BP1A 3DTTA 2CZGA 3NUQA 4NNPA 3D31A 5GIPE 4GOJA 1GNSA 2HCJB 3HEMA 3USES 3TINA 1VKJA 2AMFA 4F3YA 1PT8A 3X44A 5LU8A 2W2TA 4RY2A 3RTBA 4IDFA 2XCOA 1NW3A 1P4JA 3KJGA 5FORA 1EA5A 4FONA 4AKTA 1BAPA 3TLXA 2GK3A 4YTEA 4ARBA 2PQ0A 1REQB 1OF1A 4AJ9A 3B8EA 1Y42X 2V3WA 1H4SA 4BCCA 5AI0A 3BFKA 3RYHA 2C57A 1F6WA 2IRWA 2I80A 2RGUA 2YHUA 3HGQA 2BFFB 4GNKA 4WT7A 4D96A 5IF3A 3TF5A 1OBVA 3FYUA 1BCSB 4G23A 5SYAA 1Y33E 2C4VA 5EKDA 1JQKA 2HSZA 3Q9NA 4ZQFA 5IH7A 1Y6ZA 1XFAA 2FN3A 1A8UA 5ER6A 4Y2RA 5LQJA 5BSFA 2RB5A 2ZB8A 3QU5A 2AQHA 3TQCA 3PQ7A 3VFDA 4MHSA 2NWQA 1NXWA 4MIEA 3IRUA 3DDHA 3LKDA 4H17A 2FRDA 4MO2A 5DGIA 3DHVA 4ISCA 5JBIA 1ZSVA 2R7AA 1W581 1YZKA 3EFBA 4J16A 3GA0A 4QYIA 1O58A 1BMDA 2O7RA 3FUCA 2B9VA 3OIUA 2KQUA 2IY7A 1JDUA 2BEWB 1Z5GA 4RJIA 5BW6B 4B6SA 3K3PA 1ARZA 4FMCF 4X1KA 3WWYA 2N42A 3FDZA 4M0PA 4EYQA 4DOMA 4ZCRA 4DBLC 1J09A 1M2JA 4MVJD 3D0KA 1PI3A 5JY1A 4Y2XA 3KL2A 1MP0A 2OBBA 3C5HA 2XWPA 2DUWA 1DMSA 3MTDA 3DV0B 2I1QA 1CRZA 4GMDA 1KERA 1DARA 3CRZA 5F78A 3TVTA 1GPMA 3EVAA 4YONB 5A7HA 1NBMD 4NE9A 4KITB 4JV5B 1BZYA 3E9DA 2GFHA 2Q3EA 2HHCA 3OFVA 1VYVA 3FRHA 4OVKA 5ICFA 3R9XB 5EZYF 5E9QA 1P61B 4KXVA 4HB0A 3DFUA 1F2TB 1ZIXA 5DNDA 4K3VA 3AOEC 4IO1A 1R15A 4F5EA 2C2YA 4OOFA 5E6SB 3VR4D 1GFSA 5K3FB 2VJKA 3LQYA 1KZ6A 1R0WA 3PHCA 1BWSA 4EQ6B 3A0UA 2WU1A 4R51A 1XC7A 1NG9A 3FSGD 3QPDA 1ZOOA 1A8HA 1BKSB 2FWRA 5KAMA 2GVZC 2R4UA 1IMOA 5D87A 3W04A 1OH7A 4UTOA 2OL4A 2O5CA 3AKYA 1UZMA 3LUBA 2FPKA 4NG5A 5D86A 5T8KC 3ZHOA 3OLCX 2GK7A 3W5HA 5J1SB 2J59A 4NYJR 4DV5B 1EHCA 4IXMA 1F2UA 1SXGA 1Z18A 2EW1A 2GLTA 3JVUA 2D3TA 2HAEA 4LC0A 4P5DA 5CVJA 4QU5A 3ZG6A 5L7TA 4FZ5A 4LCJA 4MRMA 5K0BA 3D4OA 1DO2A 2FFRA 4YJ3A 4PSCA 3Q7TA 1KDRA 4YP6A 3TPCA 3TOVA 1Z4IA 1VKNA 3TMAA 5SZIA 2YWRA 4MA5A 4HL6A 1WCYA 4Y1EA 3IKMB 2FF7A 3F71A 1FSFA 3QKTA 4GC5A 4MV6A 4KL8S 4PSVA 4RAOA 4UTZA 2AOTA 4OHOA 5BN5B 4FVTA 1KP9A 1ZMOA 2VPWA 1E3TA 4DUGD 3L6EA 2XGSA 3T4EA 3ESAA 1SQ0A 3BXGA 2TS1A 2XY4A 1CRLA 5CLLA 1VL2A 3PT5A 1UBLS 4UUOA 3SR0A 5GADl 2P6OA 3AY7A 4FLFA 1OYWA 1Z6QA 1CLEA 4LGYA 4DC0A 3RVDA 3EIWA 1MJNA 4XX1A 4OHKA 4XWOA 4K88A 3ES9A 5AVZA 3MTGA 4P7KA 5BQ3A 4K6FA 4XM1A 4YWHA 3AF6A 1RJ9A 1MUUA 3QE9Y 3CRNA 2FPMA 2FUCA 4D45A 2IYXA 3SG0A 4B3JA 2NZUG 2VBCA 2AR9A 1HL3A 2CL6X 3E5RA 1WP9A 2G6BA 3HCRA 3EASA 3WK7A 1HGXA 1QYCA 3SX2A 1CB0A 4HDOB 4ES6A 2ZBQA 3A26A 4D41A 2X77A 1XALA 4OSOA 4OXRA 3D4LA 4M87A 1NP3A 4UCXA 3GXOA 4XFKA 3RVOA 1OHHA 5CITA 1JYEA 1R18A 3DO6A 4OHWA 3GGPA 4YR9A 4DV0B 5CDYA 2IX9A 4K9RA 1A2KC 4QULA 1I5EA 1BYIA 1Q91A 4D0GA 2WHXA 2XDQA 4U1RA 4E08A 2AXEA 3ABOB 2B3TA 4QPJC 2ZT7A 3BTSA 4DVGA 5DCUA 1QFXA 3JAKA 4IS3A 4EW6A 2P40A 3R1IA 3INRA 3KKZA 3AX6A 4BMXA 5EP1A 4CTJA 3DB1A 4RWZA 4IF6A 1L5LA 2Q5CA 2FZVA 2Q46A 3D3WB 2FP4A 1TCAA 1NGSA 3EGIA 3K9QO 3H5TA 3C3YA 3FIJA 4BNNA 4REQA 3ZHBA 4L3VA 1GHTA 4K9KA 4Q34A 2J48A 5LQRA 2QI9F 2I5PO 2JZNA 3JYNA 3VR1A 2OBXA 2ZTHA 3GLSA 1QFZA 3R7BA 3M89A 3EEIA 4TRRA 5AM1A 4YDHB 5IJZA 2DLNA 2IDJA 3NJRA 3RNLA 4H6XA 2ZBGA 1EFLA 3RU9A 1ZXBA 2AHRA 4MS3B 3A1FA 3QW2A 4KMMA 4YLGA 4B40A 4JCCA 5I3ZA 4X62B 4IJQA 2ZAYA 1Q7RA 1VXRA 3E48A 4K6MA 4M1MA 3EGDB 3BZUA 3ZK7A 3GFVA 2EX0A 1RLUA 2JFZA 2PSEA 3C97A 4QDOA 3O3NB 5GJCA 1U0FA 4ARCA 1S6YA 3QXSA 3OCZA 5F12A 1KS2A 2VKQA 3IQFA 3WBFA 4WN9B 4BOYA 4DCPA 3HDTA 3LOUA 3FCSB 1WABA 5CVTA 5BQFA 4MWBA 3MINA 4HAZA 3ECAA 1IZ8A 3C41J 4JUBA 1ND5A 4KLCA 4N3GA 3JW8A 5ELMA 2PWBA 1X2EA 5EMMA 3TKLA 5KWIA 3QX8A 4NKRA 5FEMA 5D3MA 4M55A 1ISPA 1NKSA 1TVCA 3QMVA 1GZ3A 2R97A 3LFTA 2BAGA 3H11B 2GBPA 1IPHA 3EYAA 4OKIA 1VC2A 4G8CA 4IQ8A 1D04A 1JGTA 2XVXA 4LDNA 4MUFA 4B9AA 1W36D 2FX2A 1MVLA 4KPGA 3FLAA 4BZWA 1T3LA 4MUAA 4B0PA 3Q9UA 4NJMB 3DPUA 2O2CA 1U5BB 2YQ5A 4TRNA 2GWRA 4PZYA 3SKXA 3FGPA 3WMWA 4WZAE 2O8FA 3G1TA 4I36A 1XRJA 1JLMA 2D5CA 2O0LA 3OMWA 3PGVA 4N0PA 4BJ3A 1NLFA 1TM1E 4C3VA 1WCIB 1C8BA 3P2YA 4IR7A 5AD1A 1FNNA 4WLEA 3IVXA 5MHTA 2QTNA 4I8IA 4EI9A 5EJMA 3DE4X 5FUWA 4P22A 5FA8A 1Z2EA 1V35A 2WFMA 4TSFD 5T6BA 4HUQB 1IQRA 1ZAYA 3SJUA 1LK5A 3UMJA 1P19A 4I1RA 1C30B 5AI6A 5DM4A 4ASUD 3SLKA 3UUFA 3ELWA 3PZRA 1CUHA 1M6VB 1NAHA 1T3ZA 2B25A 2CCJA 2V54A 3HY3A 1I1HA 2WM8A 4E22A 1JR4A 4JHXA 2PLNA 3E9ZA 5ADWA 3I73A 2CGEA 4EFLA 1U0BB 1Z0FA 4QOJA 1LPAB 1UK8A 4X95A 2VNKA 4B4VA 3KR9A 2VJPA 4F86A 1GAEO 4C76A 3SBDA 5DOVA 1Z4JA 3ISJA 5KNLA 3A11A 1T9CA 3H7AA 1J0AA 3X43A 1ILEA 3QHQA 3SX4A 1YRYE 2GCEA 4WBSA 1O0CA 2HQ1A 4ZU1X 4PX2A 4K2AA 4CLRA 1DCFA 3LF2A 1IN8A 4BASA 3BT7A 1XEXA 2NNLD 3ZLUA 5DB4A 2CLEB 3W2GA 1QU3A 3E4DA 1IHPA 4PLZA 4B73A 1ZMXA 2AFVA 3EF1A 4FFVA 2J4CA 2ZJFA 2OO5A 2AEFA 1O5IA 1Z36A 1RWVA 2CK3D 3BWVA 3EAFA 4QT0A 4TV8A 1J2TA 1UEIA 1UL1X 2ZT5A 3DKKA 1Y4SA 3QF4B 5T4BA 3FMPB 4NABA 3HDVA 3SXPA 3ZLVA 4EA9A 1NMZA 1QJCA 3R7WB 4XR9A 4DWJA 3SF0A 3PNOA 3WGJA 2DWPA 2Y1LA 4AN0A 1KMHA 1K6JA 1X14A 1KZ4A 2WB4A 4JUFA 4EKEA 1FS4A 4TRJA 1H5NA 4JSTA 1CUJA 3ZY4A 2LUOA 3UZUA 1BMFA 5HKBA 2VDVE 3H9CA 3T3EA 4PGMA 1U9IA 3MAGA 5FNVA 1GO2A 1KP2A 3L7DA 2H06A 4DQXA 1ECCA 1YC5A 1ESZA 2W6ZA 3TJZA 4AZ0B 1CVRA 5ARBA 1TEXA 5K6TA 1HV8A 2WF7A 2OCAA 4NCNA 4DLKA 3MJSA 1BX1A 4YQEA 1Z35A 2GOYA 1NIPA 4H27A 4HWPA 1EDOA 3O8QB 1WKVA 3UTCA 1EGHA 2D0PB 1PK9A 1UQRA 2X4GA 1TCUA 2BUBA 1UWCA 1BXRA 2A9QA 5KNCA 3ICVA 1JA0A 1JU9A 3HV2A 1KMCA 3OVMA 3GFPA 4DG9A 2ANBA 1OASA 4FKMA 4P3NA 2CHUA 4QOFA 4YYZA 3TMKA 3KFXA 3RVMA 3KPWA 3FCAA 4Z7JA 2FWAA 2PY6A 2QMEA 5DHSA 4FHFA 1ZUNB 1H2ZA 3F8SA 1SPXA 3ZGYA 2E5FA 4NNJA 2UDPA 5AW7A 5L53A 5JAOA 2C1ZA 4C0XA 4BFCA 3I9LA 3HU5A 1EB9A 2YZ7A 3OA0A 1NJ2A 1FMJA 1PJCA 3RW9A 4I4IA 3EZGA 4OBBA 4Y0VA 4S12A 2IHJA 4JBXA 2PBRA 1ZKMA 2O8CB 1MG0A 3BS4A 4PX5A 3QMPA 1S3GA 1J2JA 1OSNA 2Y0PA 1R3UA 5G4KB 1RWKA 4HNAA 4N0QA 4BO5A 5BYAA 3RCBA 4W9MC 3C6QA 4EI2A 1JA1A 3HY4A 3MIIA 4C89A 4LVOA 1F2TA 3DFIA 4XOUA 1EP2B 2ZCUA 4OHMA 4BQEA 2ZYAA 1K3FA 1P80A 5DP2A 5EESA 3UJCA 1ZO8A 2E4WA 4GGPA 3ZDYB 4ZHSA 1TYDE 4AI6A 4DT1A 3P2MA 4HPXB 1YR1A 4F45A 3GJ0A 3KSDO 3KS9A 2IF0A 4Z9XA 3THOA 1MZVA 3QGMA 3WRXA 1AQLA 1U7HA 2G63A 1JB1A 2E1PA 2VCHA 3KZMA 4M1SA 1UPUA 1G19A 5L3QB 3CMCO 1L5KA 4EB6B 3G7NA 4HYTA 1E2QA 1YZVA 3LT0A 4U7JA 3GW8A 3UHOA 1J6UA 3RYTC 4C6TB 2IS6A 1WF3A 3A6FA 2LKCA 3UF0A 4D0LB 2HF7A 1KGDA 1JI3A 1P1BA 4FI3C 4G0PA 1AA6A 4KE6A 4OYRA 3QBJA 4ND4A 1RHRA 3NHBA 4Q82A 3UHAA 4EW2A 1ZN7A 4HQOA 1LUAA 4A4DA 3NHPA 1BRMA 3K9LA 1Z0AA 3BMXA 3M4JA 3NC0C 5FADA 1CZOA 4ARVA 2VP9A 3E22B 1SBYA 4JQOA 4QBFA 3E2IA 4IMIB 1K1EA 1K97A 3VV2A 4O2LA 1H94A 3Q0TA 4X8HA 5KOJA 4BXOA 1TLTA 1DCMA 1HLPA 3A58B 3LLVA 3AHEA 5G0SA 3T5DA 4CMAA 1G5FA 4WBNB 1YA4A 2AMYA 1L4GA 4OHZA 5K0GA 1G5TA 1DAOA 1JG7A 3Q2KA 4LXHA 3R0XA 4PYOA 3W06A 3J81A 4FCWA 5D2CA 4IM7A 1FFGA 3UKOA 3QOXA 3BERA 5AJWA 2YNMD 3D64A 1RR6A 4JP2A 1EUYA 3KLPX 4MUIA 5CEJA 4H3KB 4JJ4A 3T4XA 1E1QA 1FRVA 2E87A 2WD7A 3UK1A 3CVOA 1YDEA 2HJ9A 4MPRA 3HVRA 3L7JA 5LDHA 1QUEA 2ENUA 3I3OA 1VLVA 3QFHA 2WT4A 1X70A 2R85A 1IB0A 1PS8A 4P53A 4RDCA 2TSYB 1PJRA 3OTOB 1Z5VA 5KS2A 4OI0A 4TX1A 4ZU3A 3ZHSA 1MFZA 1PSZA 2B4TO 1IL0A 2IKQA 2H3EA 4JFAA 3RJ9A 3B2QA 1FSGA 1BJTA 3RTGA 3W4IA 1XNRB 2D4AA 3ZD7A 1ENYA 2Q5OA 2BCJQ 2DTEA 2P67A 2RGGA 3WJ1A 1YE5A 1ZFNA 3FG9A 3GJ7A 5HE8A 3KLBA 5P21A 3RAGA 1YS4A 1TW3A 3CXRA 2ZUTA 4PX3A 1IN4A 1KMNA 1LTHR 1YUNA 1G42A 1T5BA 2OGSA 1NHWA 3LZDA 1LI4A 4OBWA 4RZ3A 1NPTO 4NMLA 3WLNA 5CXUA 3KHSA 4Q9DA 2QX4A 3D0OA 5A6SA 4B7CA 2PT9A 3NVMB 2HA6A 2IZ7A 4IW3B 4R1UA 3G9ZA 3MRXA 5T67A 5HKOA 2PX5A 1AKYA 1I1NA 1U1IA 1XQWA 4QIHA 5ALUA 3VX3A 4C05A 2C4UA 1L7EA 1P8JA 4GF5A 4GSKA 1FRFS 2Q3CA 2IU0A 4AY3A 2W2KB 3X1MA 5IK2A 2J6CA 2Q1YA 4J2OA 2CLIB 3EQ8A 4PCLA 3T9EA 4R9SA 2H1SA 1DC5A 1NVFA 1N5KA 5HA5A 5C4MA 2EL9A 3V1UA 5IAOA 1NVBA 3E0QA 3ETLA 2J5QA 5J5VA 4LMRA 1JLLA 3NALA 5B57C 2AR7A 5E7IA 5HZHA 4ZT7A 2WVJA 4MDEA 3EUWA 1K3UB 3WP0A 5BYBA 3EZYA 4EVIA 5K0EA 3EVGA 1G7SA 4JI5B 5FCDA 3U1TA 2RI0A 3DOEA 4PZPA 3R7AA 2WPNA 5BSHA 1XJQA 1QP8A 3D7RA 5CGZA 1NQTA 5CXXA 5IT4A 3I9V1 3KBOA 1J0EA 4G5FA 3LVFO 1JHZA 1UANA 1SH7A 4YBZA 1YJXA 4BU1A 4GNRA 1PGNA 3PXAA 2R48A 4Q3DA 4QBGB 3ORYA 4Q4DA 1RYBA 3RFCA 2XWJI 3G0HA 4E2FA 4HJRA 4HJXA 4J7XA 2PZLA 1QVVA 1PZHA 1K0UA 4J7CA 3ENNA 4NBKA 5HMMA 2DC1A 3R8CA 4EI8A 3LC2O 3Q8MA 3KSZO 4WOCA 3EIUA 1K86A 3HDGA 1ML3A 4YROA 1Y37A 1F0PA 1WPGA 3CUVA 3G0GA 1A3CA 3QLVC 4JYBA 3RVQA 5JNLA 3CPSA 1DX9A 2XRYA 4R3UC 8OHMA 3KJQA 2JAPA 3C8MA 4IEFB 4MJLA 1E9RA 2HTFA 1D4AA 2I87A 1K66A 3FWPA 1XZQA 3PQDA 4KEAA 4TL6A 4O2BA 1NDQA 2F9FA 4IMRA 4TWZA 1YMVA 2ZSDA 1YFKA 2XMGA 3Q6MA 5FA6A 2OXIA 1IZ9A 1X86B 3FLBA 1GUAA 3MJVA 3QWIA 3DD5A 4YAJA 2PX8A 4XCVA 1BVYF 4QATA 2AEEA 4ZN6A 1RBMA 1CZRA 1S2LA 1CR0A 3AHDA 1P3JA 2GN9A 3SEQA 2ONKA 5EL0A 5LBTA 5JAQA 1XLTA 2HQBA 5LP6C 1QH1B 3FWZA 2J4DA 1DAEA 1P1HA 3QKUA 4MNTA 4ZCSA 5EJ9A 3LC0A 3AIKA 2IODA 4TT3A 2FTKE 3ENWA 4OU4A 2WJVA 4E4YA 3U3KA 4DDTA 1U3TA 2R7MA 2B8TA 4ID9A 2ZRKA 5G1NA 2IX3A 4CMIA 5IXJA 3UAOA 3G9UA 1T5OA 2C54A 4Q3BA 4CUJA 1B23P 4M0MA 5TS3A 1PP4A 5C7OO 4JB8A 5ECWA 4Y2UA 2VP6A 1P9WA 1VHQA 1KAOA 1RAAA 3UM9A 2JBAA 3W5UA 1ATIA 4TKLA 2I2FA 3HCWA 3H9JA 5AVJA 3W3AD 1X15A 3P0FA 1AD2A 7ABPA 4XPIA 2AZDA 1D1SA 1NN1A 3SDSA 4ZYXA 1K6IA 1XL0A 3BSFA 3QY9A 1XK7A 1UKCA 1ML4A 3TNLA 2H2WA 3E9RA 1HYQA 4MS1B 1YA8A 4NYJQ 4JKOA 4U7DA 1Q3TA 4LC9A 1OT3A 3K9BA 4PCUA 3T3OA 1QIIA 3IP5A 1LI5A 4HFJA 2EF0A 3M6WA 1FTGA 1R6VA 4YCBA 2VXOA 4LS3A 2X19A 4MQBA 4XDHA 2Q29A 3UFBA 4L22A 2ET6A 3FW1A 4QNNA 2FKAA 2ZVJA 3ASUA 2BHLA 2DPYA 4RDIA 1QHHA 4F4JA 4D9EA 5JWOA 3DQQA 3U16A 3V48A 1N2IA 1VPLA 4PYLA 4CMIB 1KO4A 1AVTA 4MYDA 3KB2A 1GQSA 1ODJA 3TL3A 3ZE8A 4G0QA 3TSZA 4ZOQI 1U7TA 4M8NE 4YRSA 1DP4A 2O14A 1ZBQA 2QD1A 2Z9CA 1WXXA 2VTDA 3QU9A 1FFYA 1VIMA 1I3NA 1Z2CA 2NMVA 5FFFA 4V0QA 4QOSA 3ME5A 2ZREA 3PLNA 3HXTA 5C1BA 3CIOA 2H16A 1HE5A 2O3TA 3DHYA 4GI2A 1U3VA 1JR2A 3H11A 3ICPA 1RM0A 3Q7RA 5H7XA 4K03A 4GE3A 4F85A 4DR5B 2V5VA 2KYRA 3P9YA 3HXLA 3ILVA 1B3BA 4R2HA 4KR9A 4QDKA 5T6MA 3G1UA 4HNSA 1JT9A 1YIOA 2AN3A 4DLAA 1W19A 4DZTA 1JKIA 4GVXA 5HG0A 5EPOA 4KE8A 2VJDA 1AZWA 3KVVA 5LL6P 4AKHA 3KFLA 1Q1QA 5CTJA 5JSYA 4EBFA 5JW6A 1G3QA 3K8OE 3CLTC 1DTWA 1QAMA 1P4RA 2ORVA 3L82B 4D0RA 5ED4A 1DT5A 3AETB 1RQ2A 1WUHS 5EKSA 1RZVA 2UXBB 4JLOA 1NA5A 5EZ5A 3NVDA 4CPDA 5IG2A 1TQDA 4AWXA 3FDIA 2BGIA 3DLCA 1P0PA 1SZPA 2JFGA 3NNDA 1JXQA 5H5JA 1PS0A 2AZXA 5JMWA 4E5NA 1JQBA 2BEUB 1H5UA 2PE5A 2GM4A 1AA9A 3MT0A 3SXUA 1IG0A 1D9ZA 4FOOA 4X7PA 1E2HA 3MGBA 1OZHA 1NUAA 5KMGB 3ESDA 4FR2A 3AHCA 1WWKA 1K27A 1Y0BA 1JMYA 3EFOB 4N54A 5ALVA 1L4EA 2H31A 3PLRA 1CJUC 3G9TA 3THWB 1MO4A 3A36A 1EZZA 1P7PA 5C4IA 3HVKA 3A1TA 4TRMA 2QTFA 1ZIDA 3QVTA 4OF4A 4FX2A 1GJRA 2ZRFA 3CUUA 3E5NA 1Z2DA 4KCGA 4KH0A 5DI3B 1E3MA 1YE8A 3CRW1 2JPDA 3GGOA 3IT0A 4PLGA 5BMVB 3K1AB 2IJGX 1UDRA 1KEZA 3FGOA 4I8DA 4RMHA 2DKFA 5SYMA 1TI7A 2V7TA 3S99A 1JFFA 2X0RA 3E81A 3AR3A 2G40A 1P75A 3JTEA 2QNIA 1UMKA 2M32A 2O0JA 1ZGJA 5DIFA 2H1LA 2OO5C 4QTYA 5CD1A 2I3DA 1OXMA 2O1SA 3CISA 3EOAI 5HJ2A 3W8DA 4UBIA 4O33A 5A7GA 2B4AA 3OLXA 3I52A 2WEKA 2QQEA 1ACJA 2QLMA 3CWQA 4R0NA 1BMTA 3VNQA 1OTYA 2FOLA 1PJLA 3CZAA 4DFDA 3ZVNA 5K3BA 4XLTA 2GLXA 3ANNA 3FNRA 4F3RA 4YRIA 2IU3A 4M9SA 2FDRA 4YQZA 2G3YA 2AIRA 1K92A 1SVMA 2E37A 4MUGA 2VUUA 5TRTA 3ROFA 4EY6A 3GOQA 1VLJA 3SYNA 4RTQA 2PSJA 1VPDA 2X7JA 3TX2A 5MFZA 3D7MA 1TCBA 3N7UA 3RM3A 2GN0A 5SY6A 2LE0A 2NXJA 3DZCA 3OMLA 5HJEA 4D26A 1FDUA 1NU6A 1QDLB 2ZUBA 1A8QA 2BHNA 2FFQA 1TJ4A 3ZUGA 1ECGA 4B31A 1QKIA 4EVSA 3TLEA 3RRNA 4C7KA 5C5EA 3C3XA 1CY7A 2XEXA 4NIMA 1CNFA 3TWOA 1QGYA 2X14A 2GZSA 2O3RA 1HKHA 3LPDA 2JLVA 2OYSA 4AY4A 4OU5A 5BPHA 2R84A 2PUGA 4B83A 3I62A 4M9CA 3PEWA 2PWAA 4BN0A 4RUKA 2GUGA 4O4IB 3T34A 4H4EA 2SKCA 4JC8A 1DKLA 1N2CE 2C2HA 2ZRDA 3NBQA 2ZE5A 2IIVA 2FFHA 1XFDA 3WKBA 2GKOA 2OAGA 2XA1A 1AO3A 1Z63A 4RZQA 5TV2A 2J9YB 3JYHA 2C7OA 3LIIA 3A3NA 1R8XA 1PUJA 1PBNA 4XW2A 2P5YA 1YR3A 1SRQA 4MCHA 5EZ6B 4D6PA 4EX6A 2EFCB 2PZJA 1QRDA 1E1MA 4JJ7A 5BMVF 1LK7A 4I1VA 2QJOA 2HLDA 3MB5A 4JC4A 4EVRA 5B2FA 1YBVA 3T35A 5LNK1 4Q3EA 2F1JA 4YT2A 1T0BA 5LMZA 2FX5A 1R9JA 2GM9A 3D4NA 5F98A 2VDPB 5JAIA 1V3VA 5LMNB 2A0WA 1OOEA 1XU4A 1GOTA 3RD5A 3EPHA 3FE2A 3IMFA 4WFKA 2NU6A 4MSUA 3ZDFA 1YL5A 3DVSX 5E9JA 2YUTA 2WZQA 1IB6A 1PT9A 3IOMA 3R77A 4KK4A 3OZDA 1FA9A 2ECQA 2J3QA 3PTLA 4RYLA 4P7JA 3FTCA 3AK4A 3HPQA 3UHJA 4R8LA 1HMPA 1Z28A 1ULTA 3HKCA 2A33A 5AW0A 2WIFA 1G16A 3JY6A 3GLFE 3W8NA 1DU4A 1TQHA 1D6NA 4QVGA 4BMSA 1NQOA 2IYFA 4PTLA 5IUNC 1GZ7A 1T5DX 3U80A 4NY1A 5BV7A 3MS7A 3NGMA 5JDIC 4HRAA 3MCZA 3K30A 2DKOA 1P0CA 2JGRA 1M2EA 4LJ5A 3X2FA 3BMCB 4D8UA 4LF4B 2WF9A 2CWDA 1HFEL 3AILA 4UHDA 1MRSA 3REQA 2I66A 3TSWA 5FBWB 1JE1A 3IKJA 1SCDA 3KO8A 1PK7A 4I5GA 3ZCXA 3DLBA 2XHZA 1PNOA 1SA0A 1UKEA 2H2IA 2X1LA 2C4WA 3HDYA 2ZRBA 1ABBA 1PWZA 1UXHA 5LA6B 1T1GA 2SCUA 4MKHA 4LF5B 1VOTA 2IQ5A 2VUHB 4C7OB 3JXEA 1BYUA 3P96A 2HQSA 3HLTA 4Z0HO 2LDXA 3TE6A 3JWPA 4RYDA 3ZV3A 3T7AA 3ASZA 4A2WA 4F2PA 5T7BA 3OQOA 4KUEA 4QAQA 3WNVA 1I6WA 3AY6A 3KUUA 2CFSA 1Q7GA 1Q0QA 1ULHA 3EEYA 3OA2A 3R41A 4H08A 4HGYA 4CKWA 4QGSA 3C8DA 1BDBA 3DFZA 4RF5A 3BSSA 2CXQA 5AIAA 3UA3A 4DA9A 4DR2B 4QXPA 1XL1A 4PY2A 4PRZA 4ZV4A 1JEQA 1PQUA 2VHZA 4CQJA 2V8OA 4OHCA 1MNAA 1JEAA 3II6X 4ZYWA 3DMPA 4LYFA 5DP1A 3GLQA 3V00A 4UQLA 3QELA 3W9SA 3ZX5A 4J4TA 3EGCA 1I2MA 4XD7D 5JXIA 2OHJA 4LY0A 5F9HA 2GZ2A 3IA2A 1YNOA 5MN6A 4PG6A 1QRTA 2PBLA 2GEFA 2PH5A 2GZAA 1ZESA 4CV0A 1X1BA 2Z2IA 1DBSA 2Q3DA 3IAAA 3DZKA 3R4VA 3U7GA 5HUJA 2W22A 1OXTA 4LZJA 2ALJA 4DCGA 1YNSA 4DQDA 4DA6A 1PL8A 2PJZA 4I1IA 1WY5A 2EGUA 1U1FA 4PN3A 5K0CA 2QL5A 2DCMA 1KFEB 5AQ1A 4JN6B 3QV2A 3AZOA 2QL9A 2QSJA 1STOA 3E0XA 4N3AA 5AKJA 2FW0A 4RS3A 5TPWB 3MGKA 5J2TA 1EK0A 3UC9A 5LD2B 2JF0A 3JARA 3KQQA 2BP7A 4ERNA 4NCKA 1XMPA 4F60A 3IE0A 3P9CA 3UFXB 2CMFA 3QYFA 4A6XA 4RTRA 3G2NA 4LXGA 2IOFA 1DSSG 1XI2A 2R00C 3A3PA 3R0ZA 4IZIA 4ENQA 1SB9A 4Q1CA 1WXIA 4PV7A 5F51A 5IC6A 3OJLA 4EJSB 4QTTB 4ESEA 1T8WA 1XAHA 1L9KA 1JKJA 2J9FA 3WLQA 1GPJA 2PU7A 3C3JA 4DAOA 5I7EA 3NIFB 1ZHHA 1NUUA 1Q17A 2PV7A 3CWCA 2IPOA 1H2RS 4B6RA 4WACA 2HJWA 1FNBA 3RADC 1Y4DE 2PANA 4HO1X 1XKTA 3CUKA 5HIMA 2R96A 4GXNA 4HLCA 1VB5A 5LYJF 4L9AA 1DEKA 2C8VA 2QTRA 3GP5A 4U4AA 2I7DA 2QIPA 4WGFA 5IN5A 2Q5EA 4HXGA 5IMSA 7REQA 1AJEA 1MHPA 5JTTA 3EUAA 4YO8A 3FHTA 2ZM5A 2R8PA 3NT5A 3HBNA 3O8QA 3ZXUB 1H93A 4YYEA 1SBQA 1YQXA 3IOEA 1QYIA 4BB9A 3GA7A 3GMIA 2GN1A 4WXYB 5YASA 3V1MA 1GT6A 1VG8A 1H0KA 1YA6A 4BLQA 2BI8A 3ECSA 3G5MA 3LPLA 4R7GA 4JENA 1RXUA 3ZJYA 4UXHA 3LNCA 8MHTA 4QOHA 2HU5A 3C7AA 4OMFG 4OJMX 4PHFA 4Y1RB 1W2WB 3FJOA 3PQ2A 3GCXA 3CEHA 4FFDA 5CT4A 3NHMA 5EIEA 2DY0A 1TF7A 4K6KA 3BXEA 5E1BA 2YZNA 3QMWA 3SKVA 5BNWA 2ZTSA 4X94A 2C78A 2C5FA 1PFYA 1JKMA 1P2SA 3DE5X 2YY6A 5D51S 4C0BA 1UEJA 2A3RA 3N2KA 1WIWA 1F17A 2I8LA 2WFZA 4HWGA 4F91B 5JDCC 2O8VA 3E9YA 5ERXA 1Q19A 4AS3A 2MT9A 3KOWA 1G9SA 1XRPA 1IHUA 2FMIA 1SG0A 1ULSA 1OIWA 2DQSA 5E6SA 1NF2A 5TEWA 3ZBUA 1I2DA 3HBAA 1WKCA 1VPWA 1VMAA 3INTA 3AUFA 3GLGB 1Z6YA 4PLFA 4QO7A 5FTMA 2F2TA 1UDXA 2Y1WA 3DO8A 5AW5A 3SIRA 3TJRA 3GGDA 3MG9A 1WETA 4QUGA 3KUKA 2JLBA 1RWOA 1T3SA 4YUAA 3ABRB 2YMLA 4EPRA 4DUYB 1I9CA 1CRWG 2HV9A 1GGNA 4CNQA 4ALIA 3AF3A 1UBJS 2BLNA 5FWNA 4BTEA 1NBEA 2P30A 3AR2A 5BWCA 1B26A 2DTDA 1B0AA 2CZCA 2YS7A 4JR2A 3IEMA 4IXDA 3C5CA 3C6KA 3PFCA 3AM4A 4UU7A 4M1YA 2NGRA 4TMYA 1KOLA 5I7HA 4OHYA 4FFMA 2C3MA 1D0SA 1YDFA 2F00A 4P82A 5KSPA 2CXXA 3C39A 4UFOA 4UVEA 4IV5A 4XQ0A 2K4MA 3N5CA 3QRWA 3L6CA 4ZJZA 3IKVA 4E21A 2GJ4A 3GLTA 1OFUA 3BIWA 2WTMA 3TAXA 2GVNA 4CIAA 3WGGA 1PT7A 1SUAA 1QHEA 1BMQA 2EFGA 3DMTA 4FE3A 4M88A 3L8DA 3KHTA 2W2MA 1G8MA 1CBUA 3N59A 1SFRA 4RPIA 4WUVA 4BRSA 5LMUB 1JU3A 5K2OA 4X71A 5TY0A 4F7DA 3EY4A 3PITA 2GAFA 3RKUA 2C0CA 1B7GO 2P5UA 1QHHB 3BJMA 1U5BA 2PPVA 2ONJA 1BCSA 4BC1A 3IO5A 1QHGA 1C4OA 1WJGA 1YVDA 2ODNA 3E7FA 5BR8B 2AMJA 3NYRA 4UXJA 3VH2A 5GOTA 3GG9A 2DF8A 2O57A 1UODA 1M83A 2NO1A 4YK7A 5DXAA 3ED1A 1CDDA 1SC3A 3WWPA 3IDOA 1Q3HA 4Y2GA 3H9GA 3DNMA 1SJ9A 2QVYX 2ZBPA 3IPLA 3LG2A 4IXWA 4QELA 4TLLB 4W5OA 1OX4B 1E3QA 3RSOA 1D5WA 5JSKA 3DDUA 3K8YA 4CL0A 5IJ9A 1UMCA 4DQLA 1UMBB 1F12A 5SYNA 4U5XA 3AUSA 4RANA 4RCVA 3SZLA 1YVUA 4Q6BA 4W5TA 4P33A 2R1VA 3H6GA 5HEKA 2PLAA 2CFTA 1YBFA 2WDPA 4EPWA 2IOHA 3EGDA 1RAEA 1JBKA 3WR5A 3ZVKA 3QFSA 2G08A 1QZXA 3N2EA 1JR6A 1TTTA 4IP0A 2Q8PA 3WKDA 4WADA 4UOZA 2VRWA 1R5NA 4PO8A 4L4XA 4QYXA 1XDUA 4G3XA 2O6HA 3QTTA 4Q3AA 3IRVA 1EWTA 3VV3A 7MHTA 2MTBA 4R5HA 3UIEA 1QNLA 3LL7A 4RD3A 4ZPJA 2X86A 2ZDHA 4Z7QB 4WFQA 1QP7A 4OQEA 3A6PC 5B1DA 1PSDA 1Z16A 1L7DA 1PEAA 2FLKA 1E98A 3FUWA 3KTFA 2PLFA 3NHJA 3OOSA 4REQB 2O2GA 3TMYA 2UUBB 2A0YA 1SUBA 2Q2OA 1XAJA 2VRCD 3ONEA 2UUAB 5BY2A 1K7XB 2MOKA 3TSOA 3QBEA 4B4DA 1E0JA 1Q1NA 1USWA 2HGZA 4L75A 3ZZ1A 1FX0B 2CNDA 3GRUA 4BNLA 3ONNA 3RVSA 2BFPA 2ZAOA 1BX3A 4Z0PA 4ZKDA 3K70D 6CHYA 1NVTA 2RH9B 4E32A 2ODTX 1KMHB 2PKRA 1KYIA 2C0PA 2JW5A 2QUJA 3PT9A 3D02A 4DJ5X 2CVFA 1OLSB 1TM2A 5E9WA 1PNRA 1XLTC 2H1HA 3BXOA 4UHJA 4FGLA 1ORIA 1WZ2A 2OA0A 3P4YA 3U3ZA 4GOMD 1YMQA 4QYTA 4ABYA 1IM5A 4UEOA 5KQMA 1Q22A 4O2AB 5BN4B 1QBGA 1QX4A 1M2KA 1QWOA 2FSSA 2Q0XA 2WF6A 3DD1A 4LWOA 2V1UA 2ZJ3A 3IV6A 5B4VA 4XKJA 2NSYA 5EJFA 2FK7A 2VDRB 3SC3A 3WQBA 2C94A 5LR6A 1PR6A 1QONA 1RIFA 1RKQA 2W0MA 4IOJA 3HJGA 1JNXX 2BGTA 2H29A 1YIDA 5J63A 3A2NA 1G5QA 3TECE 1EFRD 1MEJA 4BB6A 2B98A 4NK5A 5G53C 2WA2A 4O2AA 2GX6A 4O25A 4RVNA 5KOYA 4O63O 1H0HA 5IZCC 4YXWD 1E6EA 1Z8NA 4OLAA 1Y1LA 4JK3A 1CFZA 2DHRA 2C7BA 1XCBA 1YL6A 3ROTA 3TDKA 3NS7A 4AJPA 5KNDD 2EBUA 4AX4A 2QX8A 2LW7A 3KQLA 2GGSA 2OFXA 1XTSA 1DKOA 1M2GA 2GYWA 3KJXA 2HWWA 5LVAA 2Y1DA 3G5LA 5KHLB 1Z6XA 2VBIA 4N5IX 3N0XA 3FUUA 4DLWA 4DV6B 4A91A 1P91A 3ADKA 4BVFA 1C4WA 4NENB 3CLKA 2FA9A 3EDYA 3L18A 3SJ7A 1DCKA 3G85A 3B1WA 3NYIA 2ZUCA 5CNIA 1KSHA 1KYYA 2PGLA 3AGQA 5IJXA 2DH5A 3TRDA 3ZCPA 2F4VB 2OB2A 2OLEA 4JJ6A 4G0NA 4PRKA 3FMVA 1LSJA 3CG4A 3IUQA 1F9EA 1XVUA 2YN2A 4UEWA 4WZAA 3GUVA 2F8SA 1CEXA 2ZOSA 3O9MA 2H1WA 4KRXA 2QUIA 1B74A 1Q74A 4AMBA 3QLEA 1WUIS 4BVGA 4DPLA 1UIRA 2R5NA 1ABEA 4IIGA 3KKOA 2AGVA 3FLEA 3FOWA 3MNFA 5ENDA 3RJZA 4D8XA 2Z0MA 3J7AC 3JQFA 5EP4A 5LYJB 1IONA 1GRRA 1CKEA 2YXLA 1TNDA 2EERA 1KY5A 3COJA 4NCIA 3IAS1 1SB8A 2FZ5A 1IZYA 2I0FA 3MAJA 4J2TA 4LRXA 6REQB 1JFVA 2WJ3A 3LU1A 3GNTA 2ZRJA 4NSNA 4FYVA 1ZJ6A 2D2VA 4QFDA 5ERYA 2ZDQA 2F90A 4Y9DA 1Z13A 3L8CA 5DOZA 4A16A 4ARZA 4I3GA 3LUCA 3QI2A 2QU7A 2YR0A 5EINA 3HK2A 5JRZA 1VJDA 2LVBA 2VDJA 4BQNA 1BEZA 5CB4F 1O9BA 4R68A 3W5SA 1PYOA 5T64A 4L4RA 2OK8A 4Z51A 1KKUA 1A88A 1HEIA 1TK2A 2G04A 3CUWA 1W44A 4LTNA 4KC0A 5BUZA 2X1VA 1DKRA 3UH1A 1IRXA 3HU2A 4P3KA 3C8HA 1U65A 1NW7A 1WHTA 5CLGA 3A70A 4FDTA 1Y5IA 3E9EA 4MVXA 3VR6H 4EABA 1YV9A 2FSVC 1KOFA 2H65A 2QJWA 4MWDA 1WVMA 3U62A 4XASA 4ZK2A 5HRUA 2Q28A 1EWQA 4PC2A 2AEJA 1XPRA 3I01A 4RNDB 4C14A 4E5VA 2IYTA 1L4MA 2YHBA 3AEKB 4GOKA 4L2IB 1X94A 3EW7A 5LQMA 1SBZA 1XZAA 3EIOA 3SJZA 4DS3A 1KYWA 3S1SA 4FWTA 1CEYA 2ZUDA 5KKCA 1E3IA 4LI0A 1T4DA 4EA7A 4ZO6A 1NW5A 4YP7A 2BOVA 1OILA 3OZSA 4I9HA 3GLGA 2BT4A 1YTLA 2FCRA 2O20A 2BRUA 3CW8X 4PRYA 5HK8A 2V7XA 3TLJA 3A7DA 4EKGA 1ADGA 3AEQA 1KJ9A 3EH2A 3E03A 4YN3A 4K1LA 3M1IA 1ZWKA 3E7DA 3JTMA 4EGSA 3LUKA 1IUNA 2XYQA 1C8VB 1JJAA 2UKDA 1E63A 2X0EA 3ZWWA 1UOOA 4E5UA 3K4QA 3Q8WA 5G3YA 2HWUA 3ST7A 4B09A 1TKBA 1QS0B 1SY7A 2CB0A 4U6SA 1R9NA 1V8BA 3BC1A 3BD7A 5JSUA 2V0CA 1IWPB 5CM2Z 5CT8A 1QGZA 3ICCA 4BQPA 3O7WA 4PYJA 3WKAA 1IHXA 2V9PA 3V2GA 4D8WA 4BNHA 1M34A 4RULA 3QOWA 3EISA 4K05A 2RHJA 1WY7A 2YIMA 3A9RA 4BVEA 4CQLA 1DX6A 3SFZA 1D3AA 2AX4A 2NT3A 1S2MA 1KTVA 3SYRA 3H8WA 1SCUB 1T5IA 5JSZA 3MMSA 2QD5A 1LGYA 3BGWA 5SICE 1N3LA 1I4EB 4Q05A 3UWSA 2Y99A 3OEED 3VHQA 4ZD6A 2RG7A 5J43A 3HDQA 4BU0A 1T1RA 2WAOA 4YC7A 4E0BA 1F2UB 3NBZC 5DK4A 3I9OA 4YRGA 1RQRA 1SBNE 3P2OA 4TYQA 1SBTA 4JD5A 4AF6A 4PINA 1L5QA 3IC5A 1E7QA 4GYKA 4Q4AB 1F9AA 4FT2A 3WLIA 2IU4A 5IT0A 2GKGA 2WABA 1MQ8B 4R8KA 1Y6GA 5HKLA 3G2JA 1KARA 1LB1B 1XD2A 2XUIA 2ZR9A 4GICA 2W71A 3VU0A 4A03A 1J24A 1A2OA 2Z2YA 4MWCA 3FGNA 2JFXA 4DXDA 4X1IA 1HE1C 5AHWA 5D3KA 4GQIA 1XVIA 1NXPA 4WZBB 4Z3KA 2WILA 4MQ6A 2B20A 5TVKA 3NHLA 2R8EA 5A5FA 3O8BA 4IY1A 3NO4A 1RI5A 1N6KA 4XWGA 1CETA 2CNOA 3I1YA 1KEPA 2B2XA 1JEYB 1MIHA 1BA3A 2WU3A 4QYSA 4DDKA 3C3WA 2WB2A 2OCBA 3AVOA 1J06A 2WD9A 1FFAA 4Y7CA 2WJGA 1ISJA 2F8MA 1PFQA 4DLYA 3P2IA 3RVNA 1DKQA 1JKJB 5K3EA 1T9DA 2NOAA 1ISMA 2NXEA 3KEMA 4YLYA 1M5RA 2RHRA 4DC1A 3B51X 3VNBA 1H1TA 1JILA 1J8YF 3AL2A 4MGEA 1YCFA 4Y30A 1Z4KA 3LHKA 1X9HA 4DZRA 4ZZ1A 1H9CA 2NX2A 5BN3A 3PL5A 1J2EA 2YIDA 3O0TA 4ZQIA 5AUPB 4FZ3A 2HUNA 4M9ZA 1Z6ZA 5F3DA 1XAGA 1M1YE 4C87A 1DIOB 2GEVA 4MPTA 4KQWA 4KWHA 4BJ1A 2BZGA 4PTYA 5BWMA 1SIWA 5G2OA 9ATCA 3UCFA 3NRBA 2WVGA 3E7WA 3CRVA 4BO0A 4D6XA 4NK4A 4J29A 3JD1A 1VA5A 4P84A 4CTOA 1U63A 1KL7A 3IBGA 3ITKA 5I9NA 1JG3A 1B0UA 1R4MA 1WOYA 2C5AA 2Z98A 3OC0A 1RXYA 1DJNA 3IAFA 2WSSD 3A3OA 4BX0A 2Z43A 4RW0A 1PJ4A 2JVKA 2B7BA 2IZOA 3KPUA 3HB5X 1TFUA 3F6YA 1Q0LA 1CF2O 5FIUA 4LHSA 4DMLA 4EGFA 4ZIRA 5LSAA 1C0EA 2AOUB 2DTXA 4Q1VA 3RUAA 5JYCA 4GPD1 3FLMA 2Z58A 1EZ1A 2FXIA 3G8AA 2GCGA 2VHJA 3C87A 1NY5A 3DHWC 3QE2A 5FQNA 2MSLA 1E2JA 2B4KA 3KJHA 5AJUA 3JZAA 1PDOA 3HDHA 4JIGA 1VG9B 4QBHA 5KYNA 1I3CA 1UUFA 2C88A 4CE6A 5J1TB 4F2DA 1U81A 2R87A 2F4NA 2Q49A 1BJKA 3E3MA 1JZTA 1GGFA 4TKZA 1OYYA 4BGEA 3LGSA 4O3FA 2OG1A 4L72A 4F4UA 1CUVA 4Y3UA 3WXBA 4Q37A 1ZP6A 1X9IA 2Q2NA 4GG1A 3L6OO 1XLWA 1MEEA 2BJWA 2HQOA 4TLEA 5DYYA 3MMXA 5KNDA 1MQAA 1WP4A 1U0EA 3WRYC 4EKNB 2QDXA 3GA5A 3VA7A 2QPOA 1ENOA 1Q92A 2WYVA 2ZAGA 3LCMA 1BRTA 4JLAA 5CNKA 4ZT4A 3RREA 4Z49A 5BXYA 5JXWA 4G1FA 5C51B 3KXDA 2EIHA 2Q5HA 4IWNA 3EWNA 1VG1A 2IC5A 4OGLA 2OZLB 3NAZA 2NU8B 3RYCA 1UADA 1OUMA 4ZYYA 2QT0A 4MX8A 2GM5A 2JA2A 3BHNA 4KXUA 4Z2YA 4KPEC 2ZIAA 3PK0A 4A8HA 3QHAA 3SQXA 3H8SA 4MOWA 1NW8A 3W2TA 1ZEMA 1UXGA 4JB2A 5JWRA 3UT5A 1IZ0A 3QX3A 1FQOA 1FNSA 2VK4A 2AXQA 4AW9A 4ENUA 1HDIA 3IUPA 1RVDA 1UKAA 1GUFA 4NFSA 3D3QA 1FDVA 3HR7A 1R8QA 3KKKA 2Z2KA 4Y0NA 3QVUA 3LCJA 1YDHA 3I53A 4HLNA 3OPYB 4EZIA 4DLLA 2NU6B 1FDWA 4FYIA 3U44A 4YPOA 4NE2A 2PVCA 4OM8A 3TZQA 2BN4A 1IOZA 5EWMB 5IK2D 3R23A 3DJFA 3D6AA 4HLQB 3OEHD 4B3RB 4S1WA 3VPFA 2B8WA 1IH8A 1SUPA 4PZDA 3E7PA 4JJGA 3TGWA 3DEFA 2XCQA 4NEHB 4G5OA 5EUMA 3DUWA 3V33A 4AROA 2DFNA 1FDSA 4AJHA 5CFPA 4I9UA 4NL4H 5LKAA 2QJFA 4H7EA 4UJ5A 3TIIA 2JI6A 2VC2B 4JT2A 1V39A 2WHPB 3ZH9B 4EL0A 4MQ5A 3L5KA 5IVIA 3WJ7A 4F4FA 5LNK6 2Z08A 1Z07A 2QVBA 3BTUA 2ODPA 4AS2A 2OK7A 2Q9UA 4F5WA 1E7RA 1RQGA 1UM8A 3OBBA 1DFHA 1GITA 2DMRA 3M82A 4B32A 5LLSA 3V7YA 2EX1A 4KSYA 5LP6B 1ORHA 4PC7A 1SKMA 3T7RA 2GZ1A 2MHCA 4W5JA 2QEQA 4D9NA 4UPVA 1E1KA 1SOAA 4EG8A 3U6KA 4TYYA 1RJDA 2HF9A 4CU2A 3FNEA 2ZB2A 4W6ZA 1ZVVA 1EQUA 4KFSA 4XWAA 2ZATA 4XX0B 5WRFA 2Q3FA 2HLPA 3UWOA 1E0AA 2OHXA 3I28A 3V1YA 2IBTA 3FX2A 4IDGA 5B5SA 1QQ6A 1T6ZA 1AQNA 4HDKA 3OP4A 4RLQA 3R5XA 2O7NA 1EESA 2YMPA 3SS9X 4YMWA 1BOFA 1Y9ZA 1WLSA 1EVYA 1CZUA 3QKIA 4J0DA 3GN2A 3CJTA 1QAQA 4J3JA 4EHLA 2JVJA 3PD7A 3TRJA 2WQ6A 1S89A 3CNQS 3DM5A 4LF7B 5KYYB 2V7WA 2OM2A 5KB3A 2AT1A 1H6AA 5D1HA 1YJBA 2CN1A 4CIBA 3BD9A 4B8WA 2FXVA 4DR6B 5DIZA 2LV8A 3TR0A 3BXXA 1FVFA 3D9QX 1LVHA 2Z3WA 1GADO 4HNRA 3ZIDA 3CWZA 2WICA 3BGIA 1RRMA 2D5AA 3H17A 3NX4A 4IYRA 1WMSA 3H0CA 3CZQA 3I76A 3BOSA 4XWKA 4P3YA 1KGSA 2BBSA 1G8FA 2IYQA 3M6VA 4OFXA 3FYCA 4YJHB 1O87A 4AO7A 1D2EA 1KBOA 1E1NA 3E53A 3RC7A 2ZPAA 1E59A 3KOOA 4CKEB 3OZEA 3WY9A 1IULA 2XQIA 4JEHA 4OLJA 3ZCQA 1O6GA 4LRSB 3N7TA 1VL6A 1LPBB 1P8AA 5DBFA 5EXTA 5AVWA 2DT5A 2A1IA 2Z6VA 3NOVA 4L76A 4QJ4A 4BTVA 1TQ2A 2O3UA 3F90A 3FOBA 1RACA 2JCGA 3PNYA 4OAOA 4D8YA 3B6JA 4JBNA 4X8MA 2J5KA 3WL3A 4R9VA 1VCHA 4BNXA 3SM9A 4HAUA 1DQRA 2W00A 3B7WA 3IP1A 1Q0SA 1MLDA 3LV8A 5DHTA 5KYWB 4JLUA 2CLFB 2J8ZA 3HA3A 3VUFA 2IS2A 2VAVA 1W85B 3U9TA 1BA2A 2IS4A 4I6EA 1PTJC 2OHFA 3D8SA 4JGIA 1JQLB 3M9LA 3L7KA 4RV9A 3VXKA 5BR7A 4KR2A 1G7CA 1KEKA 1N4DA 4MR9A 2JEOA 1LKZA 1EM8A 3DEIA 3N2ZB 1C1DB 1R0LA 3O73A 4JVOA 4WNYA 1HFJA 4FBGA 3RV3A 3H9BA 2WU8A 3JU3A 1AGNA 4V02A 4ZC8A 5FYDA 2D4HA 4DSNA 4MP3A 2NUAA 1HDEA 2VYND 3DDSA 1QIFA 1ONBA 4K5QA 1YI8A 4PC1A 3TRFA 2Q6TA 1J7JA 4QXQA 4TS1A 3EXHA 3ESXA 5KWEA 1KI7A 3DE6X 3ROMA 1A50B 3DH0A 4PW0A 4BNFA 1C1DA 4DMMA 3DPIA 3CEMA 1S96A 1V9LA 2C4MA 3PWZA 3ZTTA 1DIHA 1J2UA 3TFQA 1OTXA 2D8MA 4B76A 2DJIA 2ZYDA 4Y7DA 3OPMA 4U5QA 4N18A 4I19A 1E58A 2PZFA 1JHMA 4B4OA 5KYKA 2W6IA 3NKFA 4NE7A 3SZOA 1Z37A 2X41A 4E11A 4KPFC 4W5NA 1GPKA 1L7QA 2VCEA 3H0KA 1KETA 4BRWA 2FQQA 1W9MA 3CEPB 2EZUA 3TTYA 1ZNZA 4PICA 3F4LA 3GH1A 2CUKA 2VSNA 1LNSA 3NC1C 2WMYA 3KJFA 3I9KA 5BORA 1YI0A 2CSUA 2HPAA 3OC6A 3SGLA 2BWJA 4C03A 2P0EA 2O54A 4NECA 1WEHA 3TB4A 5F3RA 3WHIA 2P2YA 4PO1A 4HNTA 5IKXA 3RFUA 1B2LA 1II9A 1RKXA 1TU0A 1X42A 2J9GA 2OILA 4ETWA 5IS2A 1LY1A 1FLNA 1HOTA 1I13A 4L74A 2RJNA 4UD2A 5EJ5A 3RK1A 4RTJA 4EW3A 1RMTA 1MORA 1X7WA 2JC3A 3LYLA 4J07A 3VPXA 4D74A 1J99A 1XU7A 2A30A 3NBKA 3OKFA 4X60A 4NPAA 4CUZA 1DAMA 5LQNA 1GZUA 3IV9A 4DNPA 5ALRA 4S1VA 4JBGA 1OU0A 1QO0A 2X0KA 3GGCA 3RS5A 3HABA 5IASA 1PG5A 1G5RA 2KPOA 1PWHA 4IIYA 4LE2A 2C9BA 1U1DA 4ILEA 1D4OA 1Y48E 5DX8A 4RTKA 1C3XA 1E3SA 1Y1QA 3A1CA 3LY8A 4MQEA 2E5LB 3AI7A 1U0OC 1DX4A 4BEBA 2O2YA 2ZIEA 1QG6A 1XRMA 2WWWA 5IKOA 3NOQA 4P36A 1XZNA 4JWKA 5L7YA 3P94A 5JLAA 4ZZ0A 4QO8A 1UZAA 3RRZA 2GRAA 2PXXA 1WULS 4N47A 3P19A 1GDDA 1KPHA 4C5BA 1XQXA 1Z08A 1M8GA 1CDZA 1X77A 2CHEA 2JEYA 3COPA 5ELLA 1RJGA 3VPAA 2G5PA 4F3CA 5BN4A 1F3LA 1NV8A 3GFBA 1NC3A 2QRQA 3SKYA 1S7CA 5DM60 4O1MA 4BRZA 4R71A 4JI2B 1QVRA 3DTVA 3AUUA 1MHTA 2W7TA 4HB2A 5C8XA 1FJGB 1CPYA 1NW9B 2OESA 3H8VA 1HLFA 4BNDA 1UDAA 1UWKA 1S8OA 3COVA 4B79A 5KOHA 3LCCA 4PHHA 3LKVA 2PYIA 1GPUA 2NZJA 2NLOA 3AFGA 1DWQA 3DSRA 3PR2B 4KJZA 2PZMA 4UFNA 4MQFB 1K89A 4RY8A 1JFTA 2IELA 1DADA 2OV3A 1CY2A 3HACA 1XP8A 3A4NA 3NLLA 1G38A 5DM1A 4QBTA 4DIUA 3JZDA 3WLJA 4UZEA 5ALJA 1G1MA 1QG2A 2WP0A 3LRTA 4GGOA 1TAQA 2EP5A 1DTSA 1E0DA 3T9CA 3WYBA 5JISA 1CP2A 1MAHA 2B8NA 3D7SA 1N3IA 2ZZMA 3VOSA 1KI6B 4EFNA 2HNKA 4IZOA 2G07A 4F04A 5K8JB 1W47A 5IBQA 5K2MA 3VOTA 4BV2A 2I6UA 2PBFA 5ADUS 4XJSA 1A8IA 3RT9A 1FFSA 1AUOA 5CPBA 4JLSA 2XNDD 4B82A 5HW0A 5ALTA 1E69A 2WKQA 5H68A 4YAUA 1ETUA 3ZE2B 1FPQA 5CLHA 4E33A 3KWJA 5KX5F 2IZ5A 4PLHA 4G37A 4UQPA 3WK5A 1G2QA 4XQGA 4DMHA 3FJ1A 4K9SA 4C4AA 2YYAA 2CJWB 3DKPA 5EIXA 4Q66C 5H4GA 2CNNA 1NMQA 3DDCA 4V24A 3S4YA 2BMEA 2X2PA 2NSHA 1ADYA 4HEHA 1XZIA 1R12A 1ZA1A 1VG0B 2ZBUA 3D3KA 2DHCA 2XWBF 1DV2A 1BHO1 1RLTA 3DKIA 5F52A 5JCOC 2PV0A 4URVR 3VNVA 4JOSA 1SK9A 4B7AA 1ZY2A 1FJ2A 4DLSA 3AC0A 2Z4RA 4M21A 4ALNA 1W34A 1L5MA 4K7JA 4IQ4A 1EFPB 3GLHB 1EGQA 4OEHA 1TM3E 1EJ0A 3LZ6A 4RGVA 4UM9D 4EGJA 2C1XA 1J4AA 1JJBA 4J0QA 4L07A 3CKKA 3LBAA 2QJTA 1WTAA 2IE0A 4OHFA 4EB0A 1JLHA 4YI5A 4AU1A 2HHAA 5JYDA 1IC6A 2BTQB 1KY4A 1E99A 1F0NA 2ZROA 3C6ZA 1VSVA 2FHPA 4L5IA 4ZMSA 2OGTA 2EFHB 2WNIA 5FYQA 3R7SA 1E32A 1V5WA 3UMMA 1KOGA 1PZFA 1GCIA 3GF4A 3NVAA 3QLVA 1E1RA 2A1UB 4XCQA 3HCAA 4ZT2A 4GD3Q 5TE9A 1QGUA 3EIHA 3G2IA 1I94B 1MIOA 4D4MA 3CZ5A 5E0OA 2HT1A 1GGKA 4UE2A 1OA0A 1WW8A 1XN4A 2VWQA 3AP3A 4GPAA 4WBNA 1QHYA 4Q1AA 4H0CA 5DGCA 2RD2A 2QAGC 3OESA 1WCV1 2GN2A 2FRXA 3RDPA 1KEVA 1D5CA 4NULA 9ABPA 1TEZA 3DE1X 2FDXA 2Y4OA 5DLQC 3L8FA 3OJ0A 1I5RA 3PRJA 3OE7D 1M5UA 2D2IA 2BEVA 3JAMA 1ID1A 1NVEA 3QVLA 1QGUB 3M3HA 3X1KA 1AXRA 1Z56C 2H18A 2UUPA 2BKVA 3LA6A 2FFBA 1TUGA 1HO3A 2Q1TA 3OQHA 4V3CA 1BQ4A 3GLIA 2AFIE 3FZQA 5DHFA 3E8MA 5F1YA 1XZHA 2NTYC 2PNJA 4J03A 5C80A 2OHHA 3O4IA 2D7CA 4GI1A 4M22A 4MUEA 1DOAA 4U3JB 3WX0A 4BMCA 2VNHA 3FCUB 5BRJA 2EARA 4YV1A 4F84A 5L6MB 1OB5A 2FZEA 2DUMA 1CZKA 3BL6A 3E61A 3I2YX 4U63A 3E3OA 1NJ1A 3LVQE 4YEDA 5AJTA 4YCSA 2H4ZA 1Z83A 2PUBA 3L4SO 2ZLBA 2IV2X 5I7VA 4P58A 2FMTA 1YZGA 3ZNNA 5BR4A 5JCZA 2W2OA 1ISGA 1PZNA 4KODA 4L08A 5BNFA 5IDWA 1U3WA 3LFUA 4YRZA 1Y9EA 3BD6A 1VFPA 1G41A 5DCWA 1CUYA 4ZEMA 1G6Q1 4M0DA 1WXDA 3V46A 1A69A 1W85A 2IYRA 2REQB 2WJHA 2C4HA 1WCWA 4NRDA 3SR4A 3BMOB 4L8WB 4WLNA 4F93B 1LFAA 2EW2A 5AVOA 4MRAA 2CXPA 4YRMA 4XVQA 3L0SA 2XUZA 2ZDGA 3ER8A 1M6YA 3PPVA 1CQWA 1U9IC 2JI9A 3RF6A 4F7WA 5JROA 1EQAA 1T8TA 4Q9KA 4GLLA 4YP1A 1A9SA 3TEJA 4ZI2A 5JAUA 1L4FA 1ST3A 5HMLA 3PUYA 5IHXA 2HBZA 4I1SA 4KSCA 3FYHA 5EE3A 4DC9A 4B5LA 2E0IA 4HMQA 3VR2D 4EJ6A 3KQSA 4NONA 2OD9A 3QE3A 4EARA 5I7OA 4P4SB 3OD1A 4AG3A 1K4YA 1WDLA 4QASA 4HDKB 3DV9A 1AY0A 4EMTA 3W1WA 1PE0A 2HWKA 3ADBA 2OCGA 2Q8QA 3ROXA 1DG1G 1KFKB 2RGDA 3IJPA 2H5LA 4QOGA 2PEYA 3QUSA 4J4HA 3I9NA 4YCAA 4XJXA 4RTLA 4DV2B 3LX8A 3A1WA 4YRLA 5AVQA 5HM8A 3B52X 4J1TC 5DLDA 4B4KA 4V1CA 3LLSA 3VVBA 3GGGA 5H59A 3C1TA 4ZTBA 4RWEA 1NLYA 3VR5A 1EFAA 5GJWC 2JD1A 1Z17A 1EUCB 2G0TA 2VK1A 3AO0B 4NCHA 5DTJA 2HBRA 1KWGA 1T25A 5KSZA 1TVEA 3X3HA 1PR4A 5C1IA 4MW0A 3DM9B 2I1LA 3DEHA 3H5WA 4C6RA 3K0AB 4K26A 5FPKA 3HCPA 3E23A 1DKUA 3GCDA 2QSUA 4BKOA 4W82A 5FHQA 3RSQA 4L9RA 3MOSA 1TD1A 4FFRA 3ZKWA 1OA1A 3TPZA 5IEBA 1A95A 3E6AA 1WDWB 2GAIA 2VP3A 2XE4A 4LQLA 3GBVA 2ORIA 2P1ZA 4LV8B 4RVGA 3URKA 3ZEAA 1RHQA 3OIDA 4IFEA 4JLJA 4UZFA 1FXWA 5KTRA 3PFNA 3PEVA 4IQFA 2QNBA 1R5BA 2OYCA 1GSHA 1NWHA 2ZXFA 3V2UA 3RIMA 1CRPA 2EKDA 3LLCA 2CLKB 3P71T 5IJ0A 8AT1A 5CBPA 4MRVA 4P31A