1YSCA

2.8 angstroms structure of yeast serine carboxypeptidase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
421
structure length
421
Chain Sequence
KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFELGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGESYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE CARBOXYPEPTIDASE
publication title 2.8-A structure of yeast serine carboxypeptidase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase(carboxypeptidase)
total genus 115
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 1994-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yscA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yscA01
2ZJFA 5CH8A 5AM5A 3RK4A 5AO9A 3G7NA 3HABA 5DTJA 3IDAA 4C87A 5ALQA 5K3FA 3V1NA 4HTAA 5EIHA 2HA0A 4BAGA 4BVKA 5JADA 4B84A 3BL8A 4N8SA 3MUOA 4ZI5A 2OCIA 1FFAA 3HSSA 4ZV9A 1WHSA 2Q0XA 3WKCA 2HFKA 4U2CA 1FFCA 4TGLA 4BATA 1VXOA 4HXFB 4OPMA 3I2IA 5AI8A 2OCKA 3VDXA 5DYTA 1XRNA 1XZLA 3ZLVA 3UMJA 2G63A 4CFSA 4X3CA 3WKEA 2WHPA 7YASA 2HRQA 2CKMA 2J4CA 4OSEA 4G4GA 1AUOA 2WTNA 3K9BA 4C01A 4I19A 2Z3ZA 2WJ6A 4BCDA 3TEJA 4QDTA 4Y2SA 3H18A 3AIOA 4M0FA 1EX9A 3EQ9A 3T52A 3G0DA 2QOEA 1ZIYA 3WWPA 1TQHA 1DWOA 1VE7A 1XLUA 3WWEA 1Z68A 1ZD4A 4F5ZA 1AURA 3KD2A 2PUJA 2V9ZA 1EVEA 2OLEA 2JEZA 3I1IA 1P0QA 2GBIA 1HQDA 1MTZA 4B82A 3UUFA 5EFZA 3D3NA 4YX9A 3R3WA 5HFAA 5HF9A 1CR6A 3H2GA 4DSAA 4Q34A 3G02A 4Q1VA 2H9YA 2WG2A 2HA2A 3WQHA 4DMHA 1IUPA 4P08A 4W1SA 2ZYIA 2WUFA 1XZAA 3C6BA 4J7AA 5ALXA 3WA7A 1CUSA 1YR2A 4XJVA 4IO0A 4N5IX 3H17A 4MQLA 2WFMA 5AKGA 1G42A 3QITA 3WKBA 1PV1A 2WHQA 4S0XA 3HI4A 3C6ZA 5CTAA 2ZSHA 1L7QA 1EVQA 2W22A 2WQZA 2XUJA 1Q84A 5DJ5A 4FLMA 2R11A 3GELA 4Q82A 1RWQA 1WCYA 3QMVA 4OCZA 1UKAA 2V96A 3AINA 3DKRA 2XMRA 2PBLA 1VXRA 4J0IA 3DOHA 2BKLA 2PL5A 4KE6A 3ESBA 1WB4A 2RI6A 1I6WA 1USWA 4DYHA 4CCYB 3I2JA 4MEBA 3QPCA 4M0MA 1XQWA 4GLBA 4PF1A 5A62A 4BVJA 2NW6A 4MQMA 5KWJA 4PQEA 1EK2A 1QIFA 2G5TA 1CUEA 2G5PA 2VJCA 3CCBA 4EBBA 3FLAA 1R9MA 1P0IA 5A6VA 1ODTC 2DSNA 4GXNA 5A2GA 2YASA 3ESCA 4H77A 4HRXA 2HFJA 2XI4A 1CLEA 3GUUA 3ESAA 1CUJA 3I6YA 1LZLA 4Y2YA 2XQJA 3IB3A 4FFVA 1JJBA 1A7UA 4M0EA 1F6WA 1BEEA 3H0CA 4OD0A 4K6HA 3R3XA 5K5EA 2Y6VA 3FYTA 3IURA 3KXPA 1MAAA 1ISPA 3AZOA 5HF5A 2WU3A 1XQYA 1N5MA 3HACA 4ZRDA 4LXGA 4OUKX 4HVTA 1NX9A 4Q3LA 3VVMA 3MUNA 1H22A 2OG1A 3G9XA 4WDRA 1ZD5A 3AIKA 1G4HA 2HHAA 2VJBA 4B81A 4INZA 1NU8A 4QEKA 4AZ0A 3VVLA 4F0JA 3I6ZA 4UFOA 4XIIA 1TKRA 5DNWA 4DMKA 5A7FA 3STTA 4DTCA 5IH7A 5T4HA 2C5FA 3I2GA 4DNPA 4AZ3A 3WIBA 3PUHA 4Y2JA 5AI5A 1SCIA 5EHNA 1THGA 2WKWA 4QDZA 2XUQA 3VKFA 1L7AA 1ZD3A 4H7KA 1CUZA 5AKJA 1QZ3A 3PUIA 1LPNA 3SWWA 3WYDA 4JYMA 3FSGA 2PSJA 1GKLA 1EI9A 1E5TA 4DNQA 4J0HA 4X97A 6YASA 1TCCA 4UHCA 2AJBA 3GBSA 1KU6A 2XUFA 3I2FA 1AX9A 1R50A 4G4IA 5AI6A 2RAUA 2FJPA 1MX9A 4UBJA 2OXEA 5CH5A 1YCDA 3KSRA 1A8UA 3DYIA 4G9EA 5ALEA 1S8OA 1R88A 4K6KA 5HCUA 5DNUA 4IH9A 5CT4A 3AIMA 1H2ZA 4NS4A 5AKZA 3GZJA 1DT5A 5ALPA 2QKYA 2JGFA 3DJYA 1X2BA 4C88A 3ANSA 3ANTA 3WJ1A 2CBGA 2BUBA 5ALGA 1DWPA 4MYDA 4Z49A 2Y2VA 3FNBA 1K5PA 5EHXA 3FLBA 1SC9A 1N5RA 5FPPA 4BRZA 3N2ZB 1XQVA 1UKCA 3C45A 3D0KA 1CVLA 1QOZA 3PF8A 1AGYA 1GQRA 3FCYA 2OQVA 1ZOIA 2D0DA 3V1LA 2WM2A 5SYNA 1ZIXA 4H7FA 1QIMA 1YA8A 5C8ZA 3WK9A 4X95A 5HK9A 1BN7A 3WWDA 5KWIA 2ECFA 1DTEA 2EDAA 3I6MA 1VA4A 1BU8A 1R3DA 1CUVA 3HYSA 4I3FA 2PSFA 3AFIA 5ALNA 4CCWA 1J06A 3WL5A 5JALA 3TRDA 4HRYA 3F98A 2EDCA 4KAJA 4AMZA 2GYWA 1AMNA 1XZHA 2JGEA 3ZPXA 5HF8A 3Q0TA 2ZYSA 3H1BA 1XRQA 2X8BA 4ITVA 2WIJA 2AXEA 5T4FA 1ACJA 3DYVA 1AZWA 4UHBA 3IBTA 1CUIA 1WHTA 3K2IA 2XT0A 3QPAA 5AIBA 2I3DA 3H2IA 2VF2A 1UK6A 2B4KA 2I3ZA 3L1HA 5C8VA 2XQIA 1CFJA 2CMFA 4QA9A 3WKDA 1U2EA 2XMQA 3D2BA 1MU0A 2Y6UA 2HA6A 2JGLA 5EIEA 1L7RA 1CUAA 1UXOA 1WM1A 4X71A 2VJDA 4KYVA 3IULA 4P93A 4UBKA 4C4ZA 2D5LA 3ZWQA 1MJ5A 1U8EA 1EDEA 3B3QA 5EHZA 3ED1A 3O0DA 4AN0A 3IUJA 4HXEB 1IZ8A 4KEAA 4I4CA 4MWTA 5AICA 5LKRA 4KRXA 3CCCA 4Y2TA 3FBWA 5T4EA 1LNSA 4U2DA 2JGKA 1HDEA 4AB1A 2CZQA 4AN1A 4BCCA 4C6HA 2VSQA 5I7UA 3IUNA 1CUXA 1HL7A 2XQGA 2OAGA 3C5WP 4EY5A 2OGZA 4G5XA 1YAJA 2PU5A 5D3KA 4K5QA 1QIGA 2WIDA 2WSLA 4IH4A 5AKKA 2XUGA 3E1GA 4PV7A 3I28A 5FXMA 1UOQA 4Q05A 5IVIA 4E11A 2CUTA 1TCAA 1BRTA 4J3JA 3AJAA 2J3DA 5AKLA 5FDFA 4XWGA 1GZ7A 1QIHA 3B5EA 1IUOA 4DLNA 4BP9A 1IMJA 4GWLA 1XKLA 2JGMA 4LKOA 2GBGA 2H1IA 4BZWA 4HS9A 4ZREA 3CXUA 2PSDA 1U65A 1ZJ4A 4QLAA 2DFPA 1UK7A 5FOQA 1XZIA 4OB6A 1KEZA 4W1QA 3NWOA 2XQKA 2IIVA 3STUA 1XZDA 5JATA 3OM8A 2EEPA 1GT6A 5AM2A 3C87A 1BROA 4D9JA 3HJUA 2DR0A 4FDMA 5FV4A 2WIFA 1UOOA 4BCBA 4Y9SA 2RIPA 4N8DA 2GZRA 4P92A 4AX4A 5ALVA 1YS2X 4WJLA 1EINA 2WHPB 2HRRA 3NGMA 2FUKA 1JI3A 2O7VA 2RONA 2XMDA 4J0CA 2HU8A 4FLFA 4PO3X 4BDTA 4E46A 1CUWA 3PFBA 4G8CA 2XB6A 5K3EA 4AO8A 5DWDA 4CG1A 2VTVA 3VISA 2DCMA 3X3HA 4BZZA 1FJ2A 2OGTA 4BAUA 3BIWA 2BGNA 2HL6A 2XMSA 1LBSA 2XMZA 4CCYA 2WG0A 2WUGA 1SOMA 1MAHA 5EHQA 1MNAA 3PICA 2C58A 1UK9A 3VJMA 4W63A 4NZZA 3WIOA 4DGQA 5AM0A 1DINA 3WK8A 1BEZA 3D4LA 5H3HA 1RP1A 3O95A 3FVRA 4UPDA 4J03A 2WLSA 1K63A 3DQZA 4K6GA 5ALSA 1XFDA 2BCEA 4FTWA 4GBGA 1W52X 5HQ3B 3BWXA 3IA2A 2K2QB 5AK6A 1GQSA 3GFFA 2BUCA 5YASA 2H7YA 2OQIA 5JAHA 1PFQA 3BJMA 3LCRA 3WL7A 2V97A 3AUKA 5FLKA 1QIKA 3BF7A 4Y2RA 1UFOA 1W6RA 4YASA 1DT3A 1J2EA 3IUMA 2IX9A 5BWCA 2H7XA 1ACLA 2HDWA 1LPMA 1Q0ZA 4UHFA 1LPPA 4DMFA 5ISMA 3FYUB 3D2AA 2PX6A 4EY8A 1ODCA 5C8XA 1Y7IA 5AKIA 2XMGA 4W1PA 1SFRA 1YS1X 3C8DA 5KBYA 4IQ4A 1VLQA 1ZICA 3JW8A 3CN9A 4X7BA 4OB7A 2GYUA 1CQZA 4WCVA 2ZYRA 3VJLA 4AQDA 3S8YA 3KWJA 2ACKA 4B7ZA 4QWWA 5LZ4A 4H0CA 3A70A 5K3AA 5HKBA 3G9ZA 1GKKA 2ZJ6A 3U0VA 3KDAA 1QLWA 3OC0A 1WB6A 5ALHA 2WIKA 3GROA 4MWSA 5LZ7A 5LYYA 2FX5A 4DM7A 5AOCA 4X94A 5F4ZA 4WFIA 3H04A 1A8QA 2J4FA 3ICWA 3WA6A 3HRHA 4L72A 5KREA 1F0NA 1E8MA 5HF6A 2B20A 4F60A 1R1DA 2QUAA 2W6CX 1BN6A 1B6GA 2QJWA 5JAUA 2ZVDA 4BTVA 3BXPA 1X70A 4BE9A 4Y2VA 3GA7A 2XUAA 3DL4A 5LLSA 3YASA 4YK7A 3M82A 1TCBA 1SCQA 1R4ZA 3NOXA 2GZSA 3WL8A 3M3DA 3A2MA 1UT6A 3HXKA 2PPLA 5ALLA 2YYSA 2B9VA 5JD4A 1XRMA 3CN7A 3V48A 4OB8A 1J07A 1EHYA 1JJFA 2WFLA 4HZGA 1DQYA 2XUDA 4G8DA 2JBWA 5ALTA 3BDIA 4L0CA 1D07A 1XQXA 4BE4A 4PSDA 4EA6A 1XZFA 1HKHA 3PFCA 1YASA 3G0GA 1THTA 4TVKA 4FWBA 5ALMA 3PI6A 1XLWA 4QDOA 4UHHA 4GEGA 1XRRA 3M83A 2JGJA 1WPXA 3O4IA 3L1IA 2VQ6A 4UHDA 2V98A 3I2KA 4OYYA 1GXSA 5EGNA 1AKNA 2LIPA 1HLGA 3C6XA 3QPDA 1IVYA 3WI7A 2AJCA 1CUDA 1W75A 5ALDA 4H7EA 1EA5A 2PUHA 4AO7A 2DQYA 3E3AA 4XX1A 1M33A 1UZAA 3D7RA 2CJPA 1EXWA 1JFRA 3BJRA 3C6YA 5E4YA 5AKHA 4BYMA 3QYJA 1AC5A 3DS8A 1K8QA 4KAFA 2VJAA 2XMCA 1W4LA 3D2CA 3A6ZA 4Y7DA 3O4HA 5JZBA 4A16A 1HBJA 4FBMA 4LYEA 3RARA 5D3ZA 1H2YA 1FFBA 5IVHA 5A71A 3OTQA 3OOSA 2PKYX 3STWA 1VA5A 2GBFA 3SC2A 4MXDA 1W76A 3PF9A 2XUPA 1MT3A 1XLVA 1CEXA 1XZJA 4B6GA 1YSCA 1C4XA 2H7CA 3OPMA 2WILA 2WIGA 3BDVA 3TJMA 3FAKA 1QONA 5AK5A 3F96A 2BFNA 3AZPA 1MX1A 3R0VA 4OYLA 4KJXA 3QH4A 5CURA 2OGSA 2XUIA 4JEIA 1CUBA 5AM1A 2FJ0A 4ARBA 2VT7A 4UBLA 1SCKA 3QM1A 4EY4A 2QUBA 2XDWA 5LKAA 4H7JA 1LGYA 1VJ5A 1CUYA 3EIOA 1DU4A 2RGUA 3R3ZA 3W05A 1MN6A 2XE4A 3V9AA 3LIIA 4H35A 1QFMA 1YA4A 4KE9A 2JEYA 5AI9A 2VAXA 3RM3A 1LPAB 2C4HA 1ODSA 4PW0A 4BB0A 1QIJA 3UUEA 4G9GA 1JU3A 1U4NA 5T4BA 2B61A 4QNNA 2HADA 2PSHA 2BAGA 3O9VA 5CXXA 4H7IA 4U2BA 3E0XA 3G0BA 2O2HA 3ZI7A 2AJ8A 3BE8A 3HC7A 1VZ2A 1XROA 4IH1A 2QS9A 2DQZA 4RE6A 5BV7A 3FCXA 1E66A 3AILA 4WDQA 4PSCA 4AO6A 2O7RA 4BC1A 4QZVA 1Q83A 3WWCA 1CRLA 4X00A 4DIUA 3F8SA 4B0PA 5AI4A 4L9AA 5AJHA 1XZKA 2AJDA 1GPNA 4H7HA 1QO9A 2HIHA 2ACEA 2RHWA 4UFNA 3QZUA 1CQWA 2QMQA 3EBLA 5JARA 5IVDA 3WKAA 1H23A 1DX6A 2Z8XA 1DQZA 4U2FA 5K3FB 4IHAA 1BCRA 1VKHA 4X92A 5DLPA 1WOMA 4CIAA 1VOTA 3PDCA 1EB8A 3D5EA 4RNCA 3C43A 3Q8WA 4RGYA 4F21A 3SK0A 4RPCA 1JJIA 4EHBA 1QGED 1QO7A 5AI0A 4UBMA 3HZOA 4E15A 5ESRA 4QLOA 1CUFA 4WY5A 1HPLA 4TPKA 1QE3A 5FUMA 2O2GA 2PSEA 4FNMA 3R3UA 5FRDA 2XUKA 4X85A 1GPKA 2I03A 1ZI6A 5C81A 4U2EA 2VATA 1E8DA 1F8UA 3W04A 2WTMA 2QRUA 4FLEA 5I9IA 4B0OA 2QM0A 3PE6A 4X6UA 1Q0RA 2XUOA 4PSUA 5CH3A 4E14A 1GGVA 5SYMA 4CG2A 3HLKA 2CB9A 3FOBA 3B12A 1EK1A 1GPLA 3MVEA 2CEKA 1BCSA 5CXUA 3O4JA 4UBNA 3G8YA 1CV2A 4RE5A 4BVLA 4FBLA 3ZV7A 1WB5A 2VT6A 4MJ3A 4O08A 4JNCA 4C89A 4UHEA 2XLBA 2R8BA 2BGRA 3G9TA 4JH0A 4B85A 1JKMA 4A5SA 2QXUA 1T4MA 2WFLB 5ALZA 3AZQA 3FVTA 3ZLUA 2GYVA 2OCGA 4HAIA 5CT5A 1P0MA 3WLAA 2OCLA 4ZXFA 3C70A 4Q3OA 5AK3A 1E89A 5E4TA 2VA9A 4KE7A 1CUCA 5HK8A 1CUUA 2ZYHA 3JYHA 4LYDA 4HXGA 3NUZA 4DNFA 3WZLA 1ZGCA 5FPQA 1E3QA 2G4LA 3VJKA 4BRSA 4Y2UA 4UBIA 3OG9A 4UBOA 2PVSA 5DNVA 1G5FA 3H2JA 1O6FA 4W1RA 4WFKA 4G4JA 2C0QA 4B9EA 2BJHA 1E8NA 3LP5A 3H1AA 1TK3A 4A23A 2QVBA 1ZI8A 1W1IA 5AP9A 4MYSA 3L1JA 2BUAA 3W9BA 3QMWA 2XLCA 1X2EA 3DOIA 1YB6A 1CPYA 5EIAA 4DNOA 4X91A 5D6OA 3W2TA 1LPSA 1LLFA 1UK8A 4N8EA 3BIXA 4FFWA 5JD5A 1PJAA 5JD6A 5JYCA 4GECA 2OAEA 1N1MA 3W06A 3SX4A 1ORWA 1OXMA 3F67A 1QTRA 5JIBA 2ONCA 3U1TA 1MNQA 4G8BA 1FFEA 3DD5A 1EDDA 3T4UA 3O9MA 4X6YA 2HA5A 4EUSA 1C7JA 1ZGBA 1VE6A 1C7IA 3KOOA 2J3QA 3FYUC 3G0CA 3H2HA 2IITA 5ALRA 5C7YA 4JUIA 4KACA 1RYYA 4FKBA 3DL7A 4KE8A 1TIBA 2QT9A 3WL6A 1MX5A 3WWOA 4H18A 5LZ2A 1EB9A 4GI1A 1JT2A 3WMRA 2DHCA 1XRLA 5AOBA 5JZSA 4X90A 2HM7A 3WK6A 1UKBA 1XZMA 3V1KA 1LPOA 2Y1KA 5EI5A 5BWBA 4KAAA 3DLTA 2HU7A 5AKXA 2UZ0A 5HQ3A 2WUDA 3QMMA 5LIPA 3STVA 4CIBA 5I8PA 2HA4A 3DKKA 4X6XA 2HA7A 4FHZA 3BF8A 5ALFA 4DSZA 1OCEA 3ILSA 1CIJA 1JU4A 2DHEA 3RKSA 5JAPA 1JMYA 4KRYA 5BOVA 4J0DA 2Z3WA 4P9NA 2HA3A 2HU5A 1BE0A 3FSGD 1EDBA 4FNGA 2VEOA 1MPXA 2QXTA 1J1IA 2ZSIA 3G0IA 2ZJ7A 5AKEA 1QIIA 3E4DA 3ESDA 4J0KA 4EB0A 4H7DA 3ICVA 4PNZA 3K6KA 1DWQA 2WU4A 3KWFA 2C7BA 3WK7A 2JIDA 3IVMA 4G1FA 5LZ9A 3C8HA 3DDUA 4EY6A 3H19A 4ZGBA 2X5XA 2QJRA 3D59A 3IIIA 3STXA 5IVKA 3DEAA 5CBKA 3F97A 1DX4A 1KU0A 3WJ2A 4ARAA 1Y7HA 4NMWA 2Z8ZA 1K4YA 1EH5A 1ORVA 3VXKA 2WG1A 1CUHA 2ES4A 1LPBB 5DYWA 3EQ7A 4BAZA 4UUQA 5E2IA 4CI9A 4EZIA 3R3VA 3OURA 1QJ4A 5ALWA 4Q3KA 4QE3A 5ALOA 1F0PA 1TAHA 3WK4A 3QVMA 4DMCA 3LS2A 2AJLI 5K3BA 4KR0A 1JMKC 5K3DA 4ZWNA 2YXPX 1TRHA 1WPRA 2O2IA 2XMBA 2XQFA 3A2NA 2ORYA 4QDXA 5JANA 5AKYA 4LXIA 3RLIA 4OU4A 4GHWA 4Y2QA 1O6GA 5HFNA 3LIPA 1XZBA 2WJ3A 5J3JA 2WJ4A 4JYPA 3FLEA 5AM4A 2OPHA 1Y37A 5AM3A 1MO2A 3H2KA 4U2GA 5JASA 5FP0A 3EF3A 5CT8A 2WFZA 4FMPA 3V1MA 5IKXA 2C0PA 1B41A 3G9UA 4Y2PA 4CG3A 1R9NA 1T2NA 3FWHA 3DNMA 1XRPA 3R3YA 2PM8A 2WUEA 4GW3A 4N5HX 5JZ9A 1YB7A 2WHRA 1ETHA 2X76A 1N8SA 4Y2XA 4LHEA 3WZMA 5K3CA 1QTIA 4AMYA 3EQ8A 4GDMA 1H2WA 1QFSA 1QIEA 2QR5A 4EY7A 5AOAA 3WK5A 5A7GA 4BTLA 1ZD2P 3LLCA 5AH0A 4J0JA 4K2AA 4WFJA 2P8SA 3TGLA 2JGIA 4LXHA 1G66A 3R41A 4XVCA 4ETWA 3S2ZA 4AXBA 4YPVA 3M81A 4BC0A 5D7BA 1A8SA 3JWEA 3W9UA 5CT9A 1LZKA 4MEAA 4C4XA 4B83A 2ROQA 5LZ8A 5A7HA 3I2HA 2QTBA 4C4YA 5AK4A 5HKAA 4BDSA 3FYUA 2XUHA 4BBZA 3R40A 3QBJA 5FKJA 4WY8A 1OILA 2E3JA 4X93A 5ALYA 3STYA 3DCNA 5JAOA 1XZGA 5CT6A 4UFPA 5LP1A 2Z5GA 4W9RA 5AIAA 1IZ7A 1FSSA 4J0GA 1FFDA 1VZ3A 4QWMA 1UWCA 4QDUA 1LBTA 1ZJ5A 3P2MA 4NVRA 2JF0A 4V2IA 2VAVA 1K6EA 5HZGA 5LZ5A 1AQLA 1ZI9A 4LIPD 3O4GA 1XKTA 2QZPA 5CW2A 5ALKA 4BP8A 3MGAA 4OU5A 3F9CA 4L3WA 2C5GA 5ALUA 4B80A 3WYNA 5E4JA 2GBCA 3A2LA 5ALJA 1QIDA 1A88A 3I1YA 4ZV7A 1CUGA 4FOLA 4B9AA 3IUQA 2I78A 5DYYA 1XZEA 5ALIA 2DHDA 5CRIA 4ROTA 2Y2UA 5AHXA 3ZLTA 1XZCA 1P0PA 1NU6A 1YAHA 3HEAA 2PU7A 5CMLA 5DTIA 2RHTA 2YH2A 1H2XA 3N0TA 1UOPA 1BS9A 3C5VA 1IUNA
chains in the Genus database with same CATH superfamily
1P84F 2VSXA 1QQCA 1M56B 3Q7TA 5CH8A 5BVHB 1HDRA 3G5UA 4X0EA 3QLJA 3VSCA 4QXAA 3HABA 4DDHA 3CA8A 5DTJA 3VKWA 2JGRA 1LW6E 2QE7D 2F9LA 3B13B 5I5GA 3ZZ1A 1SG0A 2ZUUA 1KAEA 3R24A 3PCRB 4KK4A 5TY0A 4QU5A 1X38A 2GN0A 4O2LA 2HA0A 4K1XA 5EIHA 5D00A 4EJ0A 2PUSA 3SYOA 1K75A 2R72A 3KEFA 2W4IA 3CEHA 4RLFA 2KJQA 3FW1A 4X7PA 3VO9A 1OZAA 4JZGA 2Y76A 4IHJF 4BAGA 2XBUA 3OI7A 3OPYB 3MJHA 3BICA 3M5PA 4TS9A 2WTEA 1KXJA 4B84A 4YDRA 1AN9A 3OE7A 1OI2A 1COZA 5IT9N 1K97A 2DTDA 1HG0A 1SOVA 3MUOA 4KXMA 4N8SA 3T41A 2OCIA 1ZK0A 1FFAA 5C5CA 3ZHYA 5BV0A 5M04A 3CUKA 1MJGM 1JALA 1EUDA 4ZV9A 1VSBA 1W88B 1WHSA 3TLKA 3ZY5A 2Z9CA 3CBGA 2OUKA 4WZBA 5KYXA 1KEKA 3ZLJA 4U2CA 4KVAA 4PZDA 2QN3A 1FFCA 5CBGA 1CQPA 3QVVA 3M7MX 3WYEA 1IHXA 2N1MA 3F5TA 1VXOA 2OHXA 4IIEA 4U6SA 2XB2A 3K9GA 3BEHA 2RDMA 1AIPA 4BNDA 1EGQA 1Y89A 3KSDO 1YQ9A 3KXDA 4WL0A 2VDWB 4YAFA 1OSNA 4Z53A 4X3OA 1XPJA 3AG5A 3L06A 4OBXA 1MA1A 2YIVX 4XGKA 1K7YA 3HCOA 2CCJA 4QO7A 2WHPA 1J1ZA 4IINA 2HRQA 1Z15A 1C1HA 1HFWA 4OI1A 4Y9UA 3E81A 3M5DA 5WRFA 4R1UA 1OTHA 5KAPA 5KOHB 1GPWB 2G3YA 1AB6A 1UP4A 3BD7A 4C20A 2ZTLA 1D9ZA 3OCCA 4G4GA 4OSEA 5FI3A 2P5OA 2NVUB 2ZR9A 1AUOA 1YCFA 2AR9A 2FYUH 4I19A 1RWNA 4C01A 1VL1A 2QPLA 2QQEA 4WKGA 4RULA 2R9VA 4BCDA 3F6YA 5L95A 5AJUA 1L4KA 4NOJA 1ZMRA 4QDTA 1WXQA 3AIOA 3HWSA 4Q00A 2HNKA 1UC5B 1MA3A 4MR9A 2PYJA 3I0ZA 3MQ4A 3C97A 4RZ3A 3H11A 2WSSG 2D0IA 3CPWU 2HLHA 2J59A 3EDMA 3RS3A 5HWSA 4ENRA 3AR9A 8MHTA 5BSHA 3NHMA 1JZTA 1EX9A 2MSDB 4PRKA 4UCWA 4BNKA 2LCIA 1SC1A 3PGMA 1O95C 3EQ9A 4MR7B 1O57A 3DE0X 3T52A 3CB2A 3BZWA 4R6WA 1U7OA 1KKMA 2CE7A 4FQ5A 1P6XA 4JT2A 1LBEA 3NMUF 4HWSA 3RKUA 3EY4A 4TYQA 3CCEV 3W4JA 4Q9KA 1ZIYA 2B4RO 3NC0C 1TQHA 1EXMA 1I7FA 1I1HA 2OE2A 3G17A 4TVBA 1CQIB 1SGWA 1EUCA 4FYVA 1T91A 3BWBA 1QE0A 4IUCS 1VSVA 4M7WA 2V6JA 4JAVA 1I4TD 1CC1S 1Z68A 1D03A 1KJJA 1ZD4A 2QEXV 2O0JA 3KV3O 5COBA 4ZEWA 3OMAB 1WLSA 2PUJA 3DFFA 3EGWA 3NR2A 1M56C 2V9ZA 3NHAA 3BT7A 1PW7A 3TW8A 4HAOA 2I80A 4YXFA 1IWPB 2I2XB 1W36C 5T5QA 3FFAA 4RJ2A 5ER6A 3CVYA 1XCGB 3AM3A 5C7LO 1R0KA 4PTZA 4NV3A 5I9MA 2GEUA 3QV1A 4QECA 5K4AA 3N53A 3G13A 3ZUPA 5EYPA 1QAOA 4TTSA 4B82A 4UVAA 4UU8A 2E0IA 2E4VA 4LNHA 1CIVA 4KFRA 3D3NA 4BLRA 1VPDA 1Q19A 3C4JA 4AIIA 1TKCA 2X2EA 1P49A 1U0GA 1UPAA 4R2WA 2VA8A 1FQOA 3FCEA 4GYJA 2DY0A 3V6LA 1CR6A 2WD9A 3L4SO 3QNMA 1D3AA 3H2GA 4YIKA 3VGJA 5KQGA 2OTJV 2JGDA 1WS6A 4LRUA 4Q34A 3W78A 3H2ZA 4Q1VA 3TVYA 4IFEA 3DGEA 1UPXA 1SXJE 1CFZA 1IUKA 3KQSA 1LS1A 3R0IA 1AO0A 4TS1A 3BMQA 1A5AB 2VQ3A 1TLLA 3OW2U 5KNBD 1V9PA 1R66A 2PLNA 1NVVQ 2AMVA 4L8VA 4DMHA 4W1SA 1GZHB 2VL7A 3EFOA 1FIUA 3CWBH 4TLCA 4JVSB 3M1LA 2VYVD 4KBFA 5MFZA 3RWRD 2VK2A 1P29A 4DJJA 2ZNJA 2G77B 4J7AA 1I08A 2GAOA 2OC9A 4N3CA 5JSKA 4XGIA 1RBMA 4LMAA 1OAOC 5SZHB 3GL9A 3B38A 4KLZA 4TZ6A 1CEEA 1ZH4A 1WSAA 2O8FB 4JGBA 3L4BC 4XJVA 3CIOA 3QUQA 2ZSJA 3ORFA 1Y1PA 5EIFA 3QKIA 2IPAB 4OHKA 1OCCB 4Q9JA 1KI3A 5DV9A 1X9HA 3H87A 1YTFD 3M1YA 1KC3A 3MTAA 3KHUA 4FFMA 2ZI3A 1WW2A 1J0AA 3L0BA 3E9YA 2OCPA 3KSMA 1G64A 3M1IA 3QITA 4PGAA 1ZM9A 2WLIB 1XE3A 4RK6A 2CGNA 1L9KA 3DEYX 3NM6B 4WRRA 4B87A 2PEYA 4E5DA 1BGVA 3I1JA 3KUXA 2XTNA 1Y4MA 1L7QA 1WAMA 2AIRA 1EVQA 2AMJA 1MZPA 1FRFS 1M1YA 1GDTA 2IK8A 3NIGB 2O20A 1Y4SA 4P33A 4HYTA 4DDWA 2JJ1D 4PINA 3EWSA 2E1PA 2QTAA 5TXGA 1I2ZA 5F76A 3FETA 4QIWF 1A5SB 3GELA 2ZJ1A 3R4VA 4GSKA 5ERGB 1NUTA 5JVDA 5EKUA 5H5JA 1U98A 4GPZA 1TF2A 3W2IA 5IJ0B 1A9QA 3UNXA 3PTLA 2IXBA 1QORA 2LFRA 1IHUA 2V96A 3AHGA 4BASA 1DC4A 1WJGA 2X6RA 3BJEA 3T38A 1F2TA 3ZNPA 4KL1A 5K01A 4A2PA 1PWZA 1ZY2A 1PNLA 3DVRX 2XMRA 1WKBA 1GRJA 2F1OA 5HRUA 1BYUA 1J42A 2P68A 3NHJA 2Q5CA 2I4IA 3D1LA 3CNLA 5COAA 2PL5A 2D3TA 3VOSA 3A6KA 4XYGA 4AXXA 1USWA 4NZPA 4O1IA 4DYHA 5K3OA 2N9UA 3EZXA 2HWXA 1YJ5A 2OCBA 3IQWA 1KAHA 4U6NA 5THXA 5AUNB 4UTNA 5EE1A 1ZHOA 3QPCA 4KQ1A 4RV9A 3S1SA 3SBOA 3LP6A 3CJHB 3K0DA 2OHHA 4GLBA 5CJ2A 1JFTA 1OFTA 4TKUA 5A62A 4BMPB 4LI0A 4RFSB 3AVYA 1S89A 1NR5A 2DFDA 2ZVJA 5TARA 1Q7TA 2CUZA 2NW6A 4ZJYA 2JLUA 4H15A 2O1SA 4WZ6A 3ULKA 1MH1A 2NV2B 2RGGA 4EWLA 5BMVF 2QP4A 4RELA 1KORA 3KCXA 3E1SA 3RB8A 3THYB 2H54A 1XTKA 4TT8A 4EHFA 4Z2AA 1JECA 2B21A 5H4HA 4BN0A 3FHOA 1Z4NA 1A4IA 2G5TA 1Y5LA 2QLMA 2I29A 2D00A 1JEDA 3ZWNA 4GM0A 3L4JA 5AYVA 1OQAA 3PYLA 4B35A 1OA0A 1D09A 3Q4GA 4RM3A 2OD2A 2QNRA 3I4LA 1JXAA 4PO8A 5J40A 5LOVF 1Y76A 1KI6B 3LSSA 4ES6A 4PA6A 1TNDA 3VQTA 1ZLXA 1ODTC 5EK0A 3ORRA 1G3UA 4BGDA 2DSNA 4MMYB 1I1NA 5A2GA 4IXTA 1XO1A 1VMKA 2ZZMA 4MNTA 4O4JB 4H33A 3T3GA 4H77A 3F5DA 3BXEA 4DDTA 4PELA 5FBLB 3M34A 1ODJA 3QENA 5TE9A 4WOJA 5J2UF 4QUHA 1ECBA 4OF4A 2JCVA 3CEAA 3SLRA 2QAGB 4BB6A 1QVGU 4IJQA 3KKLA 4HQKA 1PHPA 5G41A 3BCCH 3RVNA 4DCGA 5C1DA 5KINB 1V45E 4HLCA 5F33A 3NVKI 4JLVA 5FA8A 3B7GA 2JJ1G 1WE2A 3NJ8A 5EIOA 2C9OA 1SUDA 2QU7A 3J81A 2JFPA 1V35A 3AEKB 1IHDA 1CF9A 2X6QA 2XA9A 3U4IA 5E2BA 4RL4A 5DYGA 4YWJA 1WD5A 1CUJA 2P9BA 5JAQA 1EQ2A 1S72V 3NASA 1THZA 2JFBA 2KS6A 2CFIA 2WKSA 2ZXEA 5HRAA 4Y2YA 4CLRA 4LYGA 3A6FA 3D1VA 1IOVA 1E1MA 1G55A 3RGBA 4L6CA 4HVAA 4FFVA 2DT5A 2ZRNA 3JQEA 4R8MA 2XA1A 4UAUA 2R6FA 4V0NA 4NE9A 1UBUS 4PC1A 4X1OA 1A7UA 2R1VA 2J7PA 4M0EA 1AI7A 3C3XA 4GICA 3E61A 1MX3A 3P4UA 3N2KA 1BEEA 3H0CA 2J0SA 1NZFA 1V11A 5HKBA 1KQ3A 5K5EA 3B53X 1NJGA 3HN6A 3DAOA 3FYTA 2XYRA 2VPXA 3IO5A 3MAAC 4F56A 5KCZA 1ZXXA 5J3JA 4D4LA 1PNMA 1EJBA 5KO2A 2VBFA 4HAMA 2Q2OA 4JT9A 4MGEA 4MKRA 4RPJA 3RFCA 2YIBA 4HR7A 4UXNA 1Z0UA 1G8MA 4HG2A 1LBHA 1NT2B 4CTJA 5LQCA 2IU3A 3A1VA 1ZH6A 3KJIA 4JR0A 3VSDA 4F6RA 4MW3A 1OF1A 2JIZA 5BSKA 4E7OA 3HJFA 1FJHA 2QRLA 3ENWA 2WPDA 1Q82W 2JAWA 3V8MA 4PYJA 2PX2A 4JEUA 1QU7A 4LF7O 1T6BY 2W2LA 3GLQA 4B6EA 5KQLA 4QYTA 1ZONA 1VJDA 2PO7A 3OESA 1T5OA 4F71A 1AXRA 2XWQA 3NIDB 1D2AA 3RK1A 1YI8A 4BV2A 5K6RA 5J4YA 4LXGA 3KX2A 4OUKX 1L8QA 1DJMA 2WLKA 4RU1A 1FNBA 4D1YA 2ZB4A 3HVJA 1NX9A 3HU2A 4FJ1A 1HT0A 4C76A 4JLJA 3GPIA 4JUBA 1F6DA 3CRAA 1XC7A 3MWEB 3TF5A 1F48A 5CYPA 4YMTA 1IBCA 3RC9A 1TYDE 4Q5IA 4B44A 3GLFA 5H8WA 2OG1A 4OMDA 2NXWA 1K92A 2IZZA 2W6ZA 5C35A 2YICA 3THOA 1WVMA 3O8NA 4JN6B 4D8WA 5CG1A 4WDRA 1VQPV 3PRKE 1M34B 1URPA 1ZHHA 4JC8A 4CCAA 1G4HA 2B1IA 2HF8A 2HHAA 2VJBA 2P4QA 1SOWA 3ZE6A 2QSUA 1G8YA 5B57C 5HSGA 1BXRB 1EZZA 1W0CA 3D6TB 4IDNA 4TYNA 5K20A 1ZQ1A 2IYYA 2VRBA 4HDKA 1QVAA 3QEMB 2PLFA 4DV3O 2PQ0A 3MT0A 1K1EA 3ON5A 1MAWA 4QEKA 2QR2A 2HR1A 1CEQA 3NIWA 3I6ZA 1IC6A 1HFEL 4BQIA 2FL4A 1YHQV 1KHHA 4OHPA 1TEHA 4OM7A 5A7FA 2CE4A 2DVMA 3F6PA 2FWAA 3SIRA 4AIRA 5C5IA 5FOVA 1VEWA 1V43A 2R7NA 3A3KA 4Q66C 2CLOB 1EVIA 3IR5A 2KHZA 5AVZA 1JDVA 3F1KA 2GETA 1NRWA 1U1FA 1UINA 3K53A 3ZHZA 1QGZA 1RWKA 4OFZA 3HXPA 4AZ3A 4BLPA 1FFXB 1RFYA 5LA6A 1OTXA 2CFTA 1IG3A 1SCIA 3N87A 1F2VA 4OI0A 2DYRC 1U8AA 3EGIA 1EFPA 4HH3C 5EZSA 3B1VA 2NUAB 2QBYA 1PT8A 1TC2A 3C1OA 3MWJA 1FQWA 3QOYA 1QHXA 2PY5A 2DBRA 3R1IA 4GOXA 4NU8X 4Y6PA 5G0UA 3X2QB 1J5PA 2WKWA 3ZW7A 4AMGA 4D9EA 1JR2A 3V34A 2VDOB 2XUQA 3B6JA 2QYHA 3FRHA 5CGZA 3VDNB 3VKFA 1BJKA 1G2QA 1HDGO 2Q4OA 1ZD3A 1ODKA 1JI0A 2QUJA 4H7KA 2NXNA 3DBHA 1XLTA 2KYRA 4FJ2A 1IJEA 1K3FA 5ENDA 3E8XA 3O2JA 1M57B 1HSOA 2WLMA 2JLQA 2KQUA 5AKJA 3ZE2B 1HGXA 2VN8A 821PA 1LPNA 1U1DA 2CNWA 2XAAA 1Y74B 2WSMA 3H7AA 3WYDA 4E12A 1FQKA 1ZCFA 4LDNA 2PSJA 3EB9A 5JO0A 1L7OA 2R00C 2ZWMA 4O6VA 1NJ8A 3FPEA 2MT9A 5IW8A 2NSLA 3E5RA 1WHTB 4L8GA 5HM6A 3GBVA 3O94A 4NJMA 4DNQA 5TEVA 1TA9A 3L46A 1AS2A 3F5QA 4AJ4A 2Q6OA 2IW5A 2GJAA 4I46A 3WGIA 4RGBA 2A7XA 2Q7EA 2AJBA 2VLBA 1GPDG 2YFQA 3K09C 3R5SA 4X8MA 2PE5A 2W4QA 1J8MF 3HKCA 1J22A 2BGTA 3AUTA 3SS9X 1RHKA 1WW3A 3KP1A 1H2EA 5FI0B 3PFNA 5JS7A 2V9PA 2NTJA 5CFLA 3AG3B 2FJPA 1VYVA 4FUTA 3BA6A 1H0HA 3EASA 2PUBA 1JHDA 2VDRB 3U44B 4ZBMA 1NMXA 2GJKA 2NO7A 5A1TA 3DXZA 4B1FA 4EZBA 1RYMA 5K6AA 4A27A 3EEYA 4GM4A 2F43G 2A5FA 1CVIA 3TX2A 1JJVA 2IY9A 2B8NA 1Y1QA 3OJLA 5A4AA 1LVGA 4CIVA 5LL6Y 1S8OA 3KWLA 5DVZA 3CX5F 1F17A 2QE7G 3PJDA 4L08A 5JO9A 4MGYR 1A97A 3SSNA 5GIPE 1DGQA 2NZWA 1JLLA 1C4KA 1GN3A 4Q03A 2KPOA 2NQTA 2QQGA 1H2ZA 2CBZA 3MRVA 4MVMA 2PRYA 5AKZA 2EQAA 2YIDA 3N2KB 3PIRA 4LOAA 3UKMA 4RF3A 4EQ6A 4ZVVA 3FHTA 2RQ6A 1DT5A 2BI8A 3Q2OA 3NFYA 4US2R 5EE5B 1BCCH 1MIHA 2AEMA 3KAJA 4HQLA 4US0R 3U37A 1R3JC 4AC9A 3I5UA 4JELA 2I91A 4CMGA 1ZX1A 4LJKA 2CBGA 4LSWA 4YMUA 1YL5A 3KTAB 3ASNB 4JJZA 3QNWA 2XAQA 4JP3A 2A3RA 1NHGA 3CVJA 4KC0A 4BKQA 3ILVA 3G68A 1PR6A 1PQUA 2ZI5A 1KDOA 1AKMA 1GTG1 3JPWA 1A9PA 3CO0S 4BE7B 3ZBQA 2NO0A 1M90W 3DC2A 1K5PA 2EV9A 2PIDA 2YN2A 4L95C 1M5TA 3VPFA 3BCSA 1O9GA 1WCIB 2F48A 1DAFA 1V1RA 4DL9A 4PZUA 4TLMB 1TT7A 4GUNA 3STLC 1ZX3A 4K3AA 2J9GA 2Q9BA 2Q6KA 3DBRA 2GFIA 4HVCA 3N2ZB 1ISFA 3T9CA 2OO7A 4BQRA 4RK0A 1II8B 2I4MA 2JLXA 1KYYA 3WBJA 1N8TA 1IN1A 1DFHA 1UKCA 4NICA 5BMVB 2SBTA 3C45A 4JU9A 4P5DA 4TN5A 5B1DA 3X1WA 4ZICA 2A9PA 2QMHA 3KYDB 2YXBA 3CC7V 1YOBA 2HGSA 1WY7A 1J2UA 1QOZA 2NTEA 2VHWA 2PZBA 3ENZA 3OKPA 4M0LA 1NIPA 3LCMA 1NC3A 3AH8A 4CH6A 1JQKA 1ZVQA 1DBWA 3PGKA 3WGVA 1AGYA 1J23A 2YEVA 1ZL8A 4RLHA 3OZVA 4PIVA 5KJEA 4IF4A 3QPUA 1AUXA 2A5DA 2RH9B 3FCYA 2VAMA 3QWFA 1ZRHA 3DAHA 4OFXA 2IZ6A 1YZNA 2Q5OA 1PYGA 4CDNA 4US1R 1ZOIA 3O03A 5CVDA 4OG2A 2ZM5A 4JA0A 5BO5A 1S7CA 1VGVA 3CS3A 3NNNA 4X8HA 5I9TA 1V2HE 3ZDEA 3CY6A 5HJ5A 4MVQA 2WDZA 4HBZA 4MV7A 1YE3A 4KPUB 3S7ZA 3WDKA 2WQ6A 1BN7A 4RFSA 3WWDA 4YT4A 2X9GA 3ESZA 2JBAA 2QP9X 1ZN8A 3HV2A 1NLFA 2ECFA 5BSTA 4ESOA 3ZMSA 2K7FA 1DTEA 1AR1B 1G20B 1JEJA 4ML3A 1HTTA 1BU8A 1TI7A 4KOAA 4L5JA 2PSFA 3I6IA 5INTA 3AFIA 1AHNA 3D7SA 4G5RA 4FFKA 2AW5A 5ALNA 3ZCTA 4M1WA 5DTMA 3GFRA 1ZA1A 1SC5B 4TT3A 4WMLA 3WL5A 4FHGA 4JF3A 3E3MA 3KKZA 1NF2A 4G36A 1CU1A 3WV4A 5JALA 4UE2A 4HRYA 2FXVA 3NT4A 4ARZA 1NP7A 3T3EA 1EP9A 4W5RA 4QBGB 4WH0A 4AMZA 3AEIA 4MUIA 4I1VA 4LXUA 4QDKA 4YAEA 1SN7A 3TFOA 1RKXA 2O3RA 4CHTA 3JSLA 1U2DA 1LUWA 4HF7A 4I1UA 3ZPXA 3CLTC 5HF8A 4ZCQA 5E7MA 3SQLA 3WLJA 2OHJA 1XRQA 3Q7QA 4OP2A 4EITA 4QTYA 4ITVA 3N2NA 3WBBA 1PR0A 3FWYA 3ZGNA 1X7YB 2O0LA 3DMYA 3DYVA 4GG1A 3U81A 2ZS9A 3VV2A 4UHBA 1N8NA 3HVIA 4FX5A 2ITCC 2BFBB 3C3AA 5CTJA 1G9SA 2RI1A 3K2IA 2UXNA 3OKFA 2I3DA 4NE2A 4OXNA 4ZQFA 4D3YA 1MABA 3EGXA 2OPBA 3HP7A 1DIBA 1EFRG 2Y8EA 3D3WB 1P1HA 1GSAA 1R74A 3CSUA 3LVQE 3AR4A 1C8BA 1ZWIC 4JI1B 2WF8A 4D9BA 5JYDA 2EIMB 1AU9A 2Q7XA 3STHA 2P35A 5FFMA 1P9LA 3A3PA 1U2EA 3CX4A 3D2BA 1HNWB 4DQXA 1DF5A 4YRPA 4EFMA 3KUKA 1SS3A 1KI2A 1Q21A 3DDSA 3FOAA 1SAYA 3VTZA 1N3BA 3L7MA 5JXJA 1AKRA 4B34A 4ER6A 1VQ5V 1T9GS 3UHFA 4RK7A 2QSYA 2YZMA 1A9OA 1QZXA 3H5IA 1CUAA 4XCVA 2FZ4A 3Q12A 2FHPA 2OSBA 3GLFE 5NLLA 1UXOA 2Q0OC 3NDRA 3DR3A 5E2AA 3LW8A 5CA1F 2VP5A 4B76A 1N9GB 1RLMA 3ZG6A 2CNOA 3JYLA 5JEDA 3WAGA 4B8YA 1CZLA 4ZAXA 4RK4A 3L79A 1GRVA 4KYVA 5LDDC 4REOA 3H6HA 1C30A 1Q1GA 1GA1A 3H9VA 1X1CA 4TWAA 1I4EB 3DW1X 3K96A 4W4KA 1NUUA 3ZWQA 3BMXA 4ZDIA 4JHLA 1QUEA 2C95A 3ETEA 1U8EA 4K9LA 2WWVD 4DBLC 2AXTZ 4EH1A 4YJ2A 2HWYA 4HDNB 2WAAA 3HR4A 3V3KA 3B3QA 1KWGA 1QP4A 5COQA 3QUTA 4L6IA 1M5RA 5ITZA 1L5FA 3ADPA 4JV5B 1XVIA 3LTEA 4O2BF 3OO1A 1A9SA 1T4BA 3DTVA 5AXDA 3ROZA 2NT4A 3ESYA 4I5GA 3UF0A 4HQ6A 3VPSA 3EEFA 4GI2A 1GKUB 2REBA 1CIPA 4KEAA 5D8DA 4EP1A 2P2LA 1WNSA 3AF2A 1PR3A 1E9EA 1M1NA 2TECE 3EQZA 2P40A 3M4ZA 4HNTA 2FE4A 3CCCA 4PC2A 2VUIB 4PLHA 4AJJA 3W6NA 2M6KA 4MQUA 1JN0A 3U3XA 5IU6A 3S99A 1AMUA 3TUJC 1OXXK 4NHEA 4BV9A 2JBAB 5IAGA 3DTVB 1LNSA 1UIMA 2P9HA 4PSKA 2O4UX 5DNCA 1Y3BE 1I4DD 3EX7C 3U61B 2JGKA 4QGFA 1KAOA 4QL3A 1ZJWA 4OBEA 2QTVB 2XR1A 4M0CA 4GYKA 3VYVA 2EX4A 2XSZD 1FDVA 2P0AA 2AK2A 2HREA 2R47A 3DE7X 4MI6A 2W2KB 1YZQA 2VSQA 1U0SY 4HQ0A 3LNTA 4I8DA 4HZ3A 5D1NA 2Q8NA 3P32A 1MC1A 2OCDA 2XDQA 4EY5A 3G5MA 2F7SA 2OGZA 1N32B 4FSHA 5B64A 4CMBA 3GH1A 1KO5A 1Z5GA 5LQSA 2AD5A 4N48A 5C93A 3CNEA 2P41A 4K5QA 1S8AA 3RYTC 3FFBA 4KREA 1KQOA 3IVCA 2O14A 1XREA 3E2IA 3BHJA 4PVDA 5FXMA 5K8VA 5LIRA 1FJGO 1JVMA 4Q05A 3MXOA 3KQWA 4I6JA 5F5LA 3R7WB 4YCSA 4E11A 4BLWA 1THMA 2WWYA 1XG5A 1V8PA 4YP9A 3LZ6A 3UHOA 2UXCO 1OBHA 3ETJA 3P3PA 3QXCA 3USZA 2PL9A 3FUUA 1HMYA 1E2NA 4Q1AA 4E70A 3FD8A 2FFBA 3KKOA 3D3WA 4RZSA 4FR0A 4BMZA 2V7VA 1OH7A 3OQIA 1NMYA 1GQYA 3DTUB 5K9ZA 4G4SO 5B1SA 4BP9A 2NO9A 4MYTA 4RPKA 4BFWA 4ZYVA 4CXMA 1B14A 4K3UA 1VCHA 1CP9A 1ESMA 2RMKA 1Y98A 2Q3JA 4NTXA 1KI9A 2FZLA 1UC8A 2OB2A 2QTMA 3FNFA 3MJEA 3OZFA 3PVSA 4GWLA 4LKOA 1IBMB 3DC6A 4RADA 5CLHA 2IBTA 1TGYA 2GBGA 5EZ5A 4GYCB 1X7XB 2BFCA 4V2UA 1KFCB 5ED4A 1KP3A 3EFEA 4ZMSA 2A57A 3CXUA 1X1BA 3LP8A 1ZJ4A 3EEBA 1M93A 3NNSA 5FOQA 2QJOA 5DSXA 4EG0A 1OWMA 3DZIA 1L5OA 4IIJB 4OB6A 1G7RA 3M4XA 4PLWA 1E79D 1IY1A 1XOIA 2F9MA 4N0MA 4W1QA 3W4IA 2XQKA 3LSQA 1ISHA 4GM1A 2XGGA 2EJVA 2QZSA 5F1KA 4EIWA 3MRSA 4MYRA 5E79Z 4M1KA 3VSBA 2C8VA 5BN5B 5G3ZA 2IYSA 1HNZO 1XKQA 2EEPA 4UEJA 3ZMZA 5IT0A 4DR4B 4ZTZB 1Y8ZA 4BNDB 4EX7A 1BROA 1C1YA 4B75A 3DVAA 3WRVA 1QR8A 4PZ0A 4ZI3A 2NR5A 5FV4A 1XD9A 2K5UA 1YMVA 4OQQA 4BCBA 1I7QB 5CA3A 1N7JA 2W6NA 4A6EA 1ZESA 4N8DA 1E59A 4QPNA 4P92A 5THKA 2PMEA 3T8YA 3EVFA 4TMFA 2I3AA 1YS2X 4AUMA 5CFZA 4KLNA 1L7BA 1LC3A 3VUEA 3DMPA 3DM5A 2VTKA 4V1CA 5EJ4A 5JTTA 3RVZA 2HRRA 2BE7A 3NGMA 5FUYA 1Q7BA 2PH1A 5EXSA 3HCDA 1OMOA 4BWYA 1JI3A 2B3TA 3WAKA 1W2BU 1XJWA 3ZD7A 2IPLA 1QRAA 2CV1A 4WFGA 4OV6B 3LBHA 2J41A 2CWWA 2KLHA 3AXSA 1HYHA 1RRMA 2R6AA 3FMPB 4ZHQB 3OPYA 4H17A 4J0CA 3I39X 4RVFA 2FK7A 4FLFA 4HH0A 5FQOA 4C0HA 3W6ZA 5IULC 5CLQA 5LHHA 1WA5A 3N6XA 3FUXA 1PX0A 3RG8A 2CMGA 3I45A 1E77A 5IZCA 1BTOA 2VTEA 2YXEA 3FKSD 1QGAA 4XXHA 3SC6A 3HJBA 4Q37A 1UFKA 4PEVA 4EMTA 1OCZB 4UKDA 2X5JO 4B6RA 5K3EA 1FVHA 2E82A 2RBEA 3NHZA 4CV3A 1E18A 1RLJA 4WKBA 4EABA 4BEJA 4F8YA 1Z26A 2PTHA 5GJBA 3X3HA 1UPCA 2CTPA 1T9CA 1DB3A 1QAMA 3K0CA 3P0FA 4CGZA 2NZ2A 4WE3A 2YMPA 4P9PA 2V0CA 4E5UA 2XVZA 1IWBB 3JVIA 4MA4A 3BIWA 3LUHA 2Z0AA 4RMNA 4LR3A 2CHVA 3G49A 1ELOA 1NN5A 2NZUG 2Y4OA 3PGLA 4IXWA 4JJ6A 3HCPA 1LBSA 1F9EA 1T5DX 1HLPA 1NQTA 1IY2A 1SKUA 3MYRA 1EFVA 1RZUA 3AR5A 3CUEF 4YONB 4HRAA 1P7WA 1TL7C 1MAHA 4R6XA 1VIYA 4QOIA 5EHQA 3WFIA 3JQ7A 3T3DA 4H59A 4PVCA 3UENA 4M55A 1MNAA 4P32A 3TXQA 1E0DA 2XD4A 1I4WA 1GCGA 2JL1A 2VDJA 3BH6A 1UK9A 3TQFA 3GZ4A 2GEVA 4FHEA 1SHUX 4NZZA 4G5GA 2I1WA 2FMLA 3O5AA 1DINA 3IEIA 3WK8A 2OV1A 1UPBA 1XHFA 4F46A 3C90A 2VEDA 1JB1A 3V4ZA 1B04A 2P75A 4LBEC 1NW9B 5LD2B 3VH4A 4WNAA 4TKMA 2VP6A 3S44A 3ZK7A 2HYDA 3QY0A 3VX4A 4D25A 1I1QB 4X62B 5DPMA 3PC2A 2DGDA 4HAZA 5BR1A 5HQTA 1RZRD 4MS1A 4C04A 4K6GA 3ER9A 4ZVLA 2H1LA 4MCAA 2HMTA 1QAQA 1C2TA 2ZYUX 3AGQA 4L5YA 2ISQA 2BCEA 2ORVA 4YV0A 1GGKA 5A4IS 4P7JA 3LT0A 4JJ8A 4LE2A 1Z73A 4FTWA 1DMSA 3GGJA 2WA3A 4PYNA 4YAGA 2WKQA 4HWKA 1SCJA 3HDGA 3VR6A 4E4TA 2OMEA 2W37A 3ET4A 1W52X 3B1ZA 4DBLE 4O4HB 1O0CA 5KTRA 3FZYA 4LCEA 4NLLA 4UCFA 1QHHA 3QKSA 3JQGB 1NDUA 1K4CC 2K2QB 4WKCA 5AK6A 1HOTA 3FRIA 4J16A 3AG4B 4FGJA 2BUCA 3BHIA 4IEIA 5G0VA 5A0FA 3PUKA 5YASA 5B3KA 2I6SA 1M2EA 4AKSA 3U0ZA 3TTTA 4D82A 4TTTS 2VNKA 5DHUA 3M9LA 2G8LA 5IVPA 2XVXA 1P1JA 3WL7A 3O1LA 2FLKA 3GVMA 2CUKA 2GTIA 4URWR 1Z13A 5KVCA 5BUCA 1RPZA 5F9MA 4IEFB 5IKOA 5HNKA 2N1BA 3CZ5A 3BF7A 1Y63A 3ZCPA 3GV0A 2X3UA 3PNVA 1EAMA 2W6JG 1TFRA 1UFOA 3NUQA 1DT3A 2JVKA 3NC4A 1J2EA 1WMAA 5HIMA 3IUMA 2IX9A 1QK5A 1N5IA 5IF3A 5BZBA 5DYIA 5EUCA 3FA2A 2PBFA 4J11A 2Y3IA 3HFSA 1MQAA 3REGA 4AWBA 1F12A 1E7SA 1LPMA 1W96A 4KUGA 2EBFX 3UCEA 3QLUA 3ZRVA 3UJ7A 1LPPA 4JGSA 2HXGA 3TNDA 4MVJG 4LDPA 1KE2A 2EJCA 4DMFA 2XB8A 3FYUB 4MIKA 4MV4A 5JPCA 2Y0PA 3JATB 2PX6A 1XJQA 2NO6A 4PBTA 1YK1A 3BXOA 1IPFA 1QGDA 2AH5A 5M7EA 1X8LA 2O9JA 1QYIA 3LNCA 3JAWB 1QSGA 5AKIA 4Z1VA 5C4IA 2V4ZA 2Z6AA 2BKEA 4DLBA 3LX4A 2Q73A 1RQXA 2LP4Y 3ZGLA 2DLDA 1FFHA 4PDVA 3GQBB 1W9MA 1EGAA 4ZMBA 5AQ1A 1JQAA 4Q9DA 4R05A 4RXUA 4C07A 5KBYA 3DMTA 1WAZA 2WA2A 1QS0A 1B2RA 3GN2A 3WSWA 3VR4A 3RS8A 2ERXA 1VARA 1ZICA 1OROA 2B7CA 3DGEC 1APBA 3CN9A 1PGPA 4X7BA 1O8BA 1R4AA 3THXA 1GLVA 2PN1A 2PX8A 4GX1A 4CN8A 3O3MB 3FOFC 4KXLA 3ZBTA 5KSPA 4QODA 3RWOA 3N1UA 2L35A 4WCVA 5GAJA 1FDOA 2QD5A 4Q9HA 3B2EE 4DO2A 2Y67A 1BIFA 2FEOA 4BWFB 1R6KA 2QU8A 5FPTA 4M0KA 1EQUA 2Y99A 1E2UA 1KMHB 4EHLA 3CGGA 2GPSA 3S8YA 3KBOA 2XD9A 2ACKA 1M2VA 3MHTA 1WCXA 3KVVA 3JWJA 3O84A 3RIHA 2IRWA 3G9ZA 3DLAA 4JP5A 3U0VA 3DO6A 4QUEA 4IJ5A 3PNLA 2HQRA 4NARA 3IV9A 1QLWA 2V7BA 4YS6A 5C1OA 1G21B 2OXIA 2QENA 3K1TA 4CNQA 4TKLA 2OVFA 1BMFG 1DKNA 1K2WA 1Q3HA 1XJCA 4QXRA 3SI7A 4CUKA 4DM7A 1L5RA 6AT1A 5IXYA 5KYWB 2F67A 5EKXA 5F4ZA 1C8VB 3EMKA 2HI0A 3PVCA 3SYKA 1P8JA 2VUHB 3DE2X 3RVRA 1G20A 4PO9A 5B58C 4TSKA 1SG6A 3ZVNA 5A0VA 4X1KA 3R9XB 3SHOA 3QTBA 1NYQA 4DCMA 4EF4A 1OTYA 1E8MA 3OTOO 1C81A 3I8XA 3SBEA 2YWGA 5D5HA 4MQ4A 1DAKA 4RLSA 5AJZA 2YJ4A 4Q21A 3HU3A 2WAYA 1R1DA 1Q14A 4D8TA 6PFKA 3EJWA 2GCGA 3UPUA 3QO8A 2I4LA 1KVSA 2QUAA 1VQ6V 4BX2A 4MLDA 1L5WA 1UANA 3DG9A 2CTWA 3P5SA 3BTOA 3KQOA 5GM1A 5BY1A 3B82A 4CKZA 2ZVDA 2WWGA 4BTVA 3BXPA 1U6JA 2HLDA 2VJNA 3AYXB 3KZIZ 3CUSA 3DBLA 3VC1A 1ISRA 2RH8A 4FZ3A 3JD4A 2GJSA 2TYSB 3GRYA 4A26A 3ACCA 3Q9UA 1MAVA 2PD3A 1WF6A 4M8KA 4JVOA 2Z43A 3M82A 4Y67A 1GHTA 4M9QA 2PJUA 1NBIA 1M6YA 3K0FA 3HN7A 4A0QA 2F17A 3NOXA 3HGMA 3O9ZA 2XYGA 3O83A 5AJWA 2GZSA 4BJ1A 4RV5A 1B06A 2QRGA 3M3DA 1UT6A 3EHBB 3U7RA 3C5HA 1IJBA 5FOWA 1VQ7V 3HXKA 4PJ0Z 3VC7A 4C5AA 4IGGA 1U2QA 3GX1A 4S0ZA 2QGFA 2E85A 4K35A 4L4XA 4RLQA 3IOBA 1F0KA 3HRIA 1JLSA 2RHMA 3PXGA 3L8MA 3IT3A 4UM8B 2E75B 2VUTA 1STOA 3EXFB 4OB8A 4XB6B 5EWLA 4DQ0A 3K6SA 4GPBA 3LT5A 4IOKA 2LO1A 1EHYA 1JJFA 2PT5A 3BD6A 4EDHA 1KYZA 2L18A 1IVSA 4HZGA 5LU9A 1DO0A 2GPBA 2JFHA 2JJMA 3AFNA 4IQFA 3R8FA 4V0ME 4IM7A 3V1UA 3F4KA 2VPIA 4CVNA 1QC5B 5IASA 1PBNA 4OA8A 4MW4A 3DE3X 1OJ7A 4X20B 3ZS8A 2I7DA 3VC3A 4BFTA 1KHTA 1NV9A 2QZJA 3BWCA 3E3NA 4BMSA 1JDBB 1P7ZA 4XYEA 2PKRA 5DN9A 2GH1A 3W2GA 3K79A 3WC4A 4Q9NA 2GLTA 4EO9A 4FGLA 3AY6A 4O1HA 1VJGA 2I4OA 4JLWA 1Q0LA 2B5OA 4I5EA 3DH0A 4Z4CA 4Y9DA 1KD1W 4NFHA 4QDOA 5EPOA 4L50A 4CLHA 3HA7A 3WJ7A 4GP6A 1HFJA 3PLAE 3JWIA 3ME5A 5CU7A 1WPXA 4EGJA 621PA 3UGJA 1GQOA 2PQ2A 2Z6VA 2OYSA 5EY5B 1RC8A 4KSYA 4RL6A 2P7TC 2Y4TA 3JSNA 2DLNA 2ZSUA 3ZWYA 2V98A 3W8NA 5C9ZA 1TUEA 1Q57A 1LWOA 3E22B 3DZDA 3NEJA 3NTOA 1W1UA 5D85A 4E5VA 3N28A 3SHVA 3CNQS 1KZ6A 3GJ5A 2QIPA 3KS9A 4MB6A 1PR5A 4U00A 3EFOB 3WRYA 4JI3B 3SXUB 1NQ5A 5CB0A 3C6XA 2J9ZB 4QULA 3VU3A 3ELWA 1OWPA 3VFDA 4X41A 1S3JA 1W75A 2C77A 2HQBA 3UC5A 4YXWA 4DG5A 3ZCUA 4IZIA 2F93B 2WK1A 4AO7A 5HOQA 1GM9A 4WXYB 2GN1A 1PUJA 4J29A 5TGDA 3CUUA 4P3KA 4Y9TA 1NN3A 1N0UA 3OJXA 2JPDA 1Z56C 4S1VA 2CJPA 5ENVA 4DK0A 1SXGA 5BXQC 4HYYA 2HVJC 1SZTA 2OL4A 2FU5C 1GM5A 5L3DA 6REQA 2WHXA 4GKJO 1IDOA 4MB0A 3OTGA 3A0RB 2RK6A 5L3RA 1FPQA 1OBOA 3W8DA 2XB4A 1QG4A 1FTSA 4BYMA 5E1AC 5BUZA 1OVGA 2W2LD 3GEMA 4JLAA 3A1TA 4GQBA 4ZODA 3KZOA 4B32A 4BIOA 3B36A 4OVKA 4WACA 4D9FA 4KJZA 1T0BA 1DIAA 2GHTA 1CJUC 3BFVA 1NGSA 3ASOC 1TUIA 2B8WA 1BSVA 2XAUA 2ZTHA 1YK0A 1AZLA 2A5LA 2DBVO 3FJYA 1RYBA 4IVRA 1SXJD 4X3PA 5LDGA 1FS5A 4MS3A 1PJZA 3KQKA 1F8YA 3D2CA 4NPAA 1TVMA 4Y7DA 2BTOA 5EZYB 2HK7A 1NURA 1Z6QA 3DV0A 1XNGA 1BE1A 4WA7A 2HT1A 4Z6KA 4Z7NB 1QS0B 3SBXA 1NF8A 3RARA 1NF3A 2C9DA 3L04A 5BR8O 1LSUA 4D43A 1R1BA 4GZ6A 3LHKA 3LRTA 4S04A 2MSEB 3AJEA 4PHTA 5IVHA 1JPNA 5A71A 4Q20A 2RAPA 3K8QA 3OTQA 1LBIA 3T7SA 1U9JA 2HCJB 3BIFA 3EFHA 4DV6B 2Y66A 1QYWA 2PKYX 3OOSA 4DYVA 4FB5A 3H2BA 1X7ZB 2W6MA 3PL5A 1C9YA 2GBFA 3EARA 3PUYA 5DHPA 4M7PA 2H5LA 1G3MA 5AW3A 5AVSA 1M6NA 4DUZB 4EAAA 3U3ZA 3URKA 5KNCD 1A5ZA 1U7DA 3R6LA 4HQNA 2Y1WA 2HF2A 3W7UA 1DX9A 2EAUA 4PGGA 1I7NA 1XZJA 4AYWA 3KU1A 5GTHZ 2Q07A 5DOVA 1J0CA 1HQYE 1RR6A 2JEUA 3O8DA 4RD4A 2R9RB 1UJ6A 3L9XA 1YSCA 1C4XA 2H4ZA 2H7CA 2NN3C 2GUZA 2OESA 3FSEA 4PYKA 2WILA 4LC9A 4BFLA 1RJ9B 3INGA 1M2FA 1XV5A 4I55F 3SHWA 1N3YA 3E9NA 4ATNA 1H85A 4HLNA 4MYHA 1C5KA 3JALA 2H59A 2X0IA 1HKUA 3DMFA 3KHKA 4MS4A 5IP5A 4DW0A 5LQRA 3CCVV 2FQYA 3NBFA 2IT1A 2B2XA 1PSZA 1U9IC 1V0JA 4OYLA 4PHZA 4ERNA 3GARA 3EPPA 5TEWA 4H9GA 5CURA 2OGSA 3N59A 4DIDA 2Q6AA 1ULBA 2XUIA 4ME6A 3Q4HA 1CUBA 2BP7B 5JNLA 2FJ0A 3T1HO 1RAGA 2WY2D 3COVA 1F4PA 1ULUA 2BMAA 3PU6A 3Q11A 1J2JA 4LJ7A 3RUIA 3ZE9A 3RVYA 5A4FS 1XL0A 2HQ1A 4DADA 1SCKA 1DC3A 2J3EA 3U4AA 2B34A 2HPAA 2P27A 2B5UA 1P4RA 2XDWA 4Y9RA 3TIGA 4TMVA 4H7JA 4IGAA 4CMIB 2OENG 3VZPA 4MWBA 2PYIA 3IERA 3RRBA 2JK1A 3DDWA 3IAUA 4MVJM 3DHVA 4R0MA 3PC3A 5CDUA 3OQBA 1CUYA 3A3NA 3W4KA 2RARA 4D79A 1VHDA 3ZZNA 1JWBB 3GUYA 4P4GA 4PYLA 5HIAA 3BMOA 3H9EO 4YCAA 3B4SA 5BSWA 3QEAZ 4A10A 1ABEA 1V39A 4P4SA 3I5AA 2IYLD 3U26A 1BX3A 3H6KA 4UULA 2JFOA 4RZIA 2VCYA 3BTSA 1K8RA 4X9XA 4B33A 1AKWA 1B6TA 1KJ9A 2PZMA 4CM8B 3I42A 2NXCA 1R3KC 3DDZX 1E6KA 1VMIA 3JXEA 2G38A 2J6BA 3SM3A 5HKKD 3H1EA 4A92A 2UUCO 2P65A 3OPVA 4UREA 3ZTTA 1MGPA 1KJYA 3VU1A 2E7ZA 3KJGA 3T12A 2FTKE 3K5LA 4C30A 4O33A 2RG1A 4BIZA 4J7ZA 1E1YA 1LPAB 3PJEA 5E3JA 5GOTA 1DBRA 1D6MA 3W6UA 1T2VA 1XHLA 4BB0A 5M29A 1CQJA 4BN4A 4QOEA 5B6JA 4NYJQ 4PA9A 1QLHA 2VSNA 4EYEA 1LBQA 1JU3A 4IDBA 4JQZA 4NR0A 1MG5A 2QRJA 1NT4A 3N3AC 3VPBA 2O2EA 5T4BA 3H2SA 3U9SA 3ZIAG 3D7NA 3N74A 4TV9B 4QNNA 4V0MA 2QLFA 5CB4A 3NORA 4RF2A 4LEIA 4ER5A 1K8ZB 1U1GA 4I9HA 4OFWA 1T15A 4U2BA 1U0TA 5CJJA 5CXXA 3TCXB 5LUAA 4L87A 4YT5A 4PLYA 3RT9A 4AP6A 1DEHA 4IILA 5L3VA 1UJNA 1PDOA 4XCXA 2VS0A 3WZ2A 3JAKA 1C0LA 5ICSA 5CYOA 4COOA 2ZXUA 2IF2A 4ARVA 1BSMA 1MP0A 1ZK4A 1W2GA 1Z6TA 3CVVA 3NBMA 1XDBA 3PPXA 3QFCA 4D5EA 1DIHA 2C4VA 4O2BA 1PX2A 2F66C 1QBZA 3TNLA 3RYIB 3ZHCA 4RE6A 2FWNA 1N4AA 2JA2A 2PX3A 3UGKA 2F3RA 2H4YA 3CSXA 1JSRA 1N2ZA 3A1WA 2D1TA 4KGVA 2WMDA 4WDQA 5CUQA 1UDAA 3D36C 1CZOA 2HHLA 5MGNA 1UM9A 4QZVA 3CX7A 3DUWA 1U5CA 4P83A 3NC1C 2A58A 2SNIE 3R20A 3P1JA 2IYEA 3MEQA 4Q1BA 3WWCA 1M2GA 4CKCA 5HZKA 4S3MA 1XDUA 1XI1A 1GG8A 2I3GA 2EFEB 4J76A 4QU0A 3F8SA 4X61A 4OK5A 3VR3A 4L4UA 4B0PA 1YOVB 2ICAA 4II3A 2P06A 1GZ6A 3L7BA 4JL5A 4PFKA 2VDKB 4Q16A 5AI4A 1OFHA 3LQRA 2AT1A 2ZPTX 2GCIA 3KOWA 1HE3A 1N92A 3O82A 5DSTA 3SICE 2AJDA 5E6RB 3WTCA 1II9A 1QO9A 1U2TA 5DN6G 2AKAB 3VPGA 2DXIA 2P6UA 4A8HA 1SVOA 2O6LA 3LQ1A 1GVHA 4HEHA 2YQ5A 5JYEA 2QXYA 3QZUA 5KHJA 1Z25A 2QMQA 1VPLA 1OCCC 3CRMA 1NOJA 1W0KA 2OBFA 3EBLA 4MI3A 4HWOA 4KTTE 1KDVA 1ZH8A 1JH8A 1HE1C 1XXHA 3Q85A 4KDCA 5A3RA 5E7JA 2XJ4A 3LV8A 4IOLA 1RJFA 4RCVA 2Y0CA 3VSAA 4DJFC 1C0PA 4R8RA 1P5JA 4MV5A 3DBIA 4HEA1 1Z2OX 2C8JA 1XMOB 2PR2A 1M2NA 3QUCA 1F4NA 2YMLA 3OWOA 4H2DA 4Q6BA 5F9HA 4UOZA 4LFAB 4C3OB 1S01A 1KYXA 3QHPA 3N8DA 3NGLA 4PTYA 2A14A 2MMCA 3LMKA 3DOEA 4MROA 1FE8A 4J9YB 3KELA 2WWFA 3KKMA 4CQMB 1CS4C 4HDNA 5CFNA 2Z3YA 2INGX 4AKTA 5B4UA 1WOMA 1V7PC 1Z4OA 3U3JA 1W0JG 4CIAA 4GU5A 1TA4A 4HPXB 3TM4A 4F97A 3PDCA 3DSRA 4FNAA 3SVLA 2CLSA 2RCNA 1C41A 1LK0A 2QTOA 3K0HA 2X6AA 4KFSA 4O3MA 2HW8A 4Q93A 1RAAA 4YRSA 4B4KA 3NFRA 2GQ0A 3TJTA 1Q1ZA 2CMHA 2Q1YA 3IUEA 1CP2A 1CRWG 2L69A 4Q19A 4RPCA 1P0CA 1DKRA 1JSLA 5EMLA 1F6BA 5IBCA 3QVTA 3T7DA 2C2OA 3B5JA 4UBMA 1DBIA 3JRXA 3TVTA 4GRDA 1XYGA 1HW7A 1SU7A 3AETA 3VJRA 2ZU0C 4QLOA 4RM2A 3DFZA 3T4XA 1W93A 1J97A 4H31A 5K4HA 4P35A 1HPLA 2O8CA 5FUMA 4F45A 2J45A 2IC5A 4IZOA 1GPKA 2YDXA 3HUDA 2I03A 5L3QA 1FUUA 2JH3A 4U2EA 1G7SA 4R83A 4Q6GA 2ZSBA 4C7OB 1FEZA 4LPKA 2F8SA 1RLUA 2IIBA 3W2EA 4LX8A 1RKQA 2K7ZA 1T8WA 3QV2A 4CKBA 4PANA 3JATA 2V5UA 2QRUA 1SUFA 2FJUA 3N2GA 5BWLA 2KE5A 4B3SO 1Z7GA 1X7YA 1GUBA 3BIOA 5LZ9A 3PE6A 1JR4A 4TZTA 2NU6A 1JDSA 3TQHA 2V1UA 4WECA 2A0LA 1N0JA 4P8RA 1ZL2A 2DR2A 3HADA 3LXMA 5CH3A 3PDHA 1DJLA 2C2KA 3IQFA 3WHPA 5CK5A 4MP8A 3ZDZB 4HP8A 1H3EA 4QFCA 4CG2A 2VTBA 4QXOA 2VUSA 2OOKA 3HLKA 2IHYA 1L5VA 2XCOA 3QBVA 3OO0A 5EESA 1FU8A 3MVEA 4TRRA 4RESA 1AKUA 1P9OA 2CKDA 4XYBA 4Y6GB 3TRKA 2YUTA 1NN0A 4NAVA 4B4WA 3HN2A 2VPWA 2FMTA 1A95A 2JGDB 4K6FA 1E9FA 1HTWA 2WZQA 3LUFA 4RE5A 3RJTA 1L7VC 4FBLA 3TVDA 4C9BA 3DFIA 3F73A 1HZZA 2YBDA 3BS4A 2VT6A 4EEZA 5C34B 2GEKA 3CLSC 4P54A 1QWOA 3LI2A 1ZJ6A 2Q0QA 5KYYA 3K9AA 5CB4F 4JNCA 2EGGA 4YT8A 4KPEC 2F55A 2XLBA 4K6MA 3CFYA 2FZCA 5LJIA 3S2FA 1U8ZA 4GSYA 1YCGA 3G9TA 1WDLA 2YVAA 4EZEA 5LMNO 3A9UA 4JH0A 2AVDA 4UNRA 3EZLA 1I3NA 3Q40A 3R6GA 1JKMA 3SKVA 5KS2A 5C31A 1XCBA 2NZ8A 3GJ4A 1T2UA 4BB5A 1J8DA 4N54A 4CIYA 2FPKA 2IYZA 4CKCB 3CRVA 2C7QA 2WFLB 1JJ2U 1T1RA 1X13A 1ZVJA 2DFKB 3B8HA 3K5WA 3NOQA 1Q3KA 1EVYA 2Z1MA 1IXMA 2LUOA 4M9CA 4V0KA 5EUBA 3E8FA 1OZ0A 3HCRA 4HAIA 4DHWA 1I3KA 3QFHA 2L19A 4YAUA 2C3PA 2NU7A 5BQFA 3P26A 1F7YA 4ZXFA 1JLKA 1OAAA 1Z5NA 1KUQA 2AOWA 2ODWA 2WV7A 3C70A 4Q3OA 2ANBA 3PUXA 4YRTA 3ZJ4A 1SVUA 3CM0A 5LB2A 2F3PA 4MCJA 5HK8A 1CUUA 4ZGGA 3IP9A 1Q20A 4LYDA 4HNSA 1DKQA 3UJ9A 1HYBA 1NFRA 1GPMA 2MOKA 2NZYA 3NR7A 2XNDG 3ZEDA 2TMYA 3L05A 5FL7G 2AC7A 5FWXA 4DNFA 2MR5A 1ZGCA 4L74A 3FSJX 3KTDA 3VJKA 1K3TA 4BRSA 3K70C 4Y2UA 1MABB 2EWVA 3KT3A 3FKSG 3U7QB 4XM1A 2ZQYA 2JGUA 2VYFA 3FMIA 3GDOA 3ILXA 3KYBA 4KQXA 2JATA 3WXMA 1XPUA 3JAMN 2AOVA 3IPRA 4MUBA 5AJVB 4B6OA 2FR8C 4WFKA 2O8EB 1OXUA 4Y6LA 2CK3G 3TTXA 5LP6C 5KTTA 4KR2A 5TQVA 1V5EA 3FOWA 2CJWB 1PNTA 1RXUA 4NH0A 1TLFA 4LKRA 2ASVA 2R86A 4PZPA 3A0BZ 2BJHA 1E8NA 3AG2C 1PR4A 1SOUA 3BAFA 1ZC3A 4LNAA 1N6OA 1SVIA 5JD3A 3VAAA 4HH4A 5EWMB 4LK3A 3RT7A 1PDVA 4NU0A 2QVBA 1C9NA 2ZT9B 4CQMA 1FRVA 3NIBA 1NATA 4DG9A 2BFOA 4EQ6B 2A1TR 1G21E 2F3QA 4GE0A 1D1TA 4XOUA 5AP9A 1V9CA 5AR1A 4KQIA 1QJCA 3OJCA 3WRWA 4L8YA 1SO8A 1SRYA 1W30A 2R00A 2OP0A 3FNEA 3KVOA 3C39A 3MN1A 3W5SA 2UVPB 1WNTA 4J0QA 2Q7HA 5IJZA 5HFJA 4EF6A 2Q49A 1T0IA 1YDEA 4FN5A 4FYPA 5I9BA 5LMZA 2X7JA 4WPGA 3G5TA 4EB6B 1JA8A 1P2VA 4QBTA 3WMXA 5EIAA 5C81A 3D4IA 1X4TA 3WADA 2HJRA 1UK8A 1LPSA 1MH9A 3BVPA 2A9JA 1QMGA 2J1LA 4N8EA 4FD3A 5IT5A 1I9GA 4KMRA 4NJOA 2O8DB 3BRQA 1Z5WA 4FFWA 5JD5A 2BISA 3C7DB 5EC8A 1W44A 3IBYA 1RXWA 3SFVA 4CC5A 3AG7A 2QRQA 2V0NA 5BSMA 3DVSX 3EIHA 1N2EA 3EFBA 3RE1A 5DMXA 4ZIRB 4ZYXA 3UPTA 3S5UA 2ODMA 4LFAO 1YZBA 2H8PC 4HL6A 1N57A 1NP6A 5DHTA 1WP4A 3G6EV 4DTIA 1ENYA 4GECA 2OAEA 2WICA 4Q02A 3CKMA 1GN9A 4FLYA 4QU8A 4XUGB 2VT2A 3W06A 4FZ0A 4NJMB 1TTPB 1OXMA 5FBQB 2WU8A 2UUBO 4OREX 5FTMA 5U1PA 4ZEMA 1FXKB 4JXXA 4RTQA 1NXXA 2OQRA 2AEFA 4MO2A 4D81A 1MB3A 3FTDA 2EG5A 4FZVA 1MNQA 3PD0A 2IPOA 3F71A 1CHNA 4ZN6A 1FFEA 2UZIR 4C29A 2B78A 2R60A 5B6PA 2GR9A 3CZMA 5EBMC 1JIJA 5H80A 4ENVA 3K0SA 3KLMX 2RHOA 3T4UA 3COPA 4Z7OB 1E7WA 1S6YA 2XNCA 2YRFA 3KZNA 3LQFA 4M1TA 4JI8O 1GMGA 1GLGA 4D99A 3CC2V 1ZGBA 4EA7A 1C7IA 1RYHA 3SE7A 3FLMA 3W77A 4LNUB 1IXRC 2J3QA 4JA2A 1BFDA 1SQ0A 3DE6X 2P8JA 4X24A 3BRWA 3SQMA 3UMCA 3G1UA 5B3AA 2Q41A 1Y6ZA 1W73A 5C7YA 2R8YA 3HDJA 1FFXA 5DLQC 1J21A 3LSUA 1NUAA 3DL7A 1PD3A 2GAFA 2Z83A 2QT9A 4IIXA 3WHKA 3F5FA 4YYZA 1DLIA 3WIDA 2IBSA 1DG1G 3QMPA 4X65O 1UFQA 1YBMA 3WGYA 1BXGA 2AC4A 3S29A 4BQEA 5J1TB 5C8DA 5LZ2A 2GV9A 1V7CA 4DWWA 5EJ2A 2DPMA 4YJ2F 1S2OA 2VS1A 3HWWA 3HMKA 3G88A 2Q5LA 1XRLA 1E60A 4FOTA 4UC0A 5CIWA 4MCIA 1HDYA 5AOBA 2E1RA 1GU1A 3QVGA 2YFYA 4MV8A 2XEDA 4HB2A 1TEZA 2HM7A 2YZNA 1XTQA 3NH6A 1I6MA 3C5EA 3QU7A 4RPGA 1UKBA 4FLUA 3GBPA 5KUMA 3L75H 2V3WA 2I2WA 3CCMV 5LNK6 3JYPA 4HWPA 4P4SB 3UAZA 4YRCA 3IT1A 3OAAG 3DLTA 4HTFB 4XCQA 2PGGA 1UJ4A 2AE2A 2UZ0A 4NABA 5HQ3A 1VIDA 1XRJA 2R6ZA 2QVZX 1QQTA 1VI5A 5DX8A 4IL6Z 2DHRA 3STVA 1O3YA 2D5IA 4QOGA 3R9XA 4EG5A 3E7DA 1FMCA 2HA4A 3TRFA 4GO1A 1FPMA 3L0CA 3CMEV 1DQNA 1XYVA 4JC4A 2HT6A 3TWOA 2EG9A 2HA7A 1L1QA 2NMVA 3O8QB 4KMOA 2WSYB 4D7AA 1NYTA 3UT0A 3R65A 4LVOA 3RUCA 4DSZA 1NBME 5CEFA 4ZFNA 4LFBB 1R4MA 5ELMA 3E2MA 4P0QB 3QPBA 3UBTA 2O8BB 5AT1A 1OX5A 2I1QA 1B6QA 3AR3A 4IKOA 1CD5A 4JLPA 1U3CA 4MARA 4RZ2A 4WZAE 2WWTA 2X40A 3K7EA 3N5CA 3ZHXA 1ZK3A 4HDSB 1MZVA 1PR1A 2BLLA 2JIQA 4ND1A 4O0LA 1ZU4A 1IOZA 2HTEA 2Z3WA 1Y74A 1ZXLA 2GN9A 2Q4PA 2C98A 2YWJA 3BXZA 4G0PA 4A2QA 2RE8A 4P9NA 5E6UA 1E1RD 3WDLA 3T1TA 1X1SA 1VE9A 1N33O 3E7WA 1TM3E 4OJTA 4GYYA 1A7KA 2C59A 5AD1A 1XDGA 4NTZA 1KNQA 4KLAA 2C94A 4NYKA 4ESVA 1VE5A 3GD5A 3G8DA 2Q1WA 3TLCA 4OHYA 2ZSIA 1L8AA 1T9AA 5AKEA 2RC6A 1QCYA 1QIIA 3ESDA 4JMLA 1CRQA 4J0KA 2Q69A 1CEYA 2W7TA 3T7CA 4CM3A 4B09A 4GLXA 2R25B 3ICVA 5JFGA 4EEKA 4PNZA 1SKVA 2ZBDA 3DF7A 4EHJA 1JAZA 3LCJA 4E6PA 4UUMA 2WU4A 5EKTA 4YN3A 3HCAA 3TSAA 1OB5A 4WUTA 1T1JA 3UBMA 4QYXA 1GR1A 2AUMA 1PLKA 2CXSA 2QX4A 4R1PA 1JV2B 1VQLV 1E0JA 1O5OA 2CXQA 3C6KA 3JTMA 2OIEA 3KWFA 1XL6A 2C7BA 1N1EA 2O4CA 2JIDA 2R5FA 4ZT7A 5G53C 4BWGA 4X20A 4EEXA 3IVMA 4LMRA 1P7BA 5EXEA 3CMCO 1K89A 1QC5A 3C8HA 3DDUA 5JH7B 4ZGBA 5B53A 3LUTB 1P2GA 2QJRA 2W8ZA 3BH7A 3D59A 1P75A 2HRBA 2VZ8A 3TG8A 2IYQA 1PT9A 4WBSA 1M8KA 1P1IA 3CRW1 2A33A 4MMZB 2ID8A 3PQCA 4RSRA 4CF5A 3G85A 3LFUA 3VZSA 1SU8A 1Y3CE 3EH1A 3QRWA 1T1GA 1S0UA 4HLUC 2QF7A 4MQFB 5A3VA 4ARAA 4D3XA 3EZYA 3R0ZA 2OYCA 2AZ0A 4PG7A 1A71A 2ZTVA 3G2KA 4ZKDA 2G9NA 4H4EA 2OXFA 2QI9C 2ZWAA 1RJWA 2QORA 5HKLA 4ZHQF 5JROA 1ORVA 1WOYA 3SPHA 1JIVA 3VXKA 1VQOV 2WG1A 3ZNOA 2EZOA 3VPCA 3ENKA 2YC0A 2Y05A 3M6UA 3T1HB 3GLFB 4QVGA 4Q1CA 4BFVA 3LX6A 2Z2ZA 4OMUA 2EJRA 1MLDA 5TQ2A 2VP4A 4EZIA 3U7IA 5JVDF 3R3VA 4GI5A 4BP3A 4G8JA 1EX1A 3RTBA 3UWKA 1XZQA 3T3OA 4V02A 1Z5OA 4RVCA 3CPHA 3U9LA 4I5FA 3ETLA 4A9AA 3GJXC 4TQGA 5IKEA 2JKZA 4P98A 1JBKA 5KYUA 5TJ9A 4Q3KA 1E1QG 4B7UA 3MQ2A 1AQNA 2J5QA 1NBMG 2WAOA 3IH5A 2XITA 4YC7A 5DNEA 3UY4A 5KVAA 1F0PA 2IUUA 2X0EA 1ZGHA 4IGIA 4EFBA 2YDEA 2EKBA 2F3TA 2Y1GA 3MOGA 4UEOA 4DT1A 5JS8A 3LA8A 5GADl 4I36A 4OGLA 5K3DA 2YXPX 3HG7A 3O8LA 1TUEB 1R5NA 2EIJB 3OMIB 1FOEB 2QR4A 1FB5A 2HSZA 4HZUB 4JUFA 4OH1A 5AKYA 5CW1A 1AXEA 4EHKA 4KX5A 2N05A 5EE0A 1MEJA 1FJGB 5HFNA 1M2KA 4EL0A 3LIPA 4NG4A 2YQ4A 4J80A 1QLJA 4YP7A 1P60A 1XZBA 2ISCA 2WJ3A 1S5PA 4NPHA 4W7HA 4DR6B 5T67A 2DYSC 4L0MA 4WFAV 2GXQA 1BHJA 3O1JC 2D13A 2ITDC 4ECAA 4HLQB 1RCFA 5IAAA 3U60B 1F4LA 2EIXA 3RO7A 3N3BC 1DMRA 2DX7A 5IYBO 1KMIZ 4WERA 1EM6A 4WN3A 5DXFA 2XCQA 2MJLA 5CBHA 4N40A 1XVAA 4Z3OA 3Q6MA 4CU5A 2QVYX 2X15A 4EMSA 3ZKWB 3K9HA 1UL1X 4U2GA 3LDDA 4O8CA 5A05A 3E58A 4YR7A 3BAAA 4CLRB 5BWCA 3BIJA 1N4CA 5KOIA 3AF6A 4FEEA 2P9JA 4DV3B 1JKFA 4M9ZA 4KYTA 4F1JA 3H1HH 1MO4A 4E13A 1UBOS 5IKXA 4CEHB 2F2TA 1R37A 1Q1AA 2ECOA 1PJ2A 3UHAA 4AJ2A 4CG3A 5BN1A 1KI1A 1R9NA 3G6WA 4KDEA 3U6KA 5DNDA 3I64A 1YVUA 4KRGA 3S3XA 3LUJA 5B1NA 4PZYA 3T4PA 1S5LZ 2TSYB 3BQNB 3FWHA 3BL6A 4R2LA 5H16A 5C37A 1RAFA 3HXLA 2QAGA 1W1WA