1X8JA

Crystal structure of retinol dehydratase in complex with androsterone and inactive cofactor pap
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
343
structure length
343
Chain Sequence
LPFPYEFRELNPEEDKLVKANLGAFPTTYVKLGPKGYMVYRPYLKDAANIYNMPLRPTDVFVASYQRSGTTMTQELVWLIENDLNFEAAKTYMSLRYIYLDGFMIYDPEKQEEYNDILPNPENLDMERYLGLLEYSSRPGSSLLAAVPPTEKRFVKTHLPLSLMPPNMLDTVKMVYLARDPRDVAVSSFHHARLLYLLNKQSNFKDFWEMFHRGLYTLTPYFEHVKEAWAKRHDPNMLFLFYEDYLKDLPGSIARIADFLGKKLSEEQIQRLSEHLNFEKFKNNGAVNMEDYREIGILADGEHFIRKGKAGCWRDYFDEEMTKQAEKWIKDNLKDTDLRYPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords retinol dehydratase
publication title The structures of the unique sulfotransferase retinol dehydratase with product and inhibitors provide insight into enzyme mechanism and inhibition.
pubmed doi rcsb
source organism Spodoptera frugiperda
molecule tags Transferase
total genus 124
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1x8jA00
2J0UA 2FSIA 3MRSA 1QVAA 2IUSA 2ZYTX 4JBXA 4N0EA 5FBLB 1J7KA 3PG5A 3T34A 4X8LA 2WTUA 4IRUB 4KSBA 3C16C 1GRNA 4XWAA 2F9MA 2FPMA 1TAGA 3AUXA 2WWWA 3EXAA 2X2FA 3IKJA 2ZSFA 2QAGC 3THOA 2ZU6A 1JR3D 1E79D 5TB5A 3VHLB 3PENA 2ZETA 3V4RA 3U3OA 2AFHE 5JI2E 4OJQA 1V5WA 1N5LA 1KI3A 4M1SA 1DELA 1Z63A 4Q9LA 4GP7A 2GJ9A 2GJ8A 3O8BA 3ZQJA 4KAXA 2FV8A 2REXB 3CB4A 1GOTA 3Q72A 5TVKA 4XH9B 2DB3A 1XBTA 2DR3A 6Q21A 1TQ4A 1Z83A 1BMFD 2LKCA 2G0NA 1NP6A 2WIBA 2A5GA 4EQ6A 2Q3FA 1GNPA 4PTLA 1ONBA 2W6IA 1OH5A 1MRNA 4G5GA 3C14C 1XD9A 5SZKB 1J99A 2ANCA 1KKLA 5JECA 1XPRA 2ZRLA 1LW7A 4FINA 3BH0A 2V4ZA 4ESHA 2GEUA 2J46A 1IHUA 4HDCA 3TW4A 5AUOB 4HUQB 3ZS9A 3A6PC 1U9IC 1Z5ZA 2JJ2A 2AN9A 3EIEA 3SBDA 4JKYA 4A8JB 1G5RA 1KK3A 2IS2A 2A78A 2GETA 1E9CA 1ZM9A 1ZINA 1YZKA 3U3KA 3GLFE 3OF5A 521PA 1JAHA 3B9PA 3HU2A 1AS3A 3HU1A 1FX0B 3CF2A 4AYWA 4DSOA 2JEOA 3C5HA 4YXWA 5C18A 4DIEA 4MQBA 3QVVA 2PT7A 5FOWA 1Z0JA 3AP3A 2BJVA 3U6BA 2CVHA 1F48A 2ZS8A 2YZ2A 2KE5A 1AA9A 5DYIA 4Q01A 3BORA 2ZVPX 1IBRA 4GZLA 4Q7JB 1N0VC 4XOIA 4RCYA 5TY0A 2GBLC 4W5JA 3RSLA 4GBMA 1UFQA 2ZAOA 4IEIA 1EFTA 2GF9A 2IYLD 3NEJA 3PV0A 4KJZA 3R7WB 5KNCA 1KDTA 1TF2A 4DT1A 4G0NA 4KI0A 2B6HA 4Y0VA 1UADA 4CIDA 1R2QA 4OK5A 1HV8A 5EE1A 3CONA 5CDFE 2XITA 4FD2A 1D9XA 1KAGA 2A30A 5CM8B 2DFKB 2PL3A 4JJZA 3OEHD 1GKYA 3I8SA 4DIDA 1SXJC 1J8YF 1WDTA 2ZM5A 3ZVMA 2XNDA 4Q1BA 1UKEA 4YMWA 5EZ5A 5FR1A 4LHWA 5FOSA 4E09A 5J4VA 2QMEA 2QRNA 4XVQA 3MWLA 1CRPA 3D3QA 5FR2A 4M21A 3QEOA 4OK6A 2W6ID 3A1TA 3EPKA 4BFVA 1R6BX 4EIWA 1T8UA 4D80A 4PZYA 4D2IA 2QMHA 2BC9A 4Q4JA 4AURA 3QUSA 5KUTA 3VR3A 3LV8A 2JASA 2OBNA 3K9HA 4TL9A 1G16A 1SVWA 4Q1EA 3WMEA 5FPHA 4TYPA 3P27A 4PHFA 3MJHA 3U7HB 3IQXA 4RSGA 1II8A 2O8FB 1T5LA 4CEHB 2F9LA 4D4MA 2ZEJA 4PXAA 1SVKA 1LF5A 3PUWA 3VNUA 2HT6A 4P4SA 1BIFA 4TMXA 2O8BA 1KMHA 1ZUHA 1YRAA 2WOOA 1J2JA 4YQFA 1G3RA 2FU5C 4JYBA 1FP6A 1CLUA 2WKRA 2WJVA 3GLGB 1E2PA 4TTRA 4B2LA 4CRWB 2BV3A 4LHZA 1N5JA 1W36C 2BEJA 4TYQA 3C8UA 4N1AA 3IBGA 2ZI7A 3AKEA 1P2UA 3DM5A 5FTMA 1E9FA 4Q48A 1P3JA 1NKTA 3EZ9A 3GLHE 2IC5A 2CDNA 3NBFA 2XTZA 4DLVA 3N5CA 4B2IA 1IY0A 3DOFA 3GFOA 4QGHA 3TSWA 4DHEA 4D4LA 5B58C 1W7AA 2KB0A 2IHYA 4B71A 1NVWQ 1IY2A 5H70A 1OW3B 4BFTA 4EFMA 5IF9A 1Z0IA 1U0LA 2A3RA 4G3XA 4DLRA 4JLAA 4JZKA 1U81A 3T1VA 3Q7QA 3SS8A 2YYZA 1TL7C 2E9SA 4LV8B 4IOMA 2FF7A 3M0EA 2AXPA 3X1YA 2MMCA 1GL9B 1B0UA 2CHGA 1N6PA 4WZAE 2XGJA 4B35A 3CZQA 4RZ3A 2Q9CA 3FDIA 3JZMA 3MG9A 4Q9HA 4FWIB 3T5DA 5KDDA 2QTFA 4A1FA 3EARA 2ZPTX 3Q8XB 2YHSA 2QE7D 2ZREA 4C4PA 1ZIOA 2CXXA 2YC2C 3QVUA 5E3HA 5CITA 3ZIAA 4EPRA 4BECA 4PO1A 5TMPA 2IHBA 1ZM7A 3SHWA 4M0LA 3ICQB 4BLTA 1UDXA 1NF3A 2R44A 4TLCA 2V6IA 1T3LA 3FKSA 1WCV1 2WWHA 4MGKR 2D2EA 2GK7A 3LNCA 4US0R 4DSTA 4TWZA 2MSDB 3X1ZA 3P20A 2PBRA 2IYZA 3ZLJA 1IN4A 1NN1A 3CF0A 1JBKA 1E0JA 1Z6XA 4Q21A 4IW3B 1WE2A 1JR3A 3RC8A 1EWRA 4PR0A 2NG1A 5LDDC 2RAPA 2JLQA 2OAQ1 2KBFA 2YC4C 1DG3A 3GLFA 1Z6TA 3F8TA 1OFTA 1U0HC 4JT2A 4RD2A 5H8WA 3NBZC 4DDUA 3LLUA 3ZJYA 2O8EB 3SNHA 3HYTA 3A37A 2EU8A 5GJWC 1YZTA 1XMSA 4ABYA 2C04A 3RYTC 3LBNA 3I5YA 1A2BA 3EASA 4XTCS 1XTRA 4Q66C 1KY3A 2B8WA 3RAPR 1DVRA 2QL6A 5CIQA 4GP6A 3U7GA 3RRZA 1XEWX 2C2HA 4RD6A 4BASA 3ETLA 1I4TD 3NKVA 2FJUA 3KJGA 1GWNA 5LB2A 3B82A 3OE7D 3VKWA 1E2DA 4HAXA 1VHTA 3QPVA 2ZQ5A 3CR8A 4C0KA 2RGNA 1KJZA 3ND8A 1RJ9A 3EPJA 4GI7A 3T5GA 1P2TA 2QP4A 4A2PA 2C99A 2QI9C 4AYTA 2D4HA 2Q3MA 2REBA 1W4RA 4PQYA 4US1R 1D8TA 1Z08A 2GJSA 2MSEB 2N42A 2OHFA 1M2OB 1XMVA 2XJ4A 2ZUDA 3AF2A 2CBZA 1SXJD 1EG7A 1GDDA 2GJAA 4TMWA 4CEJB 3AV0B 4PHHA 3U60B 3AM1A 1CP2A 2J7PD 1XTJA 2QP9X 3QBTA 4UXIA 4ASUD 4B3DA 2IYYA 4V0NA 4YLGA 2ZSBA 5CK4A 721PA 3OEED 4PC3A 1M6NA 3HPQA 4QFMA 5AWFC 2EFGA 4F4CA 1U98A 3LAWA 4IXMA 221PA 2KBEA 1TEVA 2EVWX 1MABA 2QEQA 2XTMA 3E5HA 1E94E 1Q57A 2D06A 3D7MA 2CCKA 2P6NA 2OCYC 4QHYA 4D81A 4KITB 1P75A 2GXQA 2ZJYA 3PR1A 1G9XA 3IIMA 2ZJBA 3D8BA 4LCBA 1FUUA 4JVNA 5A0FA 4Q02A 2ZRDA 3JZAA 4LBWA 5UKDA 1ZNWA 2ZR7A 3LY5A 5L3QB 1N6IA 2VHJA 3VR2A 1UF9A 1W5SA 3WYFA 4RKFA 3TMKA 4D0GA 4B47A 4EPVA 4Z1MD 4RD3A 5FI0B 3QPWA 2GKSA 2FEMA 3TJZA 4LZZA 2WAYA 5JEDA 1YR8A 1Z22A 1G20E 2IT1A 3U7EB 1XZPA 4F4IA 3U44B 3CIOA 3NBYC 1Q21A 2R2AA 2P3SA 4A0GA 4EFLA 2ZE5A 1P2SA 1LB1B 2JLUA 1JJVA 4RZUA 3IIKA 1DAMA 3BFKA 1XJCA 1BS1A 1PLKA 3ZDQA 2ZYWX 3PUVA 1XX6A 3W9YA 2GILA 3LQQA 3BERA 4I1UA 1BH2A 4Q5IA 5HZHA 1H8ED 3HP1A 3DHWC 1QRAA 4CEJA 1HYQA 3TQFA 5EE5B 4FMBB 1R10A 4M9SA 4B34A 2I3BA 4DDVA 3BXZA 2FH5B 2RKOA 3BFVA 5E95A 3C15C 1P4SA 2B8TA 4ACBA 3RNLA 4NYJR 2CLCX 1AQYA 2ZR0A 3T1QA 1OIVA 3MWKA 2R9VA 1X3SA 4DC9A 4JLVA 3O8CA 3ONWA 2Z0MA 3SYLA 1AS0A 4Z51A 1NG1A 3IO5A 5HR5A 5GVSA 2Q3HA 4M1OA 2QNRA 3SJBA 2A5DA 1OH8A 3UWOA 3R9IA 5L8VA 4E03A 3A1SA 1XJQA 4M22A 3H84A 3VR5A 4A0HA 1KO4A 1EK0A 5JWRA 4NKRA 2AK3A 1EX6A 1GM5A 2W2VA 3W8RA 4GRAA 4M1MA 1Q1ZA 2WJHA 1CTQA 3QXSA 4A0RA 2GJKA 1TQ6A 2PMKA 4Z8YA 4L9SA 5C1BA 1CKEA 2ZJ2A 5AUPB 2FNAA 2ZITA 2HUPA 4OK3A 3ADKA 3IO3A 4G5OA 4KFUA 3WP1B 2O8FA 1G3MA 1KJYA 2WMNB 2GHIA 1JECA 3K70B 3ASYA 4Q1CA 1JI0A 2QGNA 3OFND 4N3NA 1ZCBA 2JGNA 2WSSD 2IA5A 4NONA 2P5TB 4HZUA 1N6LA 2RCNA 1P62B 1AGPA 1U90A 4RZ2A 3WNBA 2ZVQX 4MDFA 5F98A 1BO6A 2CK3A 3TUIC 4B44A 1FFHA 3L8YA 3BOSA 5TXGA 2OM2A 3FMOB 2WMOB 2FFAA 2FPLA 4O0MA 4OHWA 1CS4C 3L82B 2WWXA 1OIWA 3U3JA 4UNNA 2Q6TA 2ZE8A 1E3MA 2WKPA 2JLZA 3EIHA 3TIFA 4ZI3A 1G7RA 3B1WA 4MYTA 2DBYA 3QF4B 3DMNA 5BQ5A 4A8JC 2JATA 3QKUA 2C8VA 3JVVA 3NIBA 2HXYA 2QPTA 3MWYW 3PEWA 3KQNA 1HTWA 1RRCA 2W00A 3KFVA 3AQ4A 2AR7A 5G53C 3OIUA 4NYMQ 4HB3A 4UKDA 2A5FA 1ZW6A 2VSOA 3EG5A 2PEZA 1G19A 1KY2A 1GNQA 4URZR 1US8B 3FYHA 1XEXB 2D2FA 4LJAA 5FPTA 1WA5A 2CL0X 1Q1BA 2X1VA 2IYTA 2EWVA 4KFRA 2OLKA 3RWMB 3KXIA 4E07A 2JIZA 5CJPA 5EE3A 2ZRHA 3X1DA 4GOXA 4B2PA 1ESMA 1TUEA 5AJYA 2GZDA 4LK2A 2E1RA 5DN6A 1J8MF 1MO5A 4LDJA 4B3XA 1KNXA 1CR4A 2JAQA 821PA 2F6RA 2BWJA 2ZI9A 4B3FX 1GAJA 1T0JB 3KJHA 4Q4HA 4M4SA 1E9EA 5DHFA 4BFZA 4EAQA 4HUQA 1KIMA 2OILA 5J4LA 1EWQA 2J1LA 3IHWA 4Q4LA 2J0SA 1K6MA 4MGIR 3BBPA 4POAA 5FPSA 4C0BA 3QKRA 1WXQA 3DO6A 1GP2A 4QBGB 3T15A 2QY9A 2IYRA 2AL7A 3KDSE 3GEHA 4BRWA 3KQLA 1HUQA 1ESNA 3QOFA 1NRJB 1UKZA 3VR1A 3AVVA 2QP3A 1P9RA 1RKBA 2O0HA 2IUUA 4B75A 4RVCA 1QG2A 3IPYA 3OAAD 4Q4JB 4FXPA 4WXRA 1AZSC 5AJVB 2CHQA 4Q7MB 3PVSA 5DYGA 5KNDA 5KYKA 4Q47A 3I62A 4OI2A 4PQFA 3FHCB 1S2MA 3ADCA 4DLXA 3PJRA 3KL4A 1XU4A 2FN4A 3SBEA 4PX9A 5G40A 1G4AE 3G0HA 2ZI3A 3GQBA 3AH8A 4UJ3A 1ZBDA 3GLHA 5EP4A 2PJRA 3RSOA 2O8DB 1VYUA 2VA8A 4LBVA 2RGAA 5F9FA 4V02A 5CIWA 4LJ7A 3SQWA 2YWGA 3QY0A 3A36A 2C03A 2VP2A 2FZLA 3KX2A 3A4LA 1R8SA 5C4MA 2FFHA 1LVGA 4TLEA 4BQSA 4LYJA 3KFXA 1KDOA 3TNFA 3CUEF 4QOSA 1QHHB 2IS6A 2O8EA 3WXMA 2A5YB 2YNMA 3EIQA 1MV5A 2OFWA 4ZKDA 3HU3A 3K0AA 1S96A 2Q21A 2DWOA 4EUNA 2W6JD 1IJFA 1FNNA 1LY1A 5JFGA 1UKVY 4BFSA 1HQCA 4BFYA 5B57C 3K8YA 1I2MA 3TVTA 2ODBA 4QGFA 2NO1A 4DWJA 5L3RA 3QIAA 2ZRGA 2QTVB 4B6FA 2OE2A 3GEEA 5FFMA 2LCFA 4QJ5A 3QBVA 5B30A 5D3MA 2CMKA 1HA3A 1E2JA 4M9QA 4M1TA 4PHTA 4YDHB 4D26A 4KXFB 4OYHA 1C9KA 1YZQA 2IYQA 2QA5A 1VCMA 2R6DA 3PITA 1X1RA 1N6HA 2PLFA 3TSOA 2VP6A 3TSZA 3VU9B 4DKXA 3FHTA 4NDZA 3GLGE 4K81B 1E2KA 5ELXA 4NCKA 1OE0A 1TNDA 2IXGA 4AIIA 4L5BA 3SFZA 1E4VA 2IEZA 2PH1A 5CYPA 2JLVA 1TF5A 2QMUA 2QAGB 5HKKD 1OYWA 1G3UA 1QHHA 4HAWA 5FL3A 4YMSA 4B43A 4D4KA 1GILA 2OESA 3H1TA 4PQRA 2QTHA 5E7JA 5EP1A 4JMPA 4QGAA 2OLJA 3DKPA 3IGFA 1KI6A 2VSXA 2O8CA 3VKGA 4CYMA 3ZH9B 4LUCA 1PZNA 3ZZ0A 1OV4A 2CE2X 5IRCD 3LW8A 1UBCA 3VHXA 1QDEA 1T4GA 1AN0A 1R4AA 2W58A 2IS1A 5LB4A 4B48A 1S4QA 1GL6A 1GUAA 1S1MA 4GPTA 4AKEA 4ZDKA 4DT1B 3SOPA 1T3HA 3REGA 1RPZA 2O8DA 3DVLA 5JCZA 1HQYE 2J0UB 1Q3HA 1N3BA 1DOAA 3HJNA 3P26A 1UBGA 3TVDA 2C9CA 4IDHA 2KWIA 2P6RA 4TL8A 5HTKA 3OHMA 5J47A 3U61B 2ZU0C 2D3WA 3W6PA 3W5IA 3K0CC 3MCAA 4KHZA 4B32A 3GEIA 4JLBA 5BWMA 4AG5A 1G41A 2DWQA 2JA1A 5JSZA 4TYNA 4FMDB 2PX0A 1EGAA 1JXMA 2IXEA 3EC2A 2UVQA 2BBWA 4M9ZA 1ZNXA 5IT5A 3K9LA 1VYTA 4NE2A 5DISB 3HWSA 3NC1C 1AQUA 3I8XA 2YKGA 3THXB 3ZZTA 2F1RA 3GJ5A 2NO9A 2RMKA 3AB3A 5BN5A 3AF1A 1YQTA 1G6OA 2G77B 2WHXA 1E0SA 4WAUA 3QPUA 3CLVA 3GLGA 3NDBB 4LI0A 4JLPA 1NJGA 4WA7A 4W5HA 3KKOA 4O2RA 4U7DA 2VP5A 5HZKA 5L3QA 3PUYA 3I92A 2E87A 2V6JA 3Q9LA 3UK6A 1XTSA 2HJGA 2G9NA 1DAKA 5EQTA 2J0VA 1II8B 4O25A 4Q9KA 4AK9A 2MSCB 3CRRA 1NI3A 4ZDIA 1CR0A 1QHNA 3TH5A 2CL7X 121PA 2G1JA 3MAAC 1NN5A 2OXRA 3FMPB 4QL3A 3W5JA 1DAGA 1U9IA 3AUYA 3L43A 1XZQA 3RVBA 4X8HA 3B2EA 1S3SA 1G17A 3H2YA 1VG0B 1ZYUA 1XRJA 3T61A 2Z83A 3W3ZB 5GADl 1M7BA 2B92A 1YE8A 2QMOA 4AWXA 1GL7A 3CX6A 4E22A 2P5SA 1MRSA 2VPPA 2O5VA 1FMJA 4URUR 4NP6A 2GWHA 4S2EA 4RD1A 4JLOA 4EJSA 1DAIA 3EW9A 1PUJA 2OCAA 3O8RA 4CT5A 2AD5A 3WYAA 5FUXA 5SZIA 2JLXA 1F3OA 2JJ1D 1E4YA 2EWWA 2GF0A 3LRPA 3SU8A 4D0NA 1YHNA 5F3WB 2FMXA 4FWTA 3KQUA 1DADA 3CRVA 3KB1A 4LYAA 3ZD6A 3THWA 3LXRA 1E2HA 3BC1A 1F2TA 3B1VA 3ZVLA 1X8JA 4BZXA 4QJ3A 2FZ4A 2ZSDA 2GA8A 4P33A 1GRRA 4MDEA 3L8ZA 3RDPA 3T12A 2P67A 3I32A 1SXJA 1P5ZB 2HCBA 1S8FA 3TGPA 4IFEA 2ZE6A 1AJEA 2FSGA 1PLLA 3MGCA 1SVMA 2FOLA 4BLRA 1G21E 2PLRA 5DE3A 2YWEA 1ETUA 4EKDA 2QM7A 4FCWA 2GTPA 4B3BA 3GPLA 1KYIA 2CJWB 3TKLA 4DUGA 2VTKA 4PANA 4JSTA 4PAMA 3SYKA 1JEDA 4JVMA 4Q4AB 5JMTA 2AX4A 2W6JA 1UM8A 2WKQA 4B76A 1IXSB 3KJIA 4LBZA 3AVPA 5EE9A 3AP1A 3VX4A 4A0FA 4Q4AA 1TU3A 4TMKA 4BFUA 2H7VA 4BFXA 4KU4A 1GNRA 3CH4B 1F6BA 4HLUA 5AJZA 4MRVA 3TQCA 5DHAA 2DCUA 4HAVA 1DAEA 1VHLA 4B73A 1CJVC 5FTNA 4JBYA 3K09A 2WWFA 4ITRC 1XB2A 2GCOA 4PPGA 1U8ZA 2J59A 5GVRA 1MKYA 4XWKA 1OH6A 1D2MA 2I1VB 2IF0A 4KYIB 1KJWA 2A9KA 3K9NA 3D6TB 2VO1A 4Q1FA 3EA5A 3V9PA 1L4UA 1W2GA 4TLDA 2BHRA 1Z2CA 1GRQA 4YONB 4ARZA 1L4YA 3FKQA 3WBKA 3X1XA 1MO4A 2HV8A 4QM6A 1Q44A 2HF9A 1AKEA 2ZRMA 4TQAA 1H65A 1O87A 4BUJA 3EPLA 3BFXA 3KKQA 1RRGA 5HKKA 1NVXQ 1NL3A 4LPKA 5LD2B 4JLMA 4RKEA 1KK1A 4WOPA 5C4GB 5B64A 4Q7LA 5BYKA 4OL0A 3UPUA 2GXAA 1KSJA 3V4FA 1A1VA 1E2NA 3BB4A 4GMDA 1Q1EA 3PQCA 4WXPA 1R0XA 3WBJA 3I1FA 2GZHA 1G5TA 1IOZA 2D74A 3RS5A 5JRZA 2OFXA 4FN5A 1U8YA 1UPTA 1YR9A 2BMDA 2ORVA 1SGWA 2I1QA 4ZI2A 3RRNA 3CX7A 2DYKA 4FCTA 3LVRE 3TAUA 2X8AA 1HE8B 2D7CA 2DWPA 3PXGA 3CPEA 3OIVA 2F55A 2WM9B 3K9GA 4TL7A 4RY2A 5KPJA 5J4HA 1H8EA 1Z3IX 2WV9A 1W4AA 2G6BA 3E1SA 5BN4A 1B23P 1PJRA 3RRYA 2BMJA 4ZPXA 1Z8FA 4B74A 3FGNA 1FP7A 4U00A 2OXCA 2QORA 3NVAA 2ZIAA 1E0KA 4KVGA 1NN0A 1T6NA 3OZXA 1JJ7A 1WRBA 3SHFA 3SR0A 4A2QA 2OFOA 2AKAB 3RC3A 3QENA 4DBLC 1RIFA 2EFDB 2F3TA 3DDCA 5AJXA 2ATXA 2FE4A 4XVUA 3U4QA 1QHXA 1CF4A 5DIFA 1K5GA 2P2LA 3QI2A 4KLZA 4TN1A 3M4YA 4TMTA 5A5GA 1KI4A 1E9BA 4OQFA 1W5TA 2BEKA 3NG1A 4LV6A 3M1IA 1CRQA 3SJAA 4MKIA 1COWA 3VFDA 3C7KA 5F9HA 4IDPA 2GXSA 4QBFA 4BGDA 2HLDA 2ZJOA 5DSZA 4L8GA 8OHMA 4HB0A 2IUTA 3GJ8A 4G01B 1IN8A 421PA 3C5CA 2JCSA 4DLSA 3FMFA 2GK6A 1JQLB 1XMIA 1U2RA 2JDID 1XD8A 1KSGA 1XWIA 2RGXA 4TSFA 1OB2A 1GKUB 2GDJA 2BOVA 2CK3D 1DO0A 1P72A 2J3EA 1I4LD 1UEIA 1N6NA 2REOA 3HR8A 4B33A 3FE2A 1X8LA 3FFBA 2ZXUA 1Z0DA 1E1QA 2BKEA 5KDLA 3K0FA 5FUYA 3CRMA 4Q9JA 1J90A 2QBYB 1G3IA 4TYWA 2R6FA 3IEVA 3TK1A 2ERXA 1E79A 4HEJA 1OXSC 1RYFA 2FSFA 4TYYA 4UQOA 2G88A 2ZI5A 4QGGA 2GVDC 1E2MA 1C1YA 1WP9A 1KO5A 4JLKA 5GJBA 4B6EA 1I4DD 2ZRFA 1U8AA 3P4XA 1I2DA 2BMFA 5L3SA 1JXOA 3N70A 4I81A 4AY2A 1N6KA 3IDQA 2XXAB 4HUTA 4HAYA 3VU9A 2YJTD 4A4DA 5CJ2A 3SI7A 4C7OB 2ZTSA 2O52A 4X8MA 4RFSA 2IYXA 4JT4A 2DFLA 2ZROA 1R0ZA 1W0JD 3B1XA 2IXFA 4NCHA 4Y0AA 2EFCB 4ZIRB 4A82A 1DAFA 4IOJA 4IOKA 2F1IA 4JKIA 2F43B 1G8YA 1Z47A 5BYJA 1E96A 1FTSA 2KJQA 2ZRJA 1VIYA 1E9DA 3AVYA 4HAZA 4JLNA 3KQHA 4FMCF 1E9SA 3UWKA 5EUMA 4LBYA 2KSQA 3NHBA 1GSIA 3QSYA 2Z43A 2C78A 2H17A 4EQ6B 4LC0A 2GAAA 5AJWA 1JAIA 2ZI6A 1SULA 2PX3A 3TLXA 5FPKA 3SEAA 1SZPA 3EPHA 4CEIB 2WPDD 3TRFA 3DOEA 4Q9IA 3QKSA 1EFRA 2P0EA 2PCJA 2J87A 2BBTA 2QSYA 2QT1A 4A6PA 4AKIA 2VHCA 3UMRA 5KPDA 4FCVA 2XSZA 3E70C 4LJ9A 2R6GA 2NZJA 3ASZA 1QF9A 1T9HA 3EX7C 3AF0A 1MH1A 2YOFA 2XXAA 4LWZA 5HCNA 2GNOA 1ZP6A 3K1JA 3ECCA 3KQKA 2Z4RA 1HT2E 2XNSA 3IPXA 3QEJA 4BEBA 5FUWA 4ZDJA 2HDNB 1GFIA 3CM0A 2IK8A 5JHHB 5KOYA 3S1AA 1TUIA 1FMLA 1OKKD 1ZM4A 4NYIQ 1R5BA 2WICA 1M7GA 2DFTA 1KI8A 2R8RA 2WSSA 1ZC3A 5C46F 1HH4A 2IL1A 2XNDD 2IEYA 4ILEA 4DCUA 2TMKA 3GFTA 2JLYA 4MA4A 3G82C 1SKYE 2BM0A 2VIIA 4PAOA 1JR3E 3K0FB 4NHOA 4KODA 2IWHA 1KO7A 4GMXA 1SKQA 1IN7A 1D2NA 1GKIA 3P4YA 2V7QA 4G5RA 4A36A 3AGQA 4DLUA 4QJ4A 2OZEA 1NSFA 4JLJA 4TLBA 5FTJA 4ZDWA 2V3CC 3EZ7A 4NYJQ 1H8HD 1SVSA 2H57A 3KTAA 1E0AA 3WHKA 1LNZA 4V0OA 5KO2A 5SZJA 4US2R 3WMGA 2QPOA 3KUDA 3MJRA 2YOGA 5J4YA 3QXHA 3ZZUA 1MT0A 1XD2A 2YOHA 5IDVA 2VF8A 5CDFA 3U4QB 2RB4A 4KLNA 2XEXA 2F1JA 5F2EA 3BB3A 3AKYA 1XTIA 1XNJA 4AI6A 3R9WA 3TW8B 2JIZD 3UANA 5EJEA 4ZCIA 1LS1A 3F5FA 5KTYA 4F7WA 1AK2A 2ZJ5A 2C9YA 4ZIRA 3T06B 1W2HA 4EPWA 5JRJA 1G8FA 4BWYA 3BH7A 3RS7A 4C30A 5FOTA 4BEJA 1RFLA 1VG9B 1NJFA 3CW2A 1IONA 1XTKA 1R0YA 1PVOA 4URVR 4LHVA 5DLQC 1Z6GA 2GZAA 4M1YA 1PLJA 1SXJB 5JEEA 4QKQA 2FFBA 3TE6A 4BE7B 3I73A 3C4JA 1Z0KA 2OT3B 3SN6A 3AP2A 3THXA 1JB1A 3MUFA 1FOEB 1L2TA 4Q7KA 1F60A 3AVOA 4OHZA 5ANRB 1G8HA 4OQMA 2FDCA 5DNYB 2VRWA 4IVPA 2EYQA 4EPTA 2AD1A 3RRMA 1XEWY 3UG7A 3WNDA 1YZGA 1W0KA 4CDGA 4HYYA 4EJSB 1ANKA 2F7SA 4DB2A 3CX8A 4P4UA 4M2LA 1UEJA 1IQPA 3DM9B 4MKHA 2QROA 2QAGA 4XWOA 2VQSA 4H1UA 4PPFA 2EW1A 1A2KC 4HZUB 4PSKA 5E7IA 1ZJ6A 3OE7A 4WZBE 4V0ME 2IWRA 4JYCA 4W5WA 4W7SA 1Q12A 1KI1A 3CPHA 1TX4B 5H1YA 1OF1A 3PUXA 4V0KA 4PPQA 3QG1A 4RZXA 5K8UA 1Y63A 2BJWA 2QZ4A 2IF2A 3ZS8A 5JCPA 1CU1A 1NY6A 3QXCA 2FG5A 4IVQA 1U0JA 2RGGA 2ZJZA 2FWRA 3LFUA 3MSXA 1OJLA 3CRW1 4C0AC 3MLEA 1P9WA 5FI1B 4C0JA 1NMXA 1XP8A 1KO1A 5J5CA 2P65A 3Q5DA 1IXZA 1DEKA 1XFAA 3NDPA 1TMKA 1DS6A 2H92A 2BKUA 3BK7A 4Q18A 1E2QA 1G7SA 3B7GA 1T3SA 3G5UA 2NGRA 2W2XA 4M53A 4MYUA 4Q19A 2O0KA 4LHYA 4PFSA 4D25A 4MYHA 5D3MB 1ODFA 4C0QC 1GITA 4KV9A 2CVFA 2OBLA 3IILA 2QAJA 3VAAA 4KBFA 3ZD7A 2DPXA 1NMZA 3HPRA 1YRBA 1WQ1R 1QHIA 2WWIA 4Q1AA 4M1WA 5KSYA 2YV5A 2GBLA 3QKTA 3K0AB 3DKVA 4CVNA 2J45A 4XD7D 4QM7A 2HT1A 1XF9A 2GAOA 5K8LA 5CLLA 5CB6A 1ZIPA 1E2LA 1YZUA 5G41A 4KBGA 3EZ2A 4X8OA 1WB9A 4YC7A 1W0JA 4QG7A 2HLDD 1OSNA 2ZSAA 5EXXA 4WZ6A 4IEEA 1E2FA 1ZM2A 2V1UA 2VH5R 5G3YA 1VKJA 5JWOA 5KHOC 3WRXC 1ZM3A 2RH5A 4BLQA 3IHLA 3LBIA 5P21A 4ARZB 1VDZA 4A92A 3CRQA 1N2CE 4B3GA 3O8DA 4ACAA 3CNOA 2RGBA 1RRFA 1SVOA 1P7CA 1E1RA 5BN3A 2HXSA 2VYFA 1D2EA 2FFQA 2QG6A 1EFUA 3LX8A 4N0DA 4GFDA 3MFYA 3QE0A 2OEPA 4HI0E 3KJEA 4MUAA 1T8TA 2J7KA 3BWDD 3FOZA 2PZGA 1QBKC 4QRHA 4TMZA 3AKCA 3GFPA 1X6VA 2ZE7A 3U7FB 1OXTA 2GEVA 1U94A 4E5UA 3KZ1E 3PCRB 3H0KA 3KKMA 2GRJA 2YINC 4GT1A 2QQ0A 4M9XA 5AR1A 2ZRKA 3TAHA 4H1VA 2AFIE 3QXXA 1E9RA 2QU8A 1CBUA 1KHTA 3N2IA 4LYFA 5JSZB 2YVUA 3Q5EA 5KU1A 1CJTC 4D0LB 4JJKA 3ZQ6A 2X2EA 2ZUCA 4DSNA 1QG4A 3GLIA 1LV7A 3B5JA 5JJKA 4NH0A 1UBFA 1G6HA 1XCMA 3SFVA 3U2QA 2BVNA 3A1UA 1IAQA 3ADBA 2I4IA 2IYVA 3Q3JB 3RLFA 2AKYA 3IQWA 4S35A 1CJUC 2B7BA 4G1UC 1F2TB 3I61A 5GJCA 4CF7A 4MRSA 4DZZA 3SQXA 1XJ0A 2WJGA 2EFHB 4PC7A 3V00A 4TL6A 3VQTA 3HR7A 2Y8EA 4KFSA 4OI0A 4PSAA 1W46A 2V55B 3RS0A 5J4KA 4YMVA 3WY9A 1Y3AA 4CGZA 2ZRBA 1CXZA 3DZ8A 1OFHA 2ZANA 2H8KA 4M8NE 5M04A 4ON9A 1JPNA 1G8PA 1G5PA 3AKDA 3GLHB 3DPUA 3L0PA 2V7QD 5BXQC 3PIRA 2W0SA 4IFBA 1AS2A 5K8IA 1LF0A 2ZR9A 5E4FA 3LLMA 2WOJA 4FIDA 1HT1E 2J5XA 1PV4A 5J40A 4TZ6A 1EFCA 2VHUA 2WJJA 3K09C 1OB5A 1KSFX 3EAQA 4MUBA 1W47A 3UMSA 5KSZA 5FBVB 1MO3A 1HEIA 1VG1A 2Z4SA 1KI6B 2ODWA 4ZV4A 3IEUA 1A5TA 3LO5A 1ZRHA 4TTPA 1W48A 5AUNB 5JS8A 4DVGA 2XJ9A 4RD4A 1DG1G 1S9DA 2BIFA 3REFA 4L9WA 4MH0R 3R20A 1XPUA 3CH5A 1OXVA 3P1JA 2ZYUX 1Q0UA 3A4NA 1RE0A 4DB4A 1NLFA 2AXNA 4D4JA 4ZCMA 4UNPA 2PZFA 4NTZA 3I72A 3ZVNA 3PEYA 3RWOA 3T35A 2OO7A 2WBLC 3SC3A 1MO6A 4HDQB 4DLZA 3F0TA 4WBSA 2FPKA 1XXHA 1AZTA 3HYRA 1D5CA 3EWAA 3LBHA 1IM2A 621PA 5B2ZA 4MKFA 1Z28A 4CW7A 2R6CA 5HCIA 1EX7A 2VL7A 4F38A 1M8PA 4WVFA 3B6EA 3NTUA 2GESA 1L8QA 3CR7A 3K0CA 4IHQA 1SHZA 3RS2A 3CBQA 1P6XA 1XEXA 3B1YA 4C9BA 4CT4B 4DEXA 4DRZA 4U5XA 2GXUA 2XSZD 1ZU4A 2WWGA 4L15A 1NIJA 1N5IA 4B3CA 4LC1A 5DI3B 2QSZA 4OHXA 1SKYB 2XX3A 3EZFA 1K5DA 4HAUA 4A2WA 1QHSA 1RZ3A 3GJ0A 3NC0C 3PFIA 3UKDA 2WSMA 4K8OA 1Z6AA 3B13B 5FOVA 3SDZA 1E69A 1KK0A 1XEFA 2D7DA 2OBMA 4BZPA 3LH5A 4KSCA 2OUKA 1CR2A 5BW8A 4C3ZA 3ND9A 1SVLA 1PUIA 2H18A 1T91A 3TUJC 3QJYA 2H1LA 1G3QA 2HEIA 4Z54A 3L0SA 4LYHA 3IIJA 2IW3A 3KXKA 1WMSA 1BYUA 4V0MA 2O8CB 2QPAA 5FTKA 3W6OA 2ODEA 2ANBA 2YWHA 2FGKA 1YZLA 3UMFA 1NSTA 3K0SA 1F5NA 1RRPA 4JIMA 2NQ2C 4BLPA 3VNVA 1KKMA 2AK2A 5JI3E 3GJXC 1BOFA 2FSHA 4XJXA 5JBQA 3TBKA 1ZD9A 2PJZA 3I3SR 3KB2A 1CJMA 4IJMA 5L3VA 2FA9A 5JWHA 1E1QD 4O2LA 1C4OA 4I1VA 2VSFA 1WBDA 3RANA 1KO8A 4EJSC 4TT3D 1IJEA 3GJ4A 4TQ9A 4URYR 1TF7A 5H68A 2NIPA 4HATA 1VCOA 4Q4HB 1NVVQ 4I1OA 4GZMA 4GNKA 1ZNZA 1FTNA 4G5QA 2QENA 4IXNA 1S9HA 3VR4A 5CYOA 4F93B 5EE0A 1TTTA 3WMFA 4EPXA 4P0TA 1Z06A 3EWSA 1G8GA 4DDTA 3QKRB 1OYYA 3VTKA 4LJYA 3KKPA 2N46A 1JALA 4ZO4A 3EZ6A 1Z0AA 3NHAA 4Z1MA 2RGEA 4MRPA 4Q03A 1X8KA 4R9UC 4HZIA 4DCNA 1US8A 1GZSA 5D3QA 3A4MA 4GL2A 4LRWA 3E2IA 2QQEA 1ZC4A 2ECKA 4V03A 4KCGA 5TARA 1J70A 2ZJ8A 1RYHA 3MD0A 4JVLA 2ONKA 2J0QA 1UAAA 5LBIA 5CM9C 4Q00A 2ZAMA 1II0A 4MGZR 4ZCLA 4A9AA 1TEXA 1XCPA 4TZ0A 3UG6A 2IX3A 1YZNA 4JS0A 1JQJC 4I99A 1TPZA 4QBIA 1TU4A 5GJVC 1AGRA 3NWJA 3SJCA 1DARA 1UKYA 5JLJA 3BH6A 1OIXA 1E98A 2AHOA 2AWNA 2IYWA 3QNUA 4ERNA 2OCBA 2ZRIA 4PC1A 5LD2C 1V43A 1XXHE 2PCLA 3BIFA 3UXMA 2VP4A 5CK5A 1KNQA 3K53A 3GLIB 2FX3A 3CNLA 1G4UR 3TR0A 4JSYA 4P4TA 3N2EA 2PEYA 1BYIA 2VP9A 4NU0A 2HF8A 1W0KD 3U44A 2XTNA 2IYUA 1CULC 4TT3A 1NY5A 3DZDA 2PMDA 1VCNA 4PC6A 5AK0A 3B8HA 2B7CA 4DLWA 1DAHA 3LQRA 1KI2A 4MRRA 1ZAKA 4HB2A 4OHYA 1W49A 1N0UA 3LW7A 2ZS7A 3A8TA 3GCGA 3QQ5A 5E7MA 4RD0A 4UXJA 4DCTA 2ZRAA 3TUZC 3GMTA 5A4JA 4C0SA 2N1BA 1R5NA 2BM1A 2FEOA 1W36D 2WIAA 2DFNA 1GTVA 4DSUA 2Z5FA 1N0WA 5K8TA 3CPJB 5IK2A 3THYB 1E2GA 4DDWA 3KTAB 1ZD8A 4DCVA 1G7CA 3NEYA 4YXWD 2CCJA 1AM4D 2QM8A 2NTYC 5TDHA 4C0LA 3FMIA 3LX5A 1KAOA 1F2UB 1O3YA 3X1WA 4L16A 1RW4A 2CEAA 5JJLA 5EP3A 3AVWA 1Z0FA 3Q7PA 2ZUBA 3WRYC 4DLYA 1E99A 1TQ2A 2D62A 3BAFA 3VR6A 5FOUA 2JJ8A 2Z6VA 2YWFA 4NZYA 4NPHA 4DEYA 4IDQA 1HURA 1EFHA 4V0LA 3FB4A 1Q1QA 2RGCA 4H9GA 1X1SA 2V8OA 2WWYA 1KI7A 2MMGA 1OKKA 3GJ6A 2HCJB 2ERYA 3LD9A 4PZZA 3U3MA 4QXAA 2X77A 5FL7D 3QF4A 4HB4A 4OQLA 3BB1A 1H8HA 3UATA 5FBWB 4P3YA 4ESVA 2IBMA 5FL7A 4C2TA 3ZYCA 4R2IA 4OKSA 4HLCA 1FW6A 1NLYA 3GLIE 3FPAA 3OFNA 4OHVA 4D82A 1OFUX 1W44A 1GVNB 1N6RA 1R8QA 4LJ4A 2HYIC 4IDOA 1N25A 4U02A 5KNBA 2ZSEA 1E9AA 2Q9AA 3B9QA 4R98A 4KFTA 1M74A 1UJ2A 5EXPA 2BMEA 4O3MA 4R7ZA 4CZ2A 1DBSA 3D31A 1JNYA 4LX0A 1QHYA 3RS4A 2QN6A 3QKSB 4KVAA 4XVRA 2IS4A 1XCGB 2RHMA 1NBME 3OIWA 4KYUA 4LGMA 3AGPA 4LSGA 5JZVA 1E2EA 4QC2A 5DN6D 1KSHA 2F3RA 1Q3TA 3L0OA 3W3AA 4RFVA 1NLZA 2JLSA 3THYA 4I4LA 2CLSA 2ZI4A 4IDNA 2C5LA 2XZPA 2B21A 4HLQB 1YKSA 2HYDA 1COWD 4YMTA 3J81k 3A1WA 3LXXA 2JJ1A 4OI1A 5FH9A 1BKDR 3U3RA 5L3SB 1FQJA 3AF3A 5DO9A 3A58B 2ZYVX 4WW0A 1OFIA 1NVUQ 2XOKD 3H4MA 1W4BA 1E6CA 3EA0A 1KMHB 3LVQE 3WYGA 2EQBA 5EP2A 2CNWA 5EUQB 2G3YA 2ORIA 4P4SB 5TV2A 2O8BB 2L0XA 1ZVQA 4RFSB 3QXJA 1VYVA 1Q22A 5C2JB 3W34A 5FPYA 3GJ7A 4XIGS 4URXR 1OHHD 1QVRA 1SVIA 2EYUA 3PUZA 3T1OA 3H86A 1G291 2UKDA 4JBWA 2WZQA 2GCPA 4LV5B 4PSVA 1P61B 2XAUA 2ZRNA 3AEZA 4C2UA 3I5XA 4F92B 3AVXA 3GJ3A 3IUYA 2JLWA 4G5SA 1NNEA 5HE8A 2QGZA 1XPOA 3R7WA 4UJ5A 1QHGA 4MRNA 4PHGA 3VX3A 4QHTA 2OSBA 4HDOB 4AC9A 4AG6A 4IOLA 5FUVA 2VHQA 2FGJA 4MYCA 1IN6A 3DEFA 3UIEA 4BLOA 1NN3A 4LJ5A 3SZRA 1IY1A 5G3ZA 2ATVA 4UNRA 4QNMA 4TQUS 4RJLA 1JR6A 1OLOA 3NH6A 4FW9A 1VG8A 1FQKA 1T0HB 1FX0A 1KZ7B 3L2OB 3M6AA 2PZEA 4AYXA 2NZ8A 1M34E 1RJ9B 3RABA 4YMUA 2BDTA 4BPBA 1CEEA 1A7JA 2G1KA 2P6UA 4M1KA 3T1TA 2VHTA 1W36B 1AKYA 1RC8A 4TSFD 2RGNC 1A82A 3CKLA 1D6JA 4JLDA 4JL8A 4NYMR 1P9NA 1E1RD 1NG9A 3FTQA 2CNWD 4PO8A 2OG2A 3AF4A 2JLRA 4Q1DA 3MMPA 4NCNA 2XOKA 1P2VA 5FOXA 3ZVRA 3GD7A 4EPYA 4MKGA 4A8JA 1XTQA 2QUZA 2G83A 3B78A 4NMMA 5SZHB 1TQDA 2PT5A 1N6OA 1MABB 2WVJA 3W90A 4RCZA 2VP0A 4ASUA 1E2IA 2VLIA 3X2SA 2JJ2D 1ZUIA 1HY3A 2CJWA 2EFEB 1DPFA 1Z07A 1ZCAA 2Q9BA 1XD2B 4BLSA 3B85A 3BD9A 4HSEA 3GP8A 5HE9A 2BBOA 4NYIR 3ICEA 3WHLA 1P73A 5EXTA 1BMFA 1N5KA 2RGDA 4NBSA 1II9A 5EZ6B 1SXJE 2X19A 4IKEA 4LHXA 1R0WA 4LY6A 4FI3C 3S1AB 2H5EA 2H16A 2QT0A 4UXHA 2F1HA 3CZPA 1M1YE 2VBCA 4ZKEA 4PPNA 2V1XA 4OQXA 3FHOA 4DJTA 1S0UA 2NO6A 2CL6X 3HDTA 4TTQA 4DLTA 1EESA 1RVDA 1YJ5A 2NPIA 1SHKA 2A2ZA 4PO9A 4TMVA 4GOKA 5DGXA 3R9XA 4PC2A 1ZNYA 2NPFA 5FTLA 4GOJA 2C77A 2GVZC 2ZJAA 1ZUNB 3DL0A 1VMAA 2GEDA 2GCNA 2WJIA 5KDOA 1EFRD 2DHRA 4FMCB 1DE0A 1G7TA 3IBYA 4A6XA 5FBRB 3W8NA 4XTRA 1ZD1A 1OXUA 5DI3A 5CLQA 1NBMA 3B1ZA 1LTQA 3OIYA 4LJ6A 1GG2A 3R8FA 4OBEA 2IYSA 4BRUA 3CNNA 2ASEA 1G18A 1KTVA 2V9PA 2NO0A 2C9OA 3CWZA 1ZMXA 3I4LA 4NL4H 4D6PA 1OH7A 5CB8A 1F2UA 1K8RA 2OV2A 1TADA 1DO2A 1A4RA 3K70C 2R6AA 3O47A 4PZLA 2F43A 1MOZA 1S1CA 2KI5A 3A1VA 4CEIA 2VF7A 4J0QA 1LFDB 1W4CA 2LWIA 3K70D 4UNSA 3GLFB 4WIAA 2W0MA 1JEEA 2BBSA 2C95A 2CLDX 3BGWA 5LPNA 1XMJA 3BE4A 3SJZA 4CEHA 1XXHB 2A5JA 2LKDA 4QNRA 2W83A 4C0HA 4NCIA 2BCJQ 3LWNA 1UBEA 1T5IA 3NBXX 1KOFA 1ZU5A 4GSYA 5IHPA 5KSPA 5IK2D 3PEUA 3QF7A 4L4UA 3RHFA 5HPYB 1WBBA 2ZRCA 2XZLA 4GDFA 3KUCA 1CR1A 2NO7A 2QRZA 2J7PA 1OT3A 1KZGB 1U99A 2CE7A 4LPSA 2OAP1 4NCJA 4Z8XA 1IN5A 1YR7A 1FUKA 1KGDA 5JHGB 3KKNA 4DCSA 2QE7A 2K5UA 1R7RA 5JJIA 5DH9A 1UDWA 4C7OA 4JL5A 2UZIR 2XB4A 3THWB 1MR3F 1KK2A 3OESA 2C98A 3L0IB 2QBYA 1FL9A 1LS6A 1NKSA 1M7HA 2VEDA 1VTKA 4BFWA 4KO8A 3WNCA 4DUGD 4PAQA 4QBHA 3VKHA 2JDIA 2Q0HA 3SYNA 4EDHA 1Z6YA 4K46A 3DMDA 4FMDF 3F3YA 1G1MA 1EXMA 3RS3A 2CCGA 3WP0A 1VCIA 2NMVA 4MGYR 3OEHA 1FNMA 2WJYA 4LJ8A 3FVQA 5FBQB 3KXLA 3VMFA 3TR5A 3SE0A 3BJIC 1QZXA 4URWR 2UZ3A 3ZGXA 2O0JA 3R8CA 1DTSA 1GIAA 1VIAA 1YR6A 4LOAA 1W1WA 3QG5A 1KMQA 5EXSA 4P32A 4JL6A 2XB2A 2A7QA 4AKGA 1CIPA 3OEEA 1P60A 3P32A 1OPXA 4XSHA 3BS4A 3NH9A 2R62A 3BRWD 2WAXA 1NVVR 2G0TA 3EC1A 2ORWA 2CHVA 3U6KA 4XD7A 2DY1A 4AD8A 1YU9A 1G64A 2ZRPA 1NIPA 4A15A 4II7A 2GCOB 4P31A 3ADDA 4JVSB 4OQNA 3Q85A 1Z2AA 2J41A 4EFNA 1L7VC 3FKSD 3FFAA 2OCPA 1KDRA 5KSOA 2J9RA 5JS7A 1NMYA 3MWJA 3PEVA 2SHKA 2C96A 1KI9A 3OAAA 2R65A 3U5ZB 3K0EA 3NXSA 4F91B 2V54A 4UNQA 3ZIAD 1IXRC 3AVQA 3CO5A 2RHDA 5DI9A 1E32A 4R2HA 4W9MC 1JPJA 1HE1C 3FWYA 1FZQA 1FPMA 2ZS9A 3LA6A 1D9ZA 3CWQA 2BCGY 1SQ5A 4HLDA 4QHSA 3C41J 1CJKC 1Q20A 1R5OA 1X86B 3B60A 1ELOA 2AWOA 4F4JA 4XSGA 5AUQA 4BZQA 3JVUA 4HLUC 1WF3A 4TLAA 1AIPA 3W6NA 3LDAA 1KDPA 4IVRA 1S3GA 4OI4A 2W2TA 4R71A 1VECA 3CF6R 3AVUA 4AKHA 1VPLA 1XDBA 1YVDA 3AVTA 1OHHA 2ODNA 1Z29A 2HJVA 2NOAA 4I1SA 2WPDA 1OXXK 2ONJA 4OJKA 2XZOA 1NBMD 4MITA 4DXAA 4YDSA
chains in the Genus database with same CATH superfamily
2J0UA 1I7NA 2FSIA 3L4SO 5F3DA 1QVAA 4DV5B 4K6KA 2Z5LA 4U2BA 1KY5A 3PG5A 3W5UA 3T34A 2EJTA 1EM6A 2A0KA 1HC7A 1QX3A 1EKXA 3C16C 3JQFC 3KQOA 2G5CA 2J33A 5DXJA 5TEVA 4QELA 5TIIA 1NJ6A 1TAGA 3AUXA 1A76A 3CKKA 1T1IA 3N1UA 1O96A 5DTEA 2QMQA 2ZSFA 1UMCA 1C14A 2B7LA 3VVCA 1OBFO 1I9GA 3VHLB 3M9XA 1CYDA 1DXYA 4JSRA 2OQIA 1U11A 3NHWA 2AFHE 3NW9A 1NI5A 4OJQA 1V5WA 3QY9A 1A88A 4YJ3A 1DELA 1G0OA 2EJWA 2YUTA 4Q9LA 3RBVA 4QFDA 4ESEA 3MS7A 4GP7A 4ND8B 3LK7A 3I04M 1E1NA 3EIFA 3PQDA 3V1KA 1JU3A 5DM70 2DB3A 1GOTA 2QR3A 3V4PB 4XH9B 4F72A 5JAZA 1K97A 3G0GA 2M6SA 4HX2A 4M99A 4QQ8A 2RKWA 3U7QB 2G0NA 6Q21A 3TD6A 2JPDA 2OORC 2W4MA 1IH8A 2H4JA 4C29A 1YJQA 2E55A 1JMKC 9LDBA 4X71A 1X7WB 3TKYA 2B0JA 3NORA 4RH0A 1RP1A 5SZKB 1J99A 1XPRA 1EUZA 2JI7A 1SC9A 2WD7B 4ZO6A 4ESHA 5CH3A 4IJKA 3RK1A 2HLNA 1RSZA 1V8DA 2FR8C 3C39A 3LQ2A 4HDCA 4AJPA 5CEJA 5FEUA 3CLTD 5ETJA 2JAOA 3KDAA 4GX5A 2JJ2A 2AN9A 3EIEA 2I4OA 3B7WA 5ECYA 2A78A 4B3SB 1JBQA 1J2RA 6NULA 3ESBA 3H8VA 3CG4A 1WUYA 1JAHA 1Y1TA 2GD0A 3OF5A 1AS3A 5ALMA 1QO7A 2JEOA 1PF7E 2VYCA 4D9JA 2C5FA 5K20A 1C81A 4MQBA 1Q92A 1L3BA 4FT2A 3IMFA 1KS2A 3U6BA 1FB5A 2YZ2A 1M1YB 1NZJA 2BEVA 1U5BB 1P17A 3BORA 2ZVPX 4Q6WA 3R7DA 4GKKB 1VM6A 2XLCA 1FA9A 2JBWA 4EO9A 1N9ZA 3Q3HA 4RCYA 4DVJA 4HNTA 3RSLA 4GBMA 4QEKA 1GCOA 4IEIA 5EAIA 4DA0A 2IYLD 4DA8A 5LXTA 1FRFS 4YRQA 1IY9A 5KNCA 3X0DA 1TF2A 2NYUA 4DT1A 4KQGA 4G0NA 2B6HA 1MTZA 5AP9A 3QLVC 4MRMA 4CIDA 5HFAA 4NLLA 4AS1A 4EHLA 1UAGA 8MHTA 3CONA 4DC0A 5CDFE 5EQDA 5JH7F 2DFKB 4GXRA 4BV2A 3GXBA 5K8VA 3SHQA 2VDWB 4DBLE 2XNDA 2NVOA 1R9JA 4JXKA 5FOSA 4E09A 5J4VA 1IY8A 2ACEA 3C2QA 3NUQA 3IJRA 3DZGA 2D13A 2QMEA 1JDPA 2FJ0A 1REQA 2QRNA 3D3QA 5F2OA 1QBGA 1E8MA 4D3ZA 4M21A 1P8JA 1Y9DA 3EFEA 4FSHA 1UC8A 2W6ID 4JX8A 2O2EA 2E85A 4MCIA 1IEWA 4V0RA 2C61A 3TI9A 3VU3A 3JCZA 2FWBA 5A3SA 1DU4A 1VBMA 3VNRA 3NM5A 4AMBA 4BFVA 4D80A 3IBTA 4PZYA 4D2IA 5JYDA 2X41A 3B1KA 2VQ3A 4FDMA 4KGVA 1FS6A 4MV7A 1DBPA 3LV8A 5EJFA 3VR3A 2I2FA 2X5NA 3BMCA 5I9TA 1BMQA 3E5MA 5DTRA 1SVWA 1G5HA 1J7JA 2W2KB 3LHKA 4Q1EA 4HK4A 4JT9A 4W1SA 5FPHA 5T4HA 3Q7EA 3O8LA 1WB6A 1I7DA 3KELA 1WUJS 1T5LA 1TT5B 1RI5A 3VR4H 2F9LA 2ZEJA 4PXAA 4K0RA 3DP9A 2XOEA 4FFDA 1A04A 2X4IA 3TLGA 3DDNA 3E9QA 2LZ0A 2O8BA 1KMHA 3CZCA 4YQFA 2BKLA 4ZT5A 4CMJA 1G3RA 2FU5C 2HMTA 1GRVA 3FW1A 2QRLA 5DX1A 1CLUA 2WKRA 2WJVA 3A32A 4ID3A 3VPBA 3FMVA 1OBCA 4ZEOA 1ORTA 1Z37A 2BV3A 1FJHA 2OKCA 4LHZA 3TNYA 4AECA 4M36A 1W36C 2HF7A 3I5MA 1XRLA 3H05A 3IBGA 2MYTA 4MVCA 1VP9A 3HGTA 4Q48A 4I50F 5CDHA 2WHPB 2CDNA 4HYEA 4FB5A 2VJQA 1W1UA 3HADA 3Q8MA 3UM9A 4EGJA 2ESRA 4N5IX 3S2IA 4W1QA 4DHEA 2HWUA 3KIPA 2DQKA 3L7YA 3UFBA 3ZHZA 3GA5A 4W6ZA 2PRJA 2OK8A 4RXMA 1A7KA 4BFTA 2Y1CA 1ACLA 2IJGX 4OM8A 2QYOA 2ZUVA 1XO1A 4JZKA 3T1VA 3Q7QA 4N7MA 3H19A 1QRUA 1V5FA 1YMVA 4EI9A 4B6RA 2A9FA 1VL6A 2H0RA 3A1FA 4NFYA 4WZAE 4EATA 4IYJA 4RK0A 2W98A 3IV9A 4RZ3A 4YRCA 4ZV9A 1BCSB 2XYPA 5KDDA 1XP5A 1J2EA 3BJZA 3K1AB 4FWIB 3Q15C 4A1FA 5CVUA 5FIUA 4MEJA 3TNDA 4AICA 1JIJA 1QO9A 1ZOSA 2QE6A 2QE7D 4P5PA 1CQWA 1ZIOA 4JHLA 4C4PA 1E1MA 1KA9H 1LLUA 3C3PA 3DTNA 2E18A 3OC6A 3GP5A 5DJ5A 2IZ1A 3ZIAA 3EYWA 4R9VA 4ZCRA 2DTXA 4BECA 4MVXA 3PI7A 4MWZA 5G0TA 5C80A 5TMPA 2IHBA 4L4XA 4PYRA 1UDXA 2R44A 3S2EA 4O4HF 5HIJA 1NR7A 1PG2A 2WWHA 3LNCA 3DFUA 4TS9A 1SC3A 4H0FA 5JDIC 2MSDB 2C4NA 3IKMB 3OFVA 2VNAA 1NNI1 1QZ3A 3LDFA 4GBGA 2PBRA 4OAPA 4R1NA 3WRXA 2UXCB 3O31A 4CUKA 3C43A 2FPRA 3CF0A 3WL3A 1QZTA 1I7QB 3CCCA 1PAUA 3F90A 2Z3ZA 4A3SA 4HT3B 3V6LA 4WH0A 4V1CB 1X9IA 1GA6A 3OOYA 3S70A 2BTEA 2NG1A 4XX0B 2C94A 2XH8A 1GXSA 2OAQ1 1CUDA 2YC4C 5DLDA 1DG3A 1G8SA 2XMZA 2UZ4A 1Z6TA 4JJFA 5AVWA 3F8TA 2WIKA 5H8WA 5BR1A 2CMGA 3TFQA 2EARA 3HBFA 3SSMA 4OMCA 4LF4B 5CDTA 2XWJI 4FGSA 5AW9A 2IFTA 1SCAA 2I33A 5A5DA 2C04A 1KH3A 4NBSA 3I5YA 1ISIA 2JIQA 3FUCA 4LXYA 2KM1A 4XTCS 4Q66C 4GC5A 1DVRA 3DKIA 2WYOA 3ZGZA 4WN9A 3NVKI 1B14A 4GP6A 4G5HA 3Q7SA 2A14A 5J58A 1RADA 1EUDB 2DPMA 2OXTA 2FPPA 1PEAA 1MF7A 1U2TA 4ZD6A 3F2IA 4B4KA 1O6GA 1IE3A 1RI2A 1GWNA 4Y6QA 4YRBA 3DYBA 3N2LA 3TTWA 2BRUA 1MBZA 2FPGB 3KV1A 4OJTA 2RGNA 1RJ9A 3E7PA 4UBLA 1C30A 4PFKA 4QOJA 4C4ZA 1P2TA 2QP4A 1ULUA 1NA5A 1HDOA 2QG4A 4E5VA 4CU2A 1TYCA 1YJXA 2B34A 1KYXA 1ST2A 1TLLA 4PYIA 4UARA 4DEVA 1Z08A 4YV1A 4E15A 2VXCA 3I39X 5FRDA 2IZOA 3NIGB 4NAVA 4G97A 1ZWKA 1AE1A 2OGSA 2ZUDA 3HABA 1SXJD 3F9IA 1GDDA 1P5FA 2GJAA 4TMWA 5JD3A 3AV0B 1USVA 1F4LA 3U60B 3LSTA 3AM1A 2J7PD 4UXIA 2QP9X 3HB4X 2G4VA 4ASUD 4B3DA 4D4HA 2RI1A 2Y2UA 2YICA 5CK4A 2QRVA 721PA 2O06A 4DUPA 4R81A 1UZMA 5T3YA 1M6NA 3OQIA 1SUEA 1AK9A 4HQNA 3L6CA 2QTTA 3T94A 3SXPA 4B6SA 1FS4A 2EFGA 4X20A 4F4CA 3PXEA 1U98A 1M1NA 1U0OC 3WVNA 2KBEA 3GJRA 1RWXA 1CF2O 3V4LA 3F46A 2PKWA 1E94E 4DANA 1PV2A 2ZSIA 1XQ1A 1JHYA 5FEMA 4PSUA 5F35A 5JZBA 1XA4A 3NI2A 2A6PA 2H9YA 4MQFA 4AB1A 4BC0A 4KITB 3JY6A 2ZJYA 3W4JA 3ILHA 4GWLA 4BVAA 3D8BA 1KH2A 4AL4A 1FUUA 1R74A 3GOHA 4UULA 2PFSA 3PRJA 1VE5A 4BB9A 3CGGA 4LBWA 4BP3A 3PGLA 4I9GA 4ZVSA 3WICA 2VHJA 2NYAA 2AJDA 2IIQA 4FDVA 3IBCA 4YS6A 2JEYA 4N0MA 2F1OA 4Z1MD 4PLFA 1CUJA 3PFWO 1UP6A 4YV0A 2B20A 3W5DA 1RLOA 4LZZA 5K4GA 2ORYA 3LNTA 2WJWA 5IC5A 1YR8A 4ZEXA 5B7QA 3KWJA 3RK4A 3U44B 1Y8RB 1NX9A 3NBYC 2R2AA 4DR7B 1Q1AA 3GRYA 2P3SA 3B12A 4KQEA 4A0GA 4GOMD 1I0LA 2ZE5A 2HLPA 3OO1A 3Q7RA 3WQHA 1WLYA 3IIKA 1I0ZA 4JCOA 4FE3A 2ZBQA 3OT5A 3Q40A 1Y82A 5IANA 3RAJA 1VIMA 4F8JA 2Q4BA 1NYRA 3PUVA 3ZCXA 3W9YA 5KJCA 1Y7IA 1Q19A 4LSZA 4B6PA 4QQRA 1JLKA 4EHIA 4Y9UA 3GUHA 3H65A 3JPYA 1CZKA 3C6QA 5G02A 2GMWA 1HYQA 2YTZA 1R0RE 2BEWA 5EE5B 4BMDA 4EG5A 5IZ4A 3KLBA 1R10A 5ECWA 4TROA 1QH9A 3LIIA 1KDYA 4B6QA 4DDVA 2K2QB 3KJNA 4ME6A 2PD4A 2OHVA 3CRNA 5E95A 4YASA 2FPPB 2XGGA 4RTQA 4NYJR 1X15A 1AQYA 2FPXA 1OIVA 3UV7A 5BV7A 4IUBS 1RQ2A 3NYRA 4GMHA 3MWKA 5FLYA 1WKCA 3SX2A 1EE1A 3MILA 3O8CA 3FPEA 1AX9A 3L1IA 5DTQA 3B36A 4ER5A 6ABPA 5K0NA 4GOLD 4PYNA 1MB2A 3LTEA 1I4WA 4Z2YA 3TLCA 1U3VA 4LFAB 1NF8A 1AS0A 2X1LA 4Z51A 4BO9A 1NG1A 3IO5A 2Q3HA 1TDJA 1U28C 3PNMA 3SJBA 3B6KA 1ZITA 1QTIA 4HN2A 1LSOA 3NP9A 3SQLA 4IEFB 4FNAA 3HSYA 3KDPA 2XUFA 1I5RA 1AOXA 1YTLA 3UWOA 3GEGA 3QEAZ 3C24A 4KMSA 3BT7A 3JQ7B 3OZVA 3OT4A 4JC4A 1XJQA 4M22A 1I4OA 4V1CA 1NW3A 2XWSA 5HF6A 4A0HA 5JANA 3ZR4B 4FQ5A 2AK3A 2XQFA 4FKZA 2ZYRA 2QTLA 4K9DA 4BX0A 4QPNA 4BLWA 3K3PA 3QXSA 3GT3A 2DHQA 2HTFA 4TXNA 1FFXB 2PKXA 4EHFA 5C1BA 2ZJFA 2ZJ2A 1NNLA 1ATIA 2ZITA 5EIXA 4OK3A 3ADKA 1O0CA 3PTAA 1WXWA 4KFUA 4RMNA 4DWVA 3FDXA 2DH6A 4NSNA 4XQ9A 3WG9A 3ZJ4A 3KPYA 2R11A 4FUQA 2A9OA 3K70B 1B1AA 1GG9A 3A9CA 2QJWA 1JI0A 3ASYA 5TRTA 3UWSA 1QG6A 2QLLA 4N3NA 3WLAA 3O1HB 3Q3IA 2V9CA 3J80A 2GN0A 2JJMA 4O59O 4DMMA 1UBRS 4HZUA 5CYGA 2FSSA 3ONDA 4MW1A 1FYWA 1T1EA 4HDRB 1P7YA 3PLNA 3OZCA 3N8DA 1XE3A 2C0CA 1G38A 2B99A 4TWIA 4O5OA 2DFPA 2GHTA 2YCLA 4EQZA 3SSOA 2DBRA 5TXGA 1X1TA 3FMOB 2YL2A 2HRQA 2G8LA 3OKPA 1TAQA 1E6KA 2FPLA 3BCRA 4FZ3A 4O0MA 4DNXA 5TPZD 4BMYA 5EIEA 1CS4C 3EQ2A 4D9HA 1Q0SA 5LFAA 4UNNA 2ARKA 1C9MA 1NI4B 2NU7B 2JLZA 3EIHA 1ZPDA 3TIFA 3B1WA 1RQLA 1BHO1 4ZXFA 4Y2SA 1C4KA 3NP7A 4KX5A 4G07A 4PTYA 1DEAA 3JVVA 1T4BA 4DSAA 4IKPA 4PGAA 2ZZNA 2QPTA 1W34A 1HTWA 4YCDA 3KFVA 1AHIA 3N0XA 3DLTA 3AQ4A 4YA6A 3TCXB 1JAYA 2XV1A 2XTJA 4HB3A 5COQA 4U9HS 4B3HA 4UKDA 2A5FA 2IH5A 4Y7DA 2XVXA 3EG5A 1KY2A 2RJOA 1ECCA 3FNRA 3MD9A 1EFLA 4QO8A 1XEXB 4URZR 3UA4A 2AOWA 5FPTA 2X1VA 1M1YA 2BEVB 2IYTA 4KFRA 2OLKA 3KXIA 3K2EA 3QE9Y 4QU8A 1DXHA 4BUZA 5EE3A 3GPCA 2C31A 4KQIA 5L7TA 2N1MA 1YDHA 1ESMA 5BNWA 3S8YA 1JIXA 3U9LA 3RODA 2Z6QA 2GZDA 4LK2A 1L4NA 3GC6A 3G5LA 3M6IA 4KO3S 3L9WA 4BTEA 3EUEA 4LDJA 1FFCA 2NU6B 4D99A 1XDWA 1CR4A 2JAQA 4XA8A 4Z0PA 4GS5A 2ZI9A 2Q2VA 1GAJA 2GO1A 1T0JB 3KJHA 4NRDA 2W2KA 4IDAA 4Q4HA 5I4IA 1JTEA 3IHWA 4RPKA 2X1HA 1ORWA 1A0OA 1EVKA 1B6RA 4JC5A 4MGIR 3SC2A 3WWZA 2ES4A 3ZWMA 3V3TA 5EJ9A 4ZAFA 1JYSA 1ZFNA 1VA4A 4I4TF 4QBGB 1H4VB 2QY9A 3ZD8A 1SBTA 2Z08A 2O7VA 3G49A 3F1KA 1FU4A 2IQ5A 3GEHA 3NJ4A 5F4ZA 3WA6A 1HUQA 2RG7A 3VVMA 4BMOB 1UKZA 1CSEE 1F9EA 1AQ6A 3L8DA 2O0HA 3LL4A 4WEQA 7ABPA 1EFVA 1B26A 2W8BA 2WABA 1FBNA 3OIFA 2PX6A 1DJMA 1XQYA 2VHWA 1XVIA 3VR6H 4Q7MB 2UZ1A 5DYGA 4MV5A 4DG8A 1FJGB 2XNHA 4MP3A 2GAJA 1WOMA 2G04A 2ZDHA 1BE0A 3RU2A 3FHCB 3ICPA 5EWJB 1S2MA 2G82A 3IVMA 3RIMA 3TRKA 3BKWA 4PX9A 3L0BA 5C8YA 2CVOA 5LXTB 3JYNA 5CT5A 3QMVA 2C0PA 2V3VA 3AJAA 4NMHA 1QC5A 1EEHA 2ZBGA 4RADA 2I6TA 2PJRA 1Z0SA 1J97A 5A4AA 1PNQA 4H59A 3ZEIA 1VYUA 3ZDEA 1YJ8A 2GZSA 5JNLA 3PFFA 1ZVVA 5C35A 4CXMA 2A86A 1BS2A 3C7CB 3CTMA 4MYRA 1PBNA 2B4RO 3A36A 2C03A 2XYQA 1BGXT 1GLVA 3QELA 3GMSA 1W29A 2I8LA 2XB6A 5ECGC 4BV8A 4TSRA 4TTSA 1AF4A 1I30A 1C7FA 4AX4A 1HXHA 2EJUA 5D5HA 5FF9A 2YWJA 4ZOCA 3WWPA 1KDOA 4M76B 2NP7A 3CUEF 2XT0A 3WXMA 2A5YB 1YA8A 2O2IA 2R00A 2OFWA 4ZKDA 3NHZA 4LOHA 4D8YA 5C8DA 5EFZA 1N57A 1P6QA 1NXOA 4GI2A 2CNOA 2WSYB 3SDBA 3OJLA 5IP5A 3TTUA 1YC5A 2PGNA 4QVGA 2PQ0A 3PI6A 3LY7A 1EK1A 1UKVY 1HQCA 3ITKA 5TQ2B 5KX5A 3KHSA 4LNHA 4DABA 3MS2A 5BR7A 2WB2A 5ALQA 1U3GA 3C6YA 3K8YA 4G6ZA 4U0JA 3R6TA 5HEKA 4ZMRA 4XYLA 2J08A 3P4UA 1Q7RA 2OCDA 3A3NA 4QGFA 1HNWB 1N2CA 2ZRGA 5D86A 2Y6VA 3ZWYA 4OQYA 1QZZA 3GEEA 4KPUB 4U7FA 5FFMA 3L5KA 4D97A 3A6JA 2KPOA 4G2NA 4CG2A 4M1TA 1NLUA 1NNSA 2IVZA 4D26A 4KXFB 4MMXB 2CVPA 4OYHA 1L8AA 4F11A 2IYQA 4C6HA 4DKXA 2MINA 3TSOA 1U5CA 2VP6A 3O3NB 2COUA 3FB1A 1VMIA 3IT3A 5MHTA 2VWQA 3BHMA 4LJRA 4NDZA 3GLGE 1C0IA 2VSNA 1E2KA 1O96B 3C3AA 1G4HA 2B9VA 4NX2A 1ZY2A 4MV4A 3F4KA 4NCKA 1IOWA 1LK7A 3OUZA 5BV8A 2IXGA 1SELA 2KS6A 3HI4A 4L5BA 3SFZA 2HQRA 3OLVA 3T5PA 3JQGB 1SMKA 3K5IA 1OBOA 2PH1A 5CYPA 4YPFA 5H16A 5B6JA 2QMUA 4J0EA 5HKKD 2VHYA 2W48A 2I4LA 4HAWA 5FL3A 5FDFA 4OF4A 4B43A 5JV5A 3VGJA 4QGAA 3DKPA 3IGFA 5KYVA 1CS0A 1KI6A 2O8CA 1BWQA 5AM2A 1OV4A 4OHFA 2CE2X 1LCIA 3LW8A 1UBCA 5TNXA 1VDMA 2AYXA 5IRCD 1QDEA 1AN0A 1XTTA 4H3VA 4KP7A 2B35A 3UV6A 1JF8A 3AI3A 5LB4A 2AFVA 4BNFA 2EL9A 4Q3OA 4AJKA 1JAZA 1GL6A 4N82A 1GUAA 5HNKA 3K8QA 4GPTA 1QH8B 3HHEA 1XV5A 5DYTA 3K31A 1M66A 1RZRA 4HGQA 3EMVA 4KXNA 1HQYE 4EKEA 1Q3HA 1N3BA 1GSHA 3DBHB 1DOAA 3HJNA 1UBGA 1Z7GA 3P9RA 2EP7A 3EVAA 3Q9NA 4RJIA 4DV2B 3QYFA 4I2NA 3JQFA 4EK9A 1JLMA 4H7HA 5KYXB 3U61B 2D3WA 3HL0A 3PEEA 4DUZB 4IGAA 2XQJA 3LT2A 4WESB 2QN2A 2ST1A 3MCAA 3GLSA 4PLWA 2GTHA 1T2UA 4AG5A 1A8PA 2JA1A 5JSZA 4FMDB 2IXEA 2R6HA 1QYXA 1T2DA 3IESA 3CH6A 4L6IA 3ODGA 2OWEA 4R05A 5DISB 2Q1UA 3P2IA 1UBMS 3I8XA 2YKGA 3ROXA 3THXB 2F1RA 5BN5A 3M4NA 1NVGA 2G77B 2R751 2WHXA 3HUDA 1P80A 2R7AA 3QE2A 3QPUA 2YJGA 2OVBA 5AKZA 2GFHA 2OLEA 3CNQS 4W8OA 5KBYA 4OJYA 4CCSA 4DQVA 3NATA 4LI0A 3GLGA 4Y2VA 4WA7A 6GPBA 3E9EA 5J2TA 1YB4A 3IJEB 4PZ9A 4QLBA 4FC6A 3KEQA 4O2RA 1TC2A 3KJXA 3I92A 3AUAA 3CRZA 3ESCA 5J5VA 1XTSA 3KRTA 3MIZA 4QAJA 2N75A 5K4AA 3JPWA 4O4LA 2G9NA 2J0VA 1II8B 2MSCB 4DLBA 2WZDA 4RHUA 1VI5A 1NI3A 2E4WA 1I6KA 1QHNA 2Q07A 3FPBA 4MWGA 3TH5A 2CLHB 4QXRA 4U2GA 2G1JA 5L3ZA 3QVGB 1E1CB 4RVGA 1K7EB 2OXRA 2QN7A 4JD5A 9LDTA 5KVAA 4X92A 4CV3A 1KY4A 2LCQA 3C0KA 4AUEA 4FJ1A 4TRJA 3RVBA 2WHQA 3AINA 2VTBA 4C43A 3H2YA 5M7EA 4F04A 2OO5A 1X39A 1XXLA 2B92A 1E7WA 4PS1A 5LBTA 3TRHA 3VHQA 2YW2A 5ITZB 3ZI7A 1N8TA 4KLAA 1AO0A 1W6RA 2I03A 3M1LA 2C5BA 3GZ4A 5BN3B 5E2BA 1Q74A 3EW9A 1PUJA 2OECA 1GSOA 2YW9A 3BHJA 5FNVB 5EMMA 3WYAA 4YP7A 4P86A 4EKGA 4EY3A 1MJ5A 1OPRA 1QLWA 3UF0A 4BGIA 4QX6A 2JG3A 2JLXA 4U2KA 5KJ1A 3DXZA 1B41A 1JQAA 1E4YA 1XMXA 5JSFA 3J7AC 2PKRA 1I5EA 1PO7A 4DMUB 1N0HA 4D0NA 1YHNA 4L5CA 4Q9AA 1CJSA 1N5DA 1FNDA 2FMXA 2Y0EA 4S1PA 3JQPA 3OU2A 3CRVA 3QWAA 1RACA 2RC6A 4Y9SA 5DM0A 3ZHTA 1ECGA 4ZHQA 1EFDN 1WLSA 3MS4A 1F2TA 2NSYA 1N4DA 1X8JA 2HCTA 2WUWE 2XIJA 4FIZA 4J4TA 3ZGVA 4P33A 1GRRA 1Z2EA 5F5XA 2LW7A 1BA3A 4MDEA 5A4MS 3RDPA 3PHHA 2WE8A 4L08A 1SXJA 1FIUA 3WWEA 1JX6A 4PZUA 1MORA 3TGPA 1GL3A 4OXRA 3Q8KA 2FSGA 3OVMA 4MZXA 1PLLA 5ALIA 5H0IA 2A92A 5I7RA 3ZJ5A 4YYEA 3USZA 5CGQB 5TSDA 1CRZA 3JQBC 2QM7A 2UYGA 4WN9B 2HM7A 1DKNA 4DV6B 4R1SA 2XXBA 3TKLA 4DUGA 2J3LA 4A23A 4B1FA 3SYKA 3FPFA 1DDIA 1JEDA 3SHVA 4OSOA 4Z4IA 4HDKB 3HP4A 4RO0A 3U9SA 4XVCA 4YRIA 4R8KA 5LP6B 1IXSB 2Q49A 4KIGA 3AVPA 4P7FA 1TXGA 3SAJA 3N8IA 3WRWA 3EVNA 5D51S 5HGJA 5COBA 3IFSA 4KU4A 3PJGA 3WSTA 5JJBA 4M0PA 1QAMA 1C1XB 2B1IA 4KQKA 2JJQA 1F6BA 3TQCA 4C6RA 4FOOA 1DAEA 4CPDA 3ACCA 3AFMA 2LD4A 1Z35A 3A6DA 2R6ZA 2YR0A 3JRXA 3PD0A 5I7FA 2ZM6B 4ITRC 1YK1A 3ASVA 1QGZA 2EBWA 1JQ5A 1U8ZA 1FP4A 4GPD1 3IX7A 1MKYA 3I5AA 2AS0A 1D2MA 1KFEB 1IM5A 2IF0A 3ENKA 3MWGA 2YN2A 4UHCA 2BUBA 1V5IA 3IP6A 3HCDA 2WRZA 1L4UA 1EJ0A 1X38A 2XE8A 3AHFA 5CFZA 1GRQA 3UAGA 3AUKA 4ARZA 4B6OA 5I7OA 3WBKA 1MHTA 3V1TC 4FS8A 1PJLA 4L5IA 1F1BA 1B8VA 3KEGA 5DW0A 2PMFA 1RQ7A 3OC0A 2HUNA 2ZRMA 1SQ6A 1LI4A 3DA8A 4TQAA 4X97A 3RVJA 3UFXB 1H2HA 1Z4QA 3EPLA 3BFXA 4E21A 3GJYA 1GZDA 1YB2A 4P92A 5EHQA 5IULC 4UC0A 5BYKA 4Q7LA 3G2MA 2NU8B 1D6SA 1KSJA 3KSDO 4PRLA 4GMDA 4WXPA 3V4FA 4DL9A 4KPYA 2UUOA 1I6LA 1VMEA 4G8DA 4CMKA 5EA2A 3ZHQA 1JEYB 1GFSA 1XR3A 4OTZA 1YVEI 2IQIA 3EDRA 4PSDA 2OFXA 4PYOA 4U7WA 4Y2QA 3R7AA 1YL7A 4GH5A 4CIBA 3DWIA 5HHTA 4JFAA 4KWTA 5FX2A 1YQGA 2BMDA 3OQNA 3QU2A 3RUDA 3TCNA 3RFFA 1DWPA 3DZBA 4KIFA 2A1TR 2HRCA 1CWUA 3TZ6A 2ODPA 2X42A 1V6CA 4JJ7A 2OGWA 2EATA 1WOYA 5IW8A 4XJTA 2D7CA 4BNJA 5KNLA 5KPJA 3K9GA 4RY2A 4NEQA 1FXSA 3Q3CA 3X1MA 3BHIA 3JATA 4GXQA 3LX4A 2R4QA 4KWHA 1W4AA 3E1SA 3SG0A 3VBCA 1GGVA 1PJRA 3RRYA 4DSZA 4ENWA 2IH2A 4G0VA 2H63A 4K3UA 4WDQA 1Z8FA 3FGNA 4K2HA 1OX5A 1IG0A 1FP7A 1DP4A 4U00A 4B7AA 3STHA 1KTIA 1CY6A 1HRDA 3BGDA 1E0KA 3RSQA 2PH5A 3PYMA 1QWSA 3L8CA 4GHWA 5IZCC 1EP1B 1QANA 1WRBA 4JC8A 1ZG3A 2YVQA 5E9WA 5CGZA 1KKUA 1JG3A 4KQ6A 2W43A 3H7AA 4U2CA 3TI7A 1FYEA 1SKMA 1GGMA 2H4ZA 1I32A 3RSCA 5CBPA 2QSUA 3HFGA 1YH3A 4TN1A 2P2LA 4JP3A 4N18A 3HN6A 4A8PA 1KI4A 3ER8A 2P9BA 1W5TA 3I37X 5BYBA 2Z6UA 2PBZA 2HDHA 3MGKA 3SJAA 4MKIA 1N7HA 2P6PA 4Q3DA 3ZH2A 2H9IA 1JHXA 4BNKA 6YASA 2W2LD 5I4KA 5G0WA 3PC8C 2HLDA 4GYWA 3QZUA 1E6UA 3L7DA 4TKZA 4UHKA 3U9TA 8OHMA 2QU7A 4G01B 2OXIA 3LQ1A 1J39A 4DLSA 2AI3A 2GK6A 4KRXA 1XMIA 1SEVA 1U2RA 4V24A 1I2CA 1XKTA 3RJMA 4J3FA 4EJ2A 1XWIA 2WFAA 1NKVA 1E2UA 4CKXA 4DR2B 4TSFA 1PHRA 1HDEA 1WIWA 2BGIA 1GKUB 4ZU3A 1OY1A 4YCCA 1ZRNA 2E37A 4KL8S 5J2UA 1M6HA 3QPDA 4RWZA 1I4LD 4BBJA 3AL0C 2D5BA 1ZQ9A 4LJKA 3HR8A 1XCLA 1VLLA 2XXJA 2H2IA 5K3AA 4EW2A 5JVDB 1Z0DA 1E1QA 5KDLA 4F97A 3ZLUA 1H9BA 2BW0A 3ZJUA 1POXA 3CRMA 3OPNA 1Q17A 1J90A 1S01A 1ZN2A 2D5CA 3D6JA 3EAGA 3H0CA 3LKBA 1TRKA 3I5UA 3NAMA 3QFRA 4ZU1X 4R5MA 4TYWA 2X0KA 3K94A 4NI5A 1OXSC 4EYKA 5LU8A 2QUJA 2QX6A 3T38A 7YASA 5KQLA 3FNIA 4QGGA 2A9PA 4UTXA 1RYNA 1TEZA 5DTMA 2IXDA 1L5GB 3PDUA 4B2YA 4OLBA 1HFJA 5FYDA 1P19A 1TI7A 4ZT6A 2ZRFA 4O8ZA 4B6EA 3KTFA 4P38A 5HIIA 3PDCA 1JXOA 1QTQA 4I81A 1N6KA 1CIJA 1GDTA 1AVTA 2YJTD 3N2YA 3DKKA 3PEFA 1PYGA 4OXXA 4WOKA 4DQUA 3SI7A 1UJ4A 4UFOA 2WLSA 4DNOA 4C7OB 2ZTSA 2Y6UA 2O52A 4RFSA 4G5FA 4JT4A 2II6A 2DFLA 1OMOA 5D6NA 4CMAA 4TWRA 5BVHB 5CG2A 2IXFA 3WLLA 5IJ0A 3DAHA 3HC7A 1DAFA 4U1RA 3D5EA 2F43B 2AG8A 3VSEA 1QVWA 2QL5A 1Z47A 2CW5A 2VOJA 4HDMB 4JJGA 4ED9A 3GN2A 3PRHA 1QAQA 5EPOA 1FTSA 1TMOA 4UVGA 3G0CA 3T7TA 1DIHA 2ZRJA 1QOPB 1Z62A 2C4HA 2GHQA 4Z0NA 5KQGA 1U2PA 4WLEA 3Q3EA 2VHZA 4FMCF 2IEBA 3A9UA 2JLAA 4GW3A 3QSYA 5BYAA 3D6UA 5HG0A 5BN4B 4CMEA 4R7TA 5LJIA 2PPLA 3KC2A 2WJPA 1C7JA 2VP3A 2ZI6A 1UBJS 4OXKA 5FPKA 2J5KA 4RL4A 3U4CA 4AJEA 2CD7A 2DQZA 5IDYA 1C9DB 1YRLA 2WINI 4B85A 4LF8B 5DEIA 3H9BA 2EWMA 3NHSA 3QKSA 1E5VA 3EPRA 2QSYA 3F71A 2BBTA 4M87A 4N40A 2V7VA 4HPJB 4A6PA 3T4UA 4AKIA 2A58A 3UMRA 3BWXA 5AHWA 2XSZA 1N2SA 5KPDA 1G2IA 2DPLA 4BX8A 3SNKA 1RJEA 4MYSA 5DHQA 1O95A 1ULSA 1SOUA 1V45E 3WYEA 1L7MA 4KAFA 1I33A 3HMKA 1SBYA 5MF6A 3OLWA 1T9HA 5IT4A 4BNWA 3A9RA 4GM1A 1MH1A 1P1RA 4CL3A 5JD6A 4PNZA 4LVOA 2OOSA 2V59A 2Z4RA 3N86A 4ETNA 4KXVA 4BEBA 4DJ5X 1J8DA 1ODLA 3C1AA 3CM0A 3AVTA 1AD2A 3KQVA 1QHEA 2BFNA 5DHUA 2VHXA 5ALOA 2Y67A 1FMLA 3LUBA 1D3AA 1ZM4A 3RARA 3ZU3A 3UH1A 2JI9A 3H5OA 3N0RA 2XDQA 1KI8A 3FM9A 5HKLA 5A6VA 4C7VA 4MQLA 2IL1A 1Y7TA 5AYVA 2HREA 1VHWA 3GFTA 4MA4A 3CSUA 2IIPA 1SKYE 4PAOA 4C87A 4KR6A 1JR3E 3K0FB 4H7FA 2LRHA 4XAQA 4IMJB 4JXZA 4H4EA 4I9FA 2IWHA 3O1JC 1KO7A 1PT6A 1SKQA 1IN7A 4QSHA 1JT9A 3IOCA 4G0OA 4G5RA 3T7SA 2IX9A 4EL0A 3I34X 4W9MC 3NHMA 2M1ZA 4I3HA 3D5QA 3ROGA 3FR7A 5B1IA 5AQ1A 4Z9FA 1DINA 2YOGA 3IUSA 3QXHA 5J4YA 4YT8A 2YOHA 5BN1A 5CCBA 1FRVA 2VF8A 4HADA 3L8HA 3T99A 1O6FA 4EUEA 1NX6A 3LLSA 4KLNA 5KVSA 1B4DA 4FGUA 4QIHA 3FSEA 1Y1KE 3AKYA 4N9WA 4TWJA 3GR6A 1JZTA 4YT5A 2OYRA 3FH0A 3UANA 4EHHA 1B8UA 3I3OA 2FSVC 4B84A 4F7WA 3Q7IA 4FQ8A 1NXTA 3C85A 3DGFC 3V42A 3WNZA 2WNHA 2ZJ5A 4ZIRA 3ZCPA 3LY9A 1ZLYA 4O1HA 1Z39A 3R6DA 2R6JA 3U40A 5KC9A 3T06B 4EPWA 3MW8A 1Y3BE 5BSRA 2P3LA 5JRJA 2IPOA 3RS7A 1EQUA 2JGDB 1NRXA 3C4VA 4BEJA 2HSEA 1VG9B 3IUBA 5A0TA 4XRGA 1IONA 1XTKA 4OQZA 3L41A 3EOZA 1PVOA 4FFWA 5AM5A 2OYSA 1JHZA 2BTQA 3ZE1B 1OREA 1Z6GA 4OHKA 3D6MA 2AMFA 1CZHA 4BB0A 3PD7A 1G2OA 5JEEA 1UZNA 2A59A 2FZVA 2FFBA 2KW5A 4PBRA 1IIRA 3TE6A 1NYQA 2NUPB 2XZTA 2PD3A 1ADFA 2QVZX 4OAQA 1UXKA 5G4KA 1P4HA 2GUWA 1IZ0A 2SKEA 2BFBB 1UR5A 2YYAA 3TQOA 3ZOKA 1KMIY 4X90A 1HTBA 2EJVA 4U39A 4DAEA 4Y6PA 2QYTA 3VZRA 2H2HA 1V1MB 4BMSA 2HRDA 5BOSB 4QUAA 4CHTA 3GFBA 1SUIA 5ANRB 4E6PA 2FDCA 1OAOA 2CYAA 1ZK4A 1RHMA 1Z6ZA 1JQ3A 1E58A 4WK6A 3MFQA 4AJNA 3F3SA 2PSFA 1YZGA 2Y77A 3KL2A 3Q9SA 4H4DA 2J31A 1QNLA 4CDGA 4K26A 1R5JA 3T95A 3PDWA 4EJSB 4AJOA 5C5EA 1H2ZA 4P4UA 5KREA 4DB2A 1H2BA 4YCNA 2ZPAA 3L06A 1UEJA 3BSWA 1J2UA 2XDYA 5KOJB 3IMEA 4JUBA 5AW8A 3U0VA 1SU7A 5JW6A 3LXUX 5IASA 3S1LA 5KYYB 3H3JA 2B36A 3JQQA 3PNVA 2B94A 3EXEB 3H17A 1NASA 1QYCA 2DTDA 1CVRA 4YI5A 5E7IA 1M8GA 2RI0A 3OT1A 4WZBE 4RBNA 2JFWA 1Y3CE 1WZEA 3HFJA 4JOBA 4Y6LA 3FOFC 5CT6A 1TX4B 5AO9A 1MEEA 1OF1A 4V0KA 2WJAA 2F67A 4RZXA 5T8KC 1W4LA 1WNFA 4IIVA 2BJWA 5AKLA 2AMYA 3TPFA 3ZS8A 2W2NA 4BLUA 1MZPA 2ZG6A 1S8AA 2DSTA 1NY6A 2Q28A 1DQRA 2VJYA 2I7CA 1U0JA 4EBBA 2XKKA 5AVUA 3MSXA 1QP0A 1HG1A 3CRW1 3RHSA 4F0JA 1VBFA 2JNWA 4ZEVA 4HNUA 1H4SA 1P9WA 3SLKA 3ZNNA 4KREA 4N0PA 1GZ7A