2DPMA

Dpnm dna adenine methyltransferase from streptoccocus pneumoniae complexed with s-adenosylmethionine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
275
structure length
258
Chain Sequence
TLQPFTKWTGGKRQLLPVIRELIPKTYNRYFEPFVGGGALFFDLAPKDAVINDFNAELINCYQQIKDNPQELIEILKVHQEYNSKEYYLDLRSADRDERIDMMSEVQRAARILYMLRVNFNGLYRVNSKNQFNVPYGRYKNPKIVDEELISAISVYINNNQLEIKVGDFEKAIVDVRTGDFVYFDPPYIPLFTSYTHEGFSFADQVRLRDAFKRLSDTGAYVMLSNSSSALVEELYKDFNIHYVEGKISEIIVTNYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ADENINE-SPECIFIC METHYLTRANSFERASE DPNII 1)
publication title Crystal structure of the DpnM DNA adenine methyltransferase from the DpnII restriction system of streptococcus pneumoniae bound to S-adenosylmethionine.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 89
structure length 258
sequence length 275
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 1998-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 2dpmA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2dpmA01
3LBFA 5FQNA 2HTEA 2JHPA 2O0LA 3AXTA 3KQTA 3P2EA 3KPJA 4YV1A 5ERGB 4CTKA 4GC9A 1VL5A 1KIAA 1H1DA 1RI3A 3O4FA 5E1DA 3I64A 1NW8A 3CCFA 4AX8A 4C4AA 3BWMA 1JSZA 1UWVA 3FRHA 1P1BA 3MGGA 1XDUA 3MTIA 1F38A 2BZGA 1JG3A 4HSGA 4PYNA 2DULA 3GCZA 3T0IA 5D1NA 5HIKA 3NTVA 1XTPA 4P7FA 5T6BA 3G88A 1M6EX 2CKDA 1MHTA 3BT7A 1WZNA 1M6YA 2VZ9A 2ZFUA 3REOA 3H2BA 1D2GA 3BWCA 5DRTA 2OO3A 3CJRA 3FPEA 2AR0A 2ZIFA 3FUXA 2XVAA 2HWKA 3R24A 4FR0A 3CGGA 1FP2A 3CJTA 4PINA 5DTMA 2Y1WA 3P9NA 1R8YA 2GA9A 3RIEA 4PONA 4H0NA 5GWXA 4EQZA 3GWZA 3EPPA 2JG3A 4DZRA 4KIGA 3D2LA 5DXAA 4A6DA 2Z6QA 4AUKA 4ER5A 3GNLA 4PYOA 3M4XA 3TM4A 1BC5A 1YB2A 4MIKA 4OQEA 3QOWA 2PX5A 5DM0A 2NXNA 5E2BA 3B3GA 3F4KA 4EKGA 4M37A 5HOQA 5ICFA 2QY6A 4RTJA 2O57A 1BOOA 5MHTA 4BP3A 1WXXA 4KVZA 1WXWA 1VP9A 4IKPA 4QTUB 5P8WA 3E23A 4GF5A 3UJBA 4PYKA 3NJRA 3FYDA 4F86A 4POOA 3KR9A 3LX6A 5CD1A 2PXCA 5F2NA 3EVEA 2CWWA 1HNNA 3C3YA 5CVEA 3UWPA 3B5IA 1NBIA 1TW3A 4M36A 3P9IA 2G72A 2PX2A 3PT9A 3I5UA 2YXDA 4HG2A 4CXMA 2ZW9A 2YQZA 2G1PA 1I1NA 3NW9A 5E8JA 4PIMA 2IIPA 3A4TA 2ZCJA 3P97A 4QPNA 4GBED 3GJYA 3OPNA 4FT4A 1MJFA 2I9KA 2IH5A 2ZZMA 3M6WA 3ER9A 4E2WA 1JG1A 2IPXA 1YUBA 3LSTA 2ZBQA 2OXTA 3C3PA 3TLJA 5E9JA 3U81A 2GPYA 4FT2A 2UYHA 3IHTA 1ZGJA 3OU7A 3CBGA 4MTLA 3FYCA 4OBWA 3SGLA 2UYCA 2EJTA 3BXOA 4RTKA 3M70A 3MERA 3FUTA 1VBFA 2IFTA 2IH2A 5KQSA 2I62A 4PCAA 1L3IA 3HVIA 1SG9A 1BHJA 2AVNA 3BGDA 4OBXA 5FWDA 3GRRA 1R8XA 3DLCA 3B3FA 3EVGA 2PT9A 5E8RA 1FBNA 3PFGA 5D1HA 4RTRA 2VP3A 2ZWAA 2PV0A 3LCUA 4C07A 3NVKI 3GGDA 2OZVA 1NKVA 1Q0TA 4Y30A 3C0KA 3GRUA 5CUQA 2IDKA 3PX3A 5DXJA 1SQGA 4MHTA 3FRIA 5LR6A 1G8AA 4YUWA 3WSTA 2PLWA 1NW3A 2EX4A 4PYLA 3A7DA 1EAMA 3FPHA 2PVCA 4U7TB 5HIMA 3LHDA 3HCAA 3MCZA 4E33A 4ER0A 3FPFA 1R00A 5T64A 4PYMA 3UJAA 3LCVB 5G02A 2V74B 2NYUA 4X1OA 5K0FA 5EEHA 2WA1A 3IV6A 3FTDA 4FZVA 3KU1A 5LQUA 1SQFA 3I58A 1G8SA 3NWBA 4PWYA 1XVAA 3KPYA 1EQAA 4WVLA 3JWGA 3S68A 1AQIA 5EMKA 1KP9A 3PB3A 4LECA 4GOND 2B25A 2C7PA 2B2CA 1P39A 4E2YA 1ZG3A 4YUVA 2XYVA 4Z2YA 5DRYA 3DP7A 1JG2A 1VPTA 2P40A 2AN3A 2QRVA 1JTEA 5CVUA 4HTFA 2F8LA 2PXAA 4BLVA 4BLUA 5E9QA 4RV9A 5F2OA 1IXKA 3PX2A 4RTMA 3TQSA 5DM4A 3V97A 2YTZA 2AOWA 2BR4A 3DMFA 3LDGA 5HEKA 1VP3A 5JUWA 8MHTA 1YFLA 4O29A 4DA4A 3SSOA 1F3LA 2R3SA 3ORHA 1JG4A 3SVZA 4RTSA 3DR5A 4PYQA 2JH8A 3CC8A 5E9WA 2AZTA 2PSSA 4QQKA 4RTNA 1L1EA 2P41A 3KQPA 2YXLA 3LKDA 2UZ4A 4CKBA 3DXXA 2AN5A 2FHPA 1VLMA 5C0OE 1AF7A 1KPHA 1WS6A 4OQDA 5HIJA 1D2CA 1I4WA 2NXCA 3M6VA 3ELWA 5FWAA 5M5BA 2EJUA 3A26A 2P7IA 4RVFA 3UJ7A 2FYTA 4HC4A 4QDKA 1QAOA 3LDFA 4CTJA 2C7OA 2YVLA 2OBFA 2AOTA 3V8VA 5KS2A 4F85A 2O07A 5EMJA 4RTLA 3OFJA 2AOUA 2FRXA 3E8SA 2PX4A 3K6RA 4ER3A 2ADMA 3B3JA 3KQOA 3LCCA 4QVKA 4C06A 1NW6A 3OE4A 1KYWA 1JSXA 1ZGAA 2G70A 1NV9A 5T67A 4KWCA 3VYWA 2PGXA 4R05A 3G8AA 1KYZA 5DSTA 2IGTA 5BW5A 5K0GA 1R6AA 3M6XA 5F2KA 2Q41A 5FULA 4ATNA 4EMSA 4IWNA 1X1CA 2B9EA 4ISCA 3MB5A 3E05A 3GU3A 5EC8A 5LQJA 4GUAA 3TOSA 3T7RA 3HVKA 4AZSA 2QRVB 3SSNA 3FTCA 5LQAA 4RYLA 2C7QA 3HM2A 3OZSA 4QPPA 4XUEA 1PJZA 3TKYA 3KQYA 1VQ1A 2AOXA 2P35A 4LWPA 5LQKA 3TM5A 4YUZA 4PYJA 2EG5A 2P3QA 1L9KA 3Q87B 2NP6A 1N7JA 3X0DA 5FA8A 2B78A 4EKIA 3EVFA 1YZHA 5FCDA 2IH4A 4P7JA 3UZUA 5BP7A 3MQ2A 5KQRA 3OCJA 5CIYA 5EHGA 2QE6A 3G5TA 4CKEA 3NWEA 3AWIA 4E2ZA 3LBYA 3E7PA 4GC5A 1NT2A 2PXXA 4KDCA 2BH2A 1EG2A 2E5WA 1N7IA 4M38A 1UIRA 2YXEA 3T7SA 4ZTBA 2B3TA 2OB2A 2QYOA 3EVBA 3T7TA 4E30A 3JWIA 1RJGA 1O9HA 3M33A 7MHTA 3KHKA 3EVAA 2V7EA 2XYQA 3OZRA 4QDJA 2CMGA 5CVJA 3GDHA 5EEGA 1D2HA 2AOTB 4YMGA 3KR2A 2YX1A 3LL7A 4XUCA 5ICGA 2NXEA 1WY7A 5EMLA 5HZMA 1R74A 3SR4A 2GLUA 5K05A 3VC1A 3EGEA 2N47A 1RI1A 3ELYA 3BWYA 4PYIA 4RVDA 1ORHA 4DF3A 3P2IA 2DPMA 1O54A 1RJDA 3KR0A 4A6EA 4U7PB 3HA7A 4PGGA 3RW9A 3UJCA 2FCAA 4DM3A 1PRYA 5DTRA 3HCBA 1KR5A 1ZKDA 1INLA 3G7UA 3JWHA 2AN4A 4FP9A 4P58A 5E1MA 3ID6C 3P2KA 4YMHA 2PKWA 3FUVA 3C6KA 1YFJA 2R6ZA 3OU2A 3HCEA 2PJDA 4R6WA 3CVOA 3HA3A 5CCBA 2OB1A 4YUYA 1XCJA 4KDRA 1NW7A 3HTXA 1RJFA 3NVMB 2BM9A 3KR1A 2OY0A 2PX8A 1NE2A 3EGVA 3KQVA 2AVDA 3R0QA 3G2QA 3G5LA 3KKZA 1NBHA 4V0QA 5DX0A 2ERCA 4V0RA 2ESRA 1QAMA 4RVHA 3THSA 2C7RA 1VIDA 3M6UA 4HGZA 3BGIA 4JXJA 1X19A 1NW5A 5DM2A 4E2XA 1G55A 4GOLD 4NECA 3GIWA 3UJ8A 5DM1A 3TPZA 3IYLW 5BXYA 3KQSA 5EG5A 1DCTA 5EZQA 2VDWA 5EIFA 5DX8A 2IBTA 2UYQA 2CL5A 4X61A 5BW4A 2FK8A 2UYOA 3MHTA 3THRA 2I7CA 2K4MA 3ER8A 3BGVA 4G56A 1T43A 5EKXA 2Y1XA 3HEMA 1YZ3A 2NNWB 3AJDA 3DLIA 3Q7EA 4KIFA 5EKUA 1KPGA 5FTWA 5K0NA 3HCDA 1X1AA 3LGAA 3ELUA 3PLAE 4EVIA 2PWPA 5FQOA 2QM3A 4RTOA 4MQ4A 4BP1A 2PT6A 3EEOA 3R6TA 2HV9A 1EJ0A 4BLWA 2AOUB 2ZBPA 1O9GA 4RX1A 3MAGA 4RVGA 3UJ6A 1B42A 2IP2A 4MWZA 2IBSA 3QOXA 1XDSA 3P71T 2EFJA 2ORED 5EZSA 2LD4A 5DPMA 4AZTA 2JH9A 2P1DA 1V39A 2CMHA 2VDVE 3K0BA 4R8RA 5H02A 2VS1A 2PY6A 4C03A 5GP1A 4EK9A 1HMYA 1NV8A 1RI5A 3EVDA 3LPMA 1G6Q1 2KW5A 5LQRA 1EJ6A 2NXJA 4WXHA 4ER6A 3G89A 3AY0A 3G2PA 3G2MA 2NP7A 1QYRA 2A14A 2FK7A 3DMGA 3FZGA 3JWJA 1ZQ9A 2ZBRA 3OFKA 4XUDA 4E70A 4K6MA 4P7GA 4M7RA 4X63A 5K03A 3DOUA 1XDZA 2XVMA 3HVHA 3KQMA 3EGIA 4CKCA 3KPVA 3TMAA 4LG1A 9MHTA 2ZIGA 3BKXA 5CM2Z 4GOOD 3EVZA 4L7VA 2HNKA 1YF3A 3O7WA 5DWQA 4QQNA 3EMBA 4IV0A 3NDJA 2HMYB 2VDUE 2H00A 4X41A 5DT2A 5C9ZA 1JQ3A 2BR3A 2PWYA 1QZZA 3QV2A 5DX1A 3TKAA 3A7EA 4PGHA 2OKCA 3NDIA 4PCLA 1EIZA 5C1IA 3GRVA 1G60A 5ICEA 1JQEA 3DMHA 3ELDA 5EGSA 2P8JA 3LECA 4OA8A 3GRZA 4FSXA 1N2XA 3GRYA 5IH3A 1Z3CA 2G8NA 4DCGA 3NMUF 5DSXA 5K0LA 1VE3A 3BKWA 1RI4A 5DTQA 2GH1A 3MCTA 2ZZNA 5HILA 3TR6A 5K0CA 1OR8A 2GAFA 2ZSUA 3UFBA 1JQDA 1X1DA 3GO4A 2H1RA 3P9CA 2I6GA 2OYRA 3OZTA 4DKJA 5LQNA 3MTEA 1KPIA 3KQWA 4PNEA 3G2OA 1KXZA 4HRAA 4OX9Y 4DMGA 3B89A 3EVCA 4LWOA 4E32A 3LKZA 2ONYA 3SX0A 1QAQA 3DH0A 4OA5A 4RWZA 1AV6A 3HA5A 1KHHA 1I9GA 2BR5A 2JJQA 1FP1D 3BWBA 3VSEA 1IM8A 2YR0A 1X1BA 2XBMA 2OPBA 3A27A 5K0JA 4PIPA 2PBFA 5FHQA 3PTAA 1R18A 10MHA 5GOZA 3DXZA 5KVAA 4R8SA 5E1OA 1TPYA 4DCMA 4YUXA 1FPQA 3I9FA 2Z6UA 3HP7A 2JHAA 3GXOA 4FSDA 4B17A 4CWAA 1P1CA 3I53A 3KPUA 1AQJA 2ZZKA 3FTEA 5FUBA 3DULA 4GOMD 4KRGA 3R3HA 2WA2A 2ZLBA 1G38A 5K01A 5EVJA 5CCXA 3VC2A 4YV0A 1JR4A 3SSMA 4AZVA 2WK1A 2AS0A 1QANA 3UBTA 4BY9E 1L3BA 4HH4A 2HR1A 3EEYA 3AXSA 3FPJA 3FUUA 3UJDA 4Y2HA 5K09A 3FPGA 3FUWA 2H11A 3G8BA 3C6MA 2ZULA 2O05A 4KW7A 3ME5A 4DQ0A 4ER7A 5B1SA 1M0EA 4GEKA 5EHIA 2P3LA 3IEIA 3DUWA 1FJXA 3TRKA 4F84A 5K8VA 1UFKA 4QVGA 2BM8A 3EMDA 4RTQA 3HCFA 3UA3A 2Z6AA 4C04A 4IV8A 5FHRA 1P91A 3CKKA 5E1BA 1ORIA 3UJ9A 1SUSA 2ZWVA 3OE5A 3HVJA 1Q0SA 5E2AA 5EIWA 2ZVJA 5K0BA 3ERCA 3O31A 1DL5A 3RODA 4C08A 3R9XB 5U4XA 2IDJA 3DTNA 3OU6A 4RSRA 3CJQA 4X60A 4C05A 1DUSA 1JTFA 3B7PA 5GIPE 2JHCA 3DXYA 3KPWA 2P3OA 1U2ZA 5K0EA 1WG8A 3PVCA 5IKMA 2O06A 1BKYA 1TW2A 3P8ZA 4YV2A 2GS9A 4HTFB 3SMQA 5FADA 5FA5A 1ZHFA 1RI2A 4UOEA 3PFHA 2AOVA 3P9KA 1XCLA 5GM1A 3SXJA 4E31A 4XCXA 2P7HA 5LSAA 4GQBA 5CVVA 3HCCA 2FPOA 5ICCA 5GIOE 1SVUA 4FS8A 4FGZA 5EQJB 3A25A 5KYGA 5EPEA 1XXLA 2G71A 2XYRA 3TFWA 1IY9A 3BZBA 4AZWA 2ZIEA 5LQCA 3ANXA 3L8DA 3PS9A 2ZTHA 5EMMA 1L3CA 5JR3A 4HGYA 3SM3A 1XJ5A 3KQQA 3FTFA 4QTTB 4RTPA 3BUSA 3LDUA 5GM2A 5CVDA 5HFJA 3UA4A 5GINE 1SKMA 2ONZA 4R6XA 5HIIA 1Y8CA 4P7KA 2YUIA 5DLYA 3HNRA 5EOVA 1SUIA 2GB4A 1RJEA
chains in the Genus database with same CATH superfamily
3LBFA 4NATA 2JHPA 2ZE7A 1MIOA 4N7JA 4UNQA 1I4DD 4YV1A 3HZHA 1LVUA 3DCYA 5ARDA 2EBHX 2HD4A 1GVHA 1ZH6A 3O4FA 3TRFA 3Q9SA 3MHPA 4ZPJA 4CKWB 4GR4A 1VJGA 3IUMA 3UJPA 1HT2E 1XDUA 3PQCA 1EUCA 3KEQA 1DQZA 1RYYA 2WB4A 5G1PA 3RHFA 2G08A 1DBVO 3HDYA 3VJLA 1W4BA 1TQ4A 4K6KA 3SAJA 3BK7A 2QMQA 3CRQA 5EXTA 2BPOA 3G0DA 1FK8A 1AU9A 5L6LB 4I3GA 2VDKB 3UQZA 4XWYA 3NBMA 2GBLC 3O73A 5DRTA 1VM6A 5TGTA 4QRHA 1K88A 4B3MB 4E08A 3MJEA 4YP9A 3L4SO 3ZU3A 3VZQA 4A03A 2Q50A 3CN7A 4GZLA 2OXRA 3D4IA 1NVAA 2CFIA 2HFJA 3AMVA 4UMDA 3UUGA 3VFDA 4IIUA 4EQZA 4YT2A 4YBRA 4DUGA 4JJGA 4ZHQA 2FNAA 3E70C 2BUCA 2DY0A 5D3MB 3QPVA 5IJZA 1FUKA 3TM4A 1DWOA 4PYOA 4CDMA 3KEGA 3KZVA 1ECCA 1RAIA 1C14A 2F9LA 3IHKA 4WNCA 3F4KA 1TFUA 1QBKC 4M0MA 4B0OA 1UH5A 1DWQA 2W2LD 3A6GA 4L78A 3K3PA 3SHFA 5EXDA 3RGWS 3TIFA 3ULKA 1G2PA 5HRCA 2YXPX 3R7WA 3C85A 1JHQA 2G1KA 1AA6A 3M2TA 4F11A 2XW6A 1HM5A 4I55F 4LOIA 4JEMA 4GO1A 1DMSA 1N0HA 3PKZA 5FB3A 5I4IA 2A5JA 2YL2A 3M34A 2WAYA 4KWIA 3OT5A 5ITZA 2JIQA 3SZGA 1KMHB 2CXTA 1CNEA 1NM5A 4IRMA 4JBNA 2XCRB 2ZJ4A 2JLCA 4G8BA 4JR1A 4NENA 2B9VA 3HJTA 4ARZB 2DHDA 1OC4A 4CLXA 4L4YA 2DSTA 4JLWA 1SMKA 2H1IA 3PXGA 4D3FA 3K30A 4MVJP 2VRBA 4E13A 5FOTA 2O2SA 3KJIA 2V98A 2GEVA 3BDVA 3DLTA 2H5IA 4RQBA 3LSTA 3OH8A 4M89A 1HE1C 2Q3FA 4BBZA 4PLYA 4XIGS 4OHZA 3QVXA 2CD9A 3H75A 2FN4A 5L8VA 4BVFA 4A2WA 2CC2A 5E6RB 1N6RA 1MEOA 3FYCA 1JDSA 4OBWA 5AM2A 1FJGB 4X84A 2Y4OA 4CCYB 3M83A 2LW7A 4IFEA 2IV3A 2QLTA 2IH2A 4UNPA 2PUAA 1YU9A 3HVIA 1ISIA 1DCMA 1CNMA 1WABA 3GRRA 4BMXA 4OHBA 4BVEA 2B35A 4A36A 3I83A 1IIRA 1SUWA 2PT9A 2ZJ7A 3BBLA 4UTXA 4IVQA 3HM9A 3NEJA 1IDOA 4PQFA 1QC5A 1V95A 3U4GA 4C07A 3MD0A 1JEAA 3EF0A 1A2OA 1IN5A 3KKLA 3HCWA 3PX3A 4Y30A 3I4FA 3SYKA 2HMWA 4F3CA 1FYVA 1E6LA 1G8AA 3TSCA 3NX4A 1XCOA 4LDRA 1WKCA 3CNLA 2COEA 4IMIB 1T5DX 1OBFO 1NUUA 4S2EA 4Z7NB 4Z51A 4JQYA 4PRYA 3CRVA 4EGFA 5CFZA 4QRIA 2IOYA 4ZO6A 1V1JA 2GAIA 3R1IA 1R00A 3D4NA 4HXYA 4PYMA 3ZZUA 4PYRA 4MWGA 3KS9A 5JCXA 3WKAA 4I0WB 3TUZC 1XNQB 4E15A 3FTDA 2A9QA 2O4UX 2XD4A 4WEQA 1HYEA 3BEDA 4JIGA 1JAYA 1R0YA 1YAHA 3C87A 1ADGA 2BM1A 4M9XA 2CNOA 3RVMA 3T35A 3V7FA 1GPBA 2JGDA 2EIXA 2J32A 4EO4A 4WVFA 1TOAA 1G66A 4FHFA 2YXNA 2ZRDA 1YB5A 1GARA 1YRQA 5IS2A 1ONSA 4NOKA 1HX7A 3QU7A 3TQSA 5IVDA 2H2GA 3W2IA 3FDJA 4FB4A 3HPRA 5CX4A 3A10A 4NSNA 5HEKA 2QRPA 1GPAA 4HX2A 4AUMA 3JTMA 1FJ2A 2R3SA 4FEYA 5C32A 1NVVQ 2CK3A 4X8LA 3ZNNA 5DGCA 2VNHA 3E6AA 3IBFA 5ITZB 2P6RA 2NVUA 4DSAA 2PGAA 4FWIB 3T06B 1Z5WA 3ZDBA 4LJRA 3SDBA 3FBTA 1Q0PA 1EZZA 4TOIA 4OQDA 3WL6A 4OYRA 1VCOA 3N53A 1NQAO 4ZXFA 3EXHB 4HXGA 4BZZA 4P4TA 4QPDA 2R84A 3U4QA 2YWRA 1WHSB 1LU9A 1P8JA 1KOJA 3EXAA 1EXVA 3QE9Y 4ZC1A 3AM5A 4TL8A 4LRWA 3IV7A 4QX6A 4XCVA 3WJ7A 2WIGA 3C6BA 4GRAA 3B3JA 1ZFNA 4QDTA 1ZGAA 2NZXA 4TYPA 2XB9A 4AT1A 2ZEJA 5DI9A 2X77A 5K0GA 1PWHA 3VR4D 1N9KA 1T36B 2W2KB 1GP2A 3DKKA 4G63A 3MUOA 1CQIB 3RU9A 4BB5A 5JJLA 1IWPB 1N5OX 3N5CA 4X3PA 2OGTA 4K9LA 2WWYA 1L7AA 3FGZA 4HQOA 4AJLA 3VOTA 5LQAA 3T3NA 3INGA 3ZD7A 3L8MA 1JW9B 5H4HA 1EVJA 1RFLA 2WJGA 2XUDA 3AY6A 1C7JA 1C0LA 3FHCB 2YZMA 3BFVA 2VHUA 1DRJA 4XGQA 3TYXA 1Z4IA 3VR2D 3GLQA 3QEJA 3V8MA 5A3VA 5C35A 2D5CA 1BKDR 1QVZA 1QOPB 3E03A 4Q21A 1N2CE 5FA8A 3OG9A 2C92A 3Q8XB 5TQJA 1KC3A 2IZOA 2VJCA 3ROMA 3B36A 4IBOA 1ZCJA 4D74A 2ZXUA 1WB4A 5DTIA 5H3HA 3OCJA 2NO9A 2VYCA 3UOAB 1CUBA 4P5DA 3BYZA 4CKEA 2GXSA 3LO8A 2UZ4A 3B3AA 1EMDA 4FGKA 4GC5A 2XVZA 2BH2A 2G9QA 2Y92A 1NQTA 3USCS 5EHZA 4JLAA 4AS1A 1VFPA 2YXEA 4FC7A 1Z88A 3RYHA 4NWIA 4ZTBA 3T7KA 3T5CA 2AE1A 2XECA 1WSWA 2NYVA 4JI1B 3IE1A 1Z0DA 4AROA 2C8VA 3HV0A 3OJ0A 4JI0B 4QGAA 3VSDA 4E51A 1HZZA 4TQAA 4A15A 1PR9A 5K3CA 1GL3A 3GLHA 1EM6A 3JRWA 3RF6A 4IIDA 3SICE 2FN7A 2GLUA 2GOYA 4Q5IA 1FX0B 4CT5A 3ELYA 2O2IA 2BHLA 4P0PB 4NBKA 3I09A 4V2UA 3SFTA 1TRHA 4R16A 2DPMA 1LWNA 1PEAA 1RJDA 2AT1A 1CWUA 3NC0C 4QBFA 4QGSA 1ZR4A 4ZICA 6REQA 5IWAB 2ZAGA 2W6ID 5EJ9A 3CEMA 1NUPA 3I2HA 3HCBA 3JZFA 2Z6QA 2R4TA 1KYQA 3JCZA 3T61A 2NO7A 4EFMA 5BN3A 5HM6A 5AUNB 5I3ZA 2R6ZA 1W75A 4NEHB 3EY9A 4TX1A 3CVOA 2C78A 2AD5A 1XZCA 3CH6A 1U90A 2C59A 1RAGA 2CLIB 2QRQA 4HO1X 4N8DA 5CG2A 3L7OA 4JBLA 5CDSA 2W98A 3KR1A 3T3OA 2WSMA 2EYUA 5K6RA 1NFQA 1ODIA 1JHXA 3HUDA 1LZLA 1X70A 2A1UB 2RCNA 1ODKA 3OD1A 2FG5A 3OFND 4YDSA 1GNLA 4DN6A 2C9ZA 4JB8A 1RPAA 3LT2A 3ZLVA 1U3WA 2W00A 1R4MA 4XQ0A 1K9VF 4YRPA 1NW5A 2HHHB 2O6HA 3RS2A 3NKFA 1A4IA 1MAVA 4NECA 1B6TA 3QBTA 3GJQA 4TT3D 3TDMA 2AN9A 5C51B 3CNEA 4UUQA 1I4EB 3CVXA 5CH8A 4F4FA 1B00A 4AF7A 4FGSA 5PNTA 4EFKA 1C4KA 2FJPA 1IXRC 1L7RA 1JYSA 1RRCA 3F6SA 2Y93A 3IOMA 1WB5A 5AW1A 4EUEA 1YCFA 4F0JA 4W7IA 4HI0E 1ZCFA 2CYBA 3DSRA 1YMVA 1XLUA 2YYAA 2NO4A 2X22A 3G79A 4X64B 2PT5A 1W5BA 1X2BA 1WMSA 3JPWA 3K72B 1WW8A 2QD2A 4KIFA 1OFHA 2XUGA 1ZIXA 2A0KA 2E1PA 2IF2A 1SC9A 2XUAA 4G0PA 5LQMA 3HCPA 5FOSA 4LF6B 3O3CA 1XFAA 3DMPA 1CFZA 4AURA 1F8GA 3K0SA 1DAGA 1JJBA 4FINA 1BH6A 3TFQA 2O8EB 3GLSA 3A8TA 1Q1EA 2VJAA 1I36A 1A96A 2PN1A 4K2AA 5HXAA 1N2IA 3LLSA 4HNRA 4OF4A 2IP2A 1U0BB 3M0EA 1GTJ1 1SCAA 3AR3A 3TUIC 3R8FA 2C2HA 3CWCA 3IODA 2WZCA 2EFJA 3TVYA 3DCIA 2LD4A 1JI0A 5DPMA 2COKA 3DFKA 4AZTA 4YCMA 1N6OA 2DVMA 2CMHA 3KXLA 1SKQA 4DB4A 3ORSA 2PY6A 1FNCA 1IHOA 1JLLA 2AJCA 4L16A 1YC2A 2MTBA 4PNZA 4EGSA 1KTIA 3GJ0A 3WHPA 1R50A 3R6GA 5KDOA 3ZI0A 3MB8A 4HFJA 1DAFA 3I01M 3EPJA 4NPCA 5LQRA 4WXHA 2NXJA 2O5RA 3PHHA 3EOAI 3KHSA 3TD2A 2NP7A 5JQGA 2HGZA 2VVTA 1PZGA 2IC5A 1QGED 2EC5A 2XE8A 3IALA 4E07A 3WFIA 3AEKB 5G1NA 1OXTA 1OZHA 2D2IA 4W5QA 4AMBA 1PFWA 1CJSA 3KVNA 3EULA 5B4UA 5CM2Z 2ATXA 2D3WA 3COSA 3RFUA 1RMTA 1IJFA 1F6BA 3UK2A 4N49A 2NTNA 1T3HA 4ZAZA 3CS3A 3L6RA 5IJ9B 5B1IA 4EG7A 2KLHA 4EG8A 2OKCA 4CE6A 1IFXA 3C8MA 4B3TB 2LUOA 1NNSA 1I1QB 2I9PA 4NJOA 2RG7A 3HE3A 3STWA 5JCJA 2H0AA 4OA8A 4AWAA 2DR0A 1NOJA 4W4TA 1GG2A 1NBMD 2TMYA 3QELA 4MWOA 3UTDA 4RVUA 4ZP1A 1G17A 4D9JA 2OLKA 3V2GA 4ETIA 3PC2A 3C24A 4B3JA 3H3JA 2NVUB 2CMDA 2D3TA 3FWHA 3JV7A 4QYXA 3M5CA 1B8UA 1QH1B 4JR0A 1JQDA 4F4IA 3GO4A 1UAAA 1FU7A 4JLBA 2DH6A 1T8WA 4DKJA 4ZU1X 3A1WA 1A9SA 4A82A 4FFMA 3MWDA 3VDXA 3A4LA 3W6ZA 1WF6A 4I4CA 1D5WA 4H59A 3TRHA 3B89A 3WB0A 4DC0A 2P9TA 1E1YA 3IERA 4LWOA 3CLKA 4MV6A 5A9RA 1M10A 3OLYA 4Z9XA 3VR5D 4W9MC 1YS1X 2Z09A 3O8BA 2D13A 4BO2A 5IDYA 4RULA 1ID8A 2RBGA 2G9UA 3B1WA 3L8GA 3CLUD 3ZE0B 5JSZB 1SXJD 3DNFA 1P18A 2Q6VA 4DRXA 3G17A 3FWZA 4MUKA 2BFDA 1Y63A 4JELA 1OXVA 4CM9A 1APBA 1P1IA 4XUGB 4DA9A 3U5ZB 5E1OA 4WZBE 2PE5A 1T3LA 1JIJA 2JB9A 2ZBGA 4FI3C 4O0LA 4TLAA 4JXZA 1E3EA 4GXNA 3IL2A 3LK7A 2HQ1A 3AKEA 1NYQA 3OZAA 4U2KA 1JR3D 2B7LA 4GYWA 5BORA 2W71A 3DULA 3HXKA 3JWEA 1J1UA 4INJA 1G38A 1Z8FA 3KSMA 1E2EA 2M1XA 3IRVA 4Q66C 2C7GA 4GR5A 4RLHA 2R6GA 3W5HA 4ZJPA 2J9FB 1GA1A 4PICA 3N5KA 1H2FA 1OX5A 3EH2A 3QMVA 1FUUA 5LMCA 4PO3X 2HCBA 4R5HA 4YLGA 1IJEA 3T7AA 3VSBA 5EZYF 3BJZA 3UJDA 4BMNA 4O0MA 3HYNA 1DBSA 3K0AA 1ESEA 5DK6A 2J3HA 3QKSB 2GKOA 3VV2A 3L77A 3BX1A 5JHHB 1NN0A 2YWBA 2ZULA 3E9CA 3PFBA 4MQ6A 2HKIA 3ZXUB 2NPFA 2OV8A 4L50A 3P96A 2ADOA 4YS6A 1UFKA 4KK3A 3ITEA 4ADSG 4UHJA 2Z6AA 1IVNA 3D54D 2O23A 2ZT5A 3AFOA 1GIAA 4IV8A 5E1BA 4K9OA 2IPOA 1QZUA 1ZGZA 2Q3EA 3M4NA 4P82A 1Y9DA 1VPVA 2ZRLA 2AK2A 2P2LA 1T5TA 3OU6A 4C05A 4FYJA 1W1UA 1X8KA 4KBGA 3JQGB 5IVHA 1QKIA 4MWSA 3ZE7A 3ZHRA 4YNBA 3TTVA 1UT8A 3M89A 1WUTA 2AHRA 1O6CA 2X9LA 1ZH2A 4NL4H 5ALTA 4EGQA 1XVIA 3FSGD 2C96A 2CVOA 4OJTA 3UANA 4J4BA 5IFKA 1C50A 2BGKA 4RF2A 3WLLA 3FY4A 3PUXA 3Q9LA 3VR4A 4UOEA 3Q8KA 3PFHA 4GPAA 4MEBA 4GKAA 1Q7TA 1RWQA 2P9GA 2H1CA 3LW7A 3GFTA 5DW3A 3W05A 4DEXA 3PQ6A 3JZMA 1ZP6A 3A25A 4KBYA 3RHSA 1U3VA 2XYRA 4KODA 4WK2B 4JDUA 4CYMA 2ATEA 1VPWA 4BNZA 3H6KA 3LC2O 1CZUA 2UVDA 4PRZA 3FFAA 2X4LA 1PL7A 3PEEA 3MT0A 4H7KA 3LDUA 1PR4A 1PZMA 2I1VB 4P35A 1KVTA 1VHQA 1QTNA 5ALQA 3EZXA 2EKBA 2OFPA 3A9CA 3H99A 3IIKA 4V24A 4BVJA 1OGYA 1O95D 1GPDG 2II6A 5EOVA 3AF4A 1TCBA 3MTIA 4X7BA 5ALYA 3SMVA 2O0LA 4LEIA 3A6LA 3GC6A 1X8XA 3CF0A 4BNVA 1DBPA 4MRMA 1TQDA 4YJ2A 4H0CA 3ZU5A 4E1VA 1V2HE 2ISCA 4RC9A 1OZAA 3PXCX 2WHYA 4D80A 1JSZA 1Q50A 4Q9IA 4FWBA 4PYNA 4WQMA 1MU0A 2BZGA 2ASEA 5LBUA 5C5DA 3GCZA 1REQA 4KQFA 4X6LA 5AHXA 2GM3A 3T0IA 1L7PA 4D43A 1ZAKA 3VVLA 1XF1A 1M6EX 1YOVA 2AFHA 3ROXA 5LP6F 4JLMA 4PEVA 2OLJA 4KITB 1CS4C 2YFQA 5G4LA 3WHKA 1MAHA 3U13A 5DHRA 3AF6A 3ROPA 2EYQA 4XD2A 5MGBA 1PFUA 3T95A 3NIBA 2GJ4A 5E0OA 1QPGA 4HZUB 4CR8A 5C1PA 2BFMA 2G0TA 2NUPB 2OHHA 3ZEAA 3D4OA 3CEAA 1BEEA 3D4PA 1G9TA 1RRVA 2Z1DA 1YZYA 1EE9A 1YB2A 4IV5A 1AOXA 4GQAA 1Y1RA 1BU5A 2H18A 1CUFA 2A5DA 2NXNA 2PR7A 3DE7X 3D1LA 3ETJA 3GEGA 4NK4A 5IK2A 4UC0A 4EP1A 3NNNA 4YJ3B 3SVTA 1F2DA 4RTJA 1C1DB 3PUJA 1WXEA 4AYXA 2L18A 1EFRA 3PJFA 4O08A 3EGXB 2XQFA 3ZWVA 1HDOA 4DDKA 2HQBA 5AVZA 1YT5A 2H8KA 4FFBA 3C4VA 4PLFA 4MS4A 1NHGA 1LLQA 3EPHA 4XDHA 4ZVQA 1CQIA 2WTEA 1YUNA 3JD0A 1XPJA 4YAEA 4FEGA 3UOWA 3RYCA 1K6XA 1JIVA 3JALA 3RBXA 1ADCA 5JZMA 3TZHA 3KXPA 3FJYA 3ABIA 1F4VA 1GRNA 2QUJA 1T8UA 1TF5A 2DP4E 4FYIA 4NQRA 4AY4A 4A2PA 4FFWA 1RBYA 4GKKB 4AKEA 3NTOA 1OJLA 5B64A 4JCOA 1IPHA 3QLUC 3QM1A 4A8TA 4EATA 1RIIA 5EZYB 3VHQA 3UN1A 1FRFS 4W9NC 3A3PA 3DOIA 1TRKA 4AQ7A 1SBTA 2I33A 4Q1DA 4K87A 1R9JA 2CLEB 4PR3A 3VGPA 1YR6A 1T1JA 4V39A 2OXTA 3QUCA 5E9JA 5AESA 1A3CA 2JFBA 3BERA 4B71A 4QHYA 2ODNA 3O90A 1J09A 1XZEA 2VJKA 2H65A 3BGSA 3V46A 2WJ6A 1Z37A 2NTEA 1UXJA 2G4CA 4EA7A 2UYCA 1JKJB 1S3SA 2FPXA 3MT7A 5EKTA 3CE6A 2I62A 2HJ9A 4DQLA 3JYLA 1NQ5A 2G63A 1IBLB 3H9EO 3L0PA 1OB2A 1QTIA 3G0GA 3G82C 1SQ5A 2CXRA 4UQOA 4Y7CA 1NMXA 4BTVA 1W46A 3SOZA 3TECE 3HN2A 1A76A 1ORVA 3BHJA 2X9NA 3GRUA 4D45A 2V8OA 1W0JD 5IH7A 2QTLA 4OOEA 3SFVA 4D9IA 4WXRA 1X7GA 3MRTA 3DQZA 4HDSB 2R4QA 3TRJA 2CSUA 3OTOB 2NZJA 3ENVA 2GXAA 4UUNA 5A5VA 3IB6A 1SXIA 2X9QA 5T64A 4MZXA 3F1LA 5AW2A 1JL3A 1FIUA 1F1BA 4Y2QA 5C8YB 1KMIY 1EDBA 221PA 2YRWA 1E2IA 1L7EA 2R1VB 3N28A 5FR1A 2EFEB 2XOEA 2B30A 1B16A 1BGWA 1I6LA 2X76A 3GCDA 1Z83A 4Z86A 5ES4B 2ZU6A 3I9NA 3DW1X 2HLNA 4P22A 7ADHA 4PPNA 2I6UA 5FOQA 1HDEA 4I8IA 1NDHA 1NBMA 4E5YA 4U4AA 6CHYA 1YE5A 4BKUA 3MCVA 1PJLA 1PEDA 3E22A 3RK1A 3G8YA 5FP0A 3B1JA 2HRCA 3MLEA 4I3HA 4DDHA 3GLGB 4GX5A 4UTRA 1NG1A 1YBVA 1BMDA 1RAEA 1EKXA 4N0PA 3PRYA 4JS0A 3ZU2A 1MJ5A 4Q12A 1QQAA 2WZBA 4R7ZA 4XLZA 4CM1A 5K4HA 2YZ7A 2WG0A 1G21E 2AN5A 5C0OE 4Q0MA 5A6SB 4CJXA 1C8KA 1RAAA 2HDNB 1MHPA 3NHJA 3HKCA 4R2XA 1CEEA 3B38A 4RIHA 3TG2A 4L07A 4FC6A 2F8TA 3R9XA 4IVRA 1B4DA 1QWOA 2QL5A 3GNTA 1VZ3A 4WOJA 4F2GA 2REOA 4L85A 1AS3A 5JO9A 4BAUA 4D3SA 3S6JA 1SQ0A 1D4FA 2C2MA 3JD1A 3K1AA 4HLQB 3V8VA 3AVTA 4RK5A 1L7BA 5HK8A 4F7WA 3WWEA 3INYA 1EWKA 5JNVA 5B1YA 4YJDA 1C7RA 3DW3X 3GMDA 1WTCA 2HIHA 2I1QA 2ZYHA 3IUQA 3GR6A 4OQXA 5DSTA 1PS9A 4MLDA 1IN6A 1GUDA 1RWOA 3AZQA 3ZWOA 4QXOA 1NMQA 4KMSA 3TNLA 1JQBA 2KQUA 2C2XA 1QDUA 3E1GA 3H4IA 1A4UA 1GTZA 2I3AA 3HU1A 2J5XA 1S8OA 5FPHA 1A9YA 2YJ4A 3FOFC 1ZO8A 4H7IA 1GPH1 1KNQA 2QT0A 3WLAA 3LJKA 2ZTUA 5IASA 1W44A 1WBJB 1PNRA 1PK9A 3H0EA 1ZITA 3BGWA 4GR9A 4AD8A 5LDHA 1AN0A 4M55A 5FCDA 1CUSA 2J4DA 3JQAD 1J22A 2IH4A 2C9MA 2PGNA 3K96A 1JPVA 3NJ4A 4F5YA 3QFCA 1Z16A 3DZIA 1DEKA 4K0KB 3G0OA 2C5HA 2KS6A 4NCNA 1RYFA 1R5JA 5CFQA 2Z1NA 2QMOA 3ZI4A 4ZZ1A 2BKEA 4LI3X 3ZBPA 1Z0ZA 1P5FA 2AI1A 1JFFB 3PKIA 4DV1B 4CDRA 4WJZA 5CA0B 4OMUA 4QDJA 2E0IA 1KMCA 5ILOA 1RXWA 2O2ZA 4M9ZA 3HB7A 2YDXA 3G2JA 3W2TA 4F5ZA 5KYNA 1HBJA 2M2IA 4NH0A 1K4YA 1U2TA 3WTCA 3FIJA 3H6HA 1FU4A 1XYVA 3E9MA 2EWWA 3AHHA 4PYIA 5JNTA 4AMUA 3EMVA 2I3BA 3MFYA 4GMKA 5BR4A 5C8VA 2B1QA 5ICSA 1EFAA 3VPFA 1FLDA 2B21A 2I76A 2W6MA 3DV0A 3TW0A 1GUBA 3Q3VA 1SUDA 4BCCA 1PYDA 1POXA 4ETMA 1V3UA 2C8JA 4BNXA 2NTJA 4EY5A 4ENWA 1FA9A 4EG6A 2ZRJA 1RM0A 3GDGA 4Y7DA 4Z0HO 2VQSA 5ESRA 7GPBA 3THXA 4F04A 5DWVA 3NIWA 4I8XA 3RYTC 4OLAA 2A7QA 2C5GA 3OWHA 2IEAA 1K92A 1ZHOA 2F3SA 3NS7A 5REQB 5B7PA 4FJ2A 4P3KA 1DARA 1YD7A 2IOFA 2IBMA 2O50A 2QVCA 3KG2A 4HWTA 1KMHA 1RP1A 4PZEA 3U9TA 3OOJA 3CEJA 1UOPA 4E6EA 1UPFA 4B4WA 3QFRA 3IUEA 2ESRA 1WZUA 1FDOA 3PQFA 4I2NA 2Z2IA 5F1KA 4JXJA 1H2RS 2FJ0A 1C3XA 4WNYA 4DCNA 4P2GA 1PJAA 3T1NA 4IMRA 4RS3A 2UZIR 2CBGA 2NU7A 4DR4B 3A1TA 1E4YA 1YO6A 2PS9A 4RA6B 5FEMA 1DCTA 3KJXA 4WHMA 1P75A 4K05A 4U8HA 2V6FA 5E7JA 2UYQA 2ENUA 4S0XA 4B43A 4ZV9A 5HQJA 4DLWA 3KSZO 1A1SA 3EIHA 4ZCPA 1ZI9A 4A7PA 4JWTA 5AXDA 5EJ5A 3LWZA 3PGVA 1HZZC 1L7DA 1IRXA 5GVSA 4G5SA 2G8LA 2D1QA 3O1JC 2I2WA 4QOHA 3OZVA 4M98A 5FBWB 1ENYA 3VPBA 1QP4A 5AW0A 1PGQA 2ORWA 3LUBA 3PQ4A 3DDUA 4Y2TA 4MQ4A 2ZPUA 2OBMA 1IQ0A 1NXWA 1GAJA 2A67A 1MA0A 2PT6A 1D6JA 5FL7D 4UCXA 721PA 4C6HA 1NI4A 2RGRA 1ZNQO 3P4YA 4NNJA 1KRXA 3UJ6A 1B42A 4OLBA 1WKBA 5I7SA 3LC7O 3W2FA 1BSVA 3SX4A 4B0PA 3SQXA 1KERA 3NUQA 5K45A 2OXEA 1DDIA 2VDVE 1LDMA 4NOMA 4G97A 1D04A 1HQCA 3WS7A 1C29B 3FAZA 2FXIA 1E4EA 1MO5A 1WOMA 1XHLA 2D74A 4UUOA 1KKLA 3CCBA 2HCFA 3U7GA 3ZY5A 3SXUB 3HBLA 1XBTA 4Z0PA 4MGIR 1JIUA 4P7GA 4M7RA 2YHAA 3MWEA 5T3UA 3TJMA 1E0KA 3KQMA 5EESA 2GN8A 2VJOA 3UB2A 4CIDA 4EG3A 4WPGA 4F5EA 1U7TA 5JJ5A 1IN1A 2DWQA 2O9JA 3WKBA 4G1BA 2DTXA 2H1LA 2R7NA 4KJZA 1LX7A 2PRZA 1DKRA 2XCOA 3AY7A 3K1YA 4OYLA 3V33A 1AHIA 2JAUA 3GWGA 2Y1DA 3NHKA 4K2HA 5DWDA 3DDHA 2ZOSA 1ADFA 3VH1A 2HDHA 3CVYA 2DT5A 2IIQA 4N3GA 3QHAA 5JYEA 2H3EA 2LBPA 1KE1A 2NYAA 2YOHA 1S6YA 4X92A 2VF7A 1SVMA 1JZTA 1QG6A 2NPOA 2QENA 1FFHA 4X5OA 3F6EX 4Y9DA 3QFSA 3L7YA 2OL4A 4LDZA 5AM1A 4BEBA 2C4WA 3FCAA 4JC8A 4J29A 5A9TA 3SHWA 1DQRA 5DN9A 4AG3A 2BRUC 5D86A 4IO0A 1YS2X 1PG5A 2DQSA 4MDYA 4MUGA 4WNAB 2P2NA 1UKAA 1L4NA 3TQHA 2XXAA 2XV1A 1AGNA 4RD3A 1YR2A 1WQ4A 3AX6A 3TF5A 1Q57A 4MRAA 2E2WA 1TZ2A 1MGOA 4M54A 5ERXA 1KI9A 3H5VA 3TTTA 2JJYA 4LYFA 3OZTA 1MNQA 4RW0A 4BX3A 1WPGA 1V0JA 4DRXB 3WKCA 4BO0A 1ZISA 2FLWA 2CVQA 4DEYA 5ICMA 1FRNA 1UBGA 2VF4X 3QE2A 1W1IA 1E1CB 4DMGA 1MC4A 3EFEA 4WDRA 5E7QA 2WWVD 1WQ3A 2HSWA 1IE3A 3CZQA 1OWLA 4I2VA 1EA7A 1H4TA 3EIWA 3F6RA 4HDAA 4IDGA 4IIJF 4OQYA 1IN8A 4UXHA 4X9XA 3M82A 5CTAA 4DR6B 3FDZB 2IOHA 2O3RA 1CR1A 2OD2A 5HHTA 2ZDQA 1NZDA 4HEQA 2A94A 3LAWA 1L4KA 4AVYA 1SHLA 1DIHA 2DLNA 1PS8A 2D06A 2Q27A 3JATA 4GOKA 1T13A 5CT9A 2PZJA 2C9BA 2BGIA 3ICEA 1Z6QA 4JXXA 3B5EA 4L27A 1ADBA 4II3A 3TE6A 3R7LA 2QOEA 3BHIA 2QTHA 2AEEA 2GCPA 4P0TA 2FETA 1I6KA 2FX3A 1OI4A 4YRNA 3NB0A 1EVZA 4FBLA 2VXOA 1JIQA 2J7PA 4S12A 1WP9A 2FGJA 2JFPA 4MX8A 4ETWA 2A0FA 5K01A 4Q19A 1BD3A 1QV7A 3DF7A 5LJLA 1VKHA 2PUWA 5BWOA 4M1EA 1PSDA 3NBQA 2WK1A 3KJQA 4I3FA 4P38A 3T1HB 2P2DA 4RHXA 4CKEB 4AI6A 4Z7JA 2WQZA 4M1OA 1DBRA 4UEOA 3OEHD 1I3CA 1JWBB 3DOHA 3G5AA 3DS8A 4PZZA 1K8QA 5I9MA 5L4NA 4CZ2A 3SJZA 1DGQA 4MYDA 4B8YA 1HEUA 5LYJF 1OWMA 1N6NA 3KKEA 1NP7A 1TFRA 1NVWQ 4KQKA 3KAKA 3AUUA 5ULLA 1V96A 4HDMA 1TEZA 3CLVA 4RCVA 5AOAA 1AKNA 1ZRSA 3TRKA 1TLFA 3WP1B 2QQGA 1H2HA 1WUHS 3ENNA 3F5MA 4QVGA 3R8CA 3P32A 3P1JA 1F8YA 2ILTA 2P79A 1R4MB 1V8DA 2WJPA 1NNEA 3EUAA 4IMJB 3THWB 1DUVG 4QOSA 3NHUA 3VZCA 5KCZA 2ZVJA 3PQDA 1Z4KA 2ZETA 4DUPA 3DTNA 2D2VA 3PK0A 2C94A 1EWTA 3GUZA 1MX9A 1T15A 1TVEA 4RF5A 4UDYX 1BW9A 4X60A 3P9PA 3RRXA 4B6OA 2QY9A 4L75A 1C4WA 1XG5A 1G5IA 4YPFA 1XMSA 1ZD4A 1JPJA 4ZI7B 1E9DA 1NC1A 1IXZA 1ULAA 3DDOA 1RZRD 3PE3A 5FA5A 2QMUA 1XFDA 1ETHA 4JITA 5B2EA 3LCMA 1M1UA 3U4HA 2P7HA 2WJIA 3AL0C 1NVMB 5CNMA 3WWZA 4D0GA 1OU0A 4TV9B 5AI8A 4EARA 3QK7A 3VO9A 1T36A 2G4LA 2RK3A 5FH9A 4CEIA 4IOLA 4RK4A 4F3NA 2G09A 1II9A 1M7BA 3OCVA 3DMTC 4IJ5A 4JA2A 4KXQA 4KOEC 4EFDA 4BTLA 3LT5A 4MB6A 2XOXA 5JR3A 4L6IA 1XJ5A 2C8LA 4Y2UA 1YDHA 4US2R 1GU1A 1CRQA 4MW5A 5HIIA 4F4JA 4MS4B 1J4AA 3KFXA 2QZJA 5KJEA 5D87A 1FFXB 1RJEA 3LH5A 2OESA 3G7NA 1GFWA 3N7TA 4HGPA 1UM9A 1GXSA 4B7UA 4RGBA 1UXKA 3PCTA 3SYLA 2JZCA 1UWVA 2YS6A 3B3QA 3EIOA 3H8SA 3IQDB 2BMJA 1Q20A 4JT4A 4WKGA 1AY0A 1MRZA 4YBZA 5HS6A 4CVNA 3AVYA 5D1NA 4XD7A 4JJKA 3MIZA 5FL3A 1MHTA 3PQ2A 4OXKA 1V3VA 1M6YA 5DH9A 4DSTA 3IPRA 3FMIA 4NU0A 2R62A 3JSAA 3CG4A 1RCTE 1X7ZA 2ZIFA 4BXOA 5A3QA 3N1UA 2PCLA 1U3UA 4C7OA 3O82A 4WA7A 5KTOA 1ITZA 3OZFA 1AKMA 1QK5A 1RCFA 2DJIA 4KMOA 2W8ZA 3FCXA 3HO6A 2WU0A 1EDOA 2GEBA 1W29A 1WDKA 3AC0A 2YIJA 2HBYA 3MGAA 1VCNA 3QX8A 1MMFB 2PX5A 3I04A 5DXFA 1E9AA 3ONWA 4UEJA 3Q3HA 5ALIA 4WDQA 1SRRA 5ICFA 3TKLA 4RD1A 2JFYA 2RB5A 3IUBA 3H65A 1WXXA 1IPFA 4FJ0A 3N8HA 3THOA 2H4XA 1G42A 3UHOA 3RS9A 1P9RA 4JHXA 1OROA 5EUQB 1W76A 5I45A 4RAOA 2BBOA 4ZN6A 3UWOA 2F6RA 2Q2QA 3JQBC 3T0GA 3DCNA 4JI3B 1ZA2A 2H63A 2VK8A 2VJNA 2GT1A 3PPIA 1KFKB 1S9HA 4MQMA 1UP6A 1JKJA 4MYTA 3TH5A 1YOBA 2Y68A 5J40A 1LPAB 1MJFA 1YCHA 1T9CA 4D81A 3E9QA 2XNCA 4GLOA 3R7FA 3VSCA 5EUMA 3ZD8A 1WZ2A 2JHGA 5CDTA 2VRNA 3BCRA 3E3MA 3QLUA 1RPJA 1JEYA 3DZFA 2YZ2A 1FTSA 3E4DA 1TJ3A 4C5BA 4MP3A 3R3JA 1H8HD 1FDSA 2A3RA 4PZYA 3V4PB 5EJAA 5THXA 3ZE8A 5KTRA 4ZHQB 3FUTA 2IFTA 2ZIWB 3AETB 3CM0A 2QP3A 1XMIA 2GJSA 1H2BA 4MLCA 4F92B 4HY3A 1BW9B 4B9EA 4M0EA 1YQEA 1H93A 4H31A 4L22A 2WNSA 4F45A 4RY0A 1XRMA 3IAAA 4JJ6A 1UC4B 1VGRA 3NBKA 4KQCA 1DCFA 3GGDA 4P8RA 4HL6A 4MS1B 4C22A 1U2QA 4QLAA 5HQ3B 3HI6A 2ZREA 2GRAA 2PAFA 3G02A 4DB2A 3ZV3A 2J08A 3B20A 4FGUA 1U2DC 3QU5A 4MUIA 5EJIA 1YMQA 4NCXA 3H5IA 1TDJA 1NJFA 3CUKA 2AKAB 4L2IA 4XGKA 3TLAA 4RGVA 1ILEA 1VA5A 5DE3A 2BGLA 2R00C 4LF8B 3TQRA 3KJNA 3B9PA 2FY8A 2DY1A 3KALA 5ALLA 3MLBA 3DEAA 3LCVB 3UJAA 1PYGA 5AVVA 5EUBA 5EEHA 4NNOA 2JEYA 3IPLA 1VI5A 3SC2B 5LQUA 2P9HA 3AY3A 2PPLA 2CF5A 2XIJA 3IO3A 3L2OB 5KCMA 2GHIA 4WCDA 4F12A 3I34X 3NANA 4U7DA 1DSSG 1C3OA 2NU9B 1U8YA 2HO5A 2O3SA 5DBIA 4D57A 2IS1A 1XA0A 2P40A 5I7FA 3D43A 4DG8A 2PH5A 4R2WA 1KU0A 1Z5OA 4RV9A 1GCIA 3HWX1 3V97A 3N8IA 4ZPXA 2W70A 4OQPA 2QM0A 4DA4A 3VVBA 1ZC4A 3TD9A 3UICA 1ZK1A 5BSKA 3QELB 1VLVA 2JH3A 5C18A 1ZC3A 3PLNA 5DHSA 3GX1A 1KI4A 1QQBA 4TKUB 1F0PA 2B2XA 3LKDA 3TOXA 3EASA 5G2OA 3H9GA 3BFPA 4NJEB 4P80A 3QVOA 1OI3A 1AMOA 1YE3A 1I4WA 4CM8A 2OLEA 4LQ4A 2HT1A 1HTBA 1KI8A 2NSDA 4L4ZA 1OLSA 1VDMA 4HDQB 4M22A 3VPDA 3N2LA 2BELA 1Q83A 3FYHA 3ETGA 3JVUA 4RQUA 3BXFA 2WVAA 2ZROA 2QRGA 1E1LA 4MAFA 5FNVA 3N0RA 1I5EA 3KJZA 3KQOA 4X71A 5EQFA 1NLMA 1MX1A 3ZLUA 4C89A 1AZWA 2AIRA 2JFZA 2IGTA 1ZU4A 3VAZA 1I3OA 1NMZA 1XTZA 2W93A 1QGZA 1Z2AA 2BC9A 2HPHA 2XDAA 3QHQA 4IWNA 3CF2A 4UNNA 1K6JA 5BVHA 4YP7A 1YZLA 1QIDA 4RWEA 3W04A 2RH4A 3WBJA 3RC1A 1JLMA 2SKDA 5AK5A 3SSNA 3ZZTA 4GWGA 3HM2A 2OHGA 3HHEA 5BR8B 5JC8A 4V1CA 2P5TB 1P4HA 2EBUA 3F9IA 1FUYB 1TEXA 4X7PA 5LQKA 1S8NA 1QCYA 4PYJA 4ZZ3A 1OMOA 3WMXA 3Q87B 3EISA 5LJIA 3SF0A 4RK7A 2PFGA 2C2KA 3ZTTA 5EWMB 3ZIUA 2B3DA 3I72A 1ZAYA 1G98A 3D3NA 1Y42X 1OLXA 1YR8A 3O4HA 4WUTA 1E69A 2RJNA 4WEOA 2UUOA 4AIRA 4J4HA 2FEPA 2BKAA 1WKVA 1C1HA 2NWQA 2D2FA 2VSYA 4P3PA 1MT0A 2G82A 1WXIA 2PXXA 3PP8A 5E6RA 3T8YA 3WIDA 2I6FA 5JJBA 2PUEA 1T2VA 1ISSA 3HI4A 5ADUS 1E9EA 1MQ9A 4C6SA 3DUFB 4GT1A 3DV0B 3T7TA 2V0GA 1SQSA 2FSVA 5LQDA 3U7QB 3CZPA 2V7EA 4QGFA 4FCWA 1UDRA 3V1NA 4NE2A 3QGMA 1X1RA 2Q7XA 3RUCA 3WL7A 1VB5A 3QF7A 3H18A 4YMWA 2HRRA 1J0XO 3VU0A 2DQYA 3R41A 5EMLA 4HEJA 3LXMA 1YS7A 4HNTA 5JAZA 4LOKA 3OZUA 3R7AA 3NT2A 3JYPA 2ZITA 4DF3A 1QHHB 2J3LA 1O54A 4EKYA 3RWMB 1OFUA 2PZAA 4LOHA 1EAYA 2JLZA 2OCKA 3OTHA 3M3PA 4FK8A 3ISTA 4G85A 3T3GA 1DG1G 2FQXA 3M9LA 4A23A 3MMZA 2RH5A 4W5RA 2AN4A 2AWOA 2DUJA 1RVDA 2JIOA 2O0KA 2ZRQA 3GUYA 3L6BA 4QHSA 1V3QE 1ZK2A 2B7BA 3FPSA 1U94A 4YAWA 4MIEA 4HEHA 4FE7A 4ZOEA 5EWJB 3HTXA 4O4JB 4BNNA 1M6VA 1GLNA 2EZ9A 2CNBA 4JL6A 4OFBA 4OAOA 5I4CA 1MXFA 3L1KA 1TAUA 4QC2A 4JLKA 1ZN8A 2OOKA 1FW6A 4CGYA 2Q1XA 4CI0B 2EIHA 2Q28A 3LY9A 3VNRA 4O59O 2VP2A 2VAWA 3TJRA 2ZB4A 1JQLB 4BKPA 3CYFA 1T2AA 3GIWA 4RU1A 5JSYA 1SCBA 4G9BA 3IYLW 3PXEA 5BSTA 3NV9A 4N3NA 3JAMA 4IDHA 4Q7QA 1M2OB 2BUAA 2FQQA 3LXUX 1UC5B 4CM7A 1P4JA 4O4JF 3R3YA 4NDNE 4E09A 5SY6A 1JEOA 4MAMA 2HU8A 1DKUA 1BA2A 1NTRA 2H06A 2XMRA 3WNVA 3MTAA 2MR6A 4BFLA 1F48A 3D6VA 1W5AA 4J7UA 5THKA 3AJEA 4TN1A 3M3DA 1BYIA 3T41A 3OX1A 1YZ3A 3CNOA 4F96A 4MQUA 4FYYA 4V03A 2OO5C 1UZMA 2XZDA 4AYTA 3K9FC 2XKAA 1REQB 4M0PA 4TM8A 4XEUA 5P21A 4AO8A 5AI9A 3RJZA 3DE1X 5FQOA 1QGUA 4XPZA 3SC6A 4EUKA 1N3LA 3W0LB 4G2NA 2NX2A 4YMTA 1CW2B 5K2MA 4MVJA 4F1JA 3U44A 4RCZA 5IZ4A 4GQIA 3O8QA 1EHIA 2XGSA 3QOXA 4NVRA 4MI3A 1R8SA 1M5UA 3AF2A 3P71T 2XT9A 3RAJA 3W77A 4ZHSA 4Q16A 2JH9A 1GWNA 4HP8A 3UK0A 5JVDF 3AIMA 2ZIXB 5DASA 1HT1E 4LDPA 1GAQA 4HQ6A 3MAAC 3WGGA 4QYTA 2OBLA 4AKGA 4D4KA 2HH9A 3CKMA 3TBKA 3Q88A 1KY3A 1YJAA 2KW5A 3EC2A 3B2QA 1EJ6A 4MEJA 4BE7B 4JGIA 3G3EA 4PS0A 1DINA 4K9MA 1ENPA 2NV2B 2PUJA 5EHQA 4LGCA 5JU6A 1JH9A 1KO7A 2F55A 2DFNA 1G3IA 1BMTA 1PGPA 3RM3A 1CFJA 3HVHA 4QSHA 1N6KA 2H07A 3ANMA 3KPVA 3TMAA 1OI2A 4BBAA 1E9VA 3ICPA 2A57A 2PSHA 1U8EA 4MLPA 5FYQA 3ZOKA 1SKBA 2HNKA 4IIHA 4L9AA 2QJFA 4X91A 4ALIA 1U7DA 2H4FA 1CS0A 3RKRA 1WNFA 2QE7D 3E22B 3ETCA 2RH8A 3KDPA 8LDHA 2IHUA 3L5KA 1Y3DE 3GJ4A 3JARB 2QE7A 1XMXA 5FTNA 2JVIA 3NDIA 3ZGXA 4CKXA 4HADA 2IYAA 1G6HA 1DTSA 1N2GA 3ELDA 3BRSA 1F8UA 3VNQA 3SBDA 1SIWA 5KEIA 5HK9A 3RPEA 1VE3A 1WLSA 1PW5A 3PHGA 4YAUA 2XVYA 1KORA 2CZCA 4LPSA 3Q1KA 4O4IB 4RXTA 1A98A 1XDDA 5J58A 3NT4A 3FGOA 1P60A 4B2PA 4RVSA 2RGGA 3H2JA 1EFUA 1KNXA 1X1DA 4CLHA 4Q3CA 3MGBA 2ZJ2A 1FX0A 4PXAA 3CVVA 2W6OA 5LDDC 2PKRA 2ODWA 3ZGNA 3EEFA 3O21A 3OCYA 1U1DA 1O94A 1KTVA 4BASA 2D54A 5L3SB 1A5BB 4KAAA 3SZMA 3E3LA 3BMOB 3PTZA 5A6VA 1GFSA 1I2CA 2BR5A 4OKNA 3HGMA 3ONEA 2PS3A 3VSEA 2FUG1 2ZJBA 3BZUA 4TVBA 5BV1A 2HF2A 1X8JA 3ANTA 2CBXA 3RADC 1T4MA 2OG2A 3GY0A 4EIWA 3KLBA 3KSDO 5KJ6A 3ONFA 1C8LA 3GJ5A 4RFVA 3RSFA 2IS6A 3WLKX 4OL9A 2PMDA 5TNXA 1WCV1 1P44A 2AI2A 2JAPA 4O4HB 1M5TA 2JGJA 2NAFA 5K1ZA 1MAWA 2MSEB 1MO6A 4QXRA 3EWNA 4NBRA 1NJ2A 2WA2A 1Y9ZA 4E5NA 3QBDA 5LP6C 3V42A 4G0UA 1HTTA 1CIJA 2GARA 3L8HA 1SVWA 2ZIXA 1MO2A 1NXXA 3JWPA 4JMPA 3NWPA 4TLDA 1PWYE 1KYIA 1YNSA 1P5ZB 4XYBA 3OO1A 3NHPA 4RM3A 4BLTA 4OBEA 3I5YA 1X39A 4BEVA 5BNWA 1V45E 2LKDA 4YDRA 4MR8B 4OCZA 1NVTA 5DISB 1T3GA 1VJ1A 2EEPA 3VX3A 2ZJYA 3U4IA 1QIMA 4IIFA 4F46A 2H11A 2QLBA 4FI3F 4BX0A 3F5SA 5AP9A 5GJVC 4K26A 1R6UA 5CA0F 5ELLA 4IDEA 2PLFA 5B1SA 2ES4A 3RU3A 1M0EA 1VHLA 1FLNA 2QUZA 2P0EA 3H8WA 5A4KA 4PNPA 2JFFA 5TF0A 4C04A 5EMHA 2AXPA 4PM4A 2JZNA 1NLZA 3O8LA 3TLGB 3UXMA 3T9DA 3TS1A 2R68A 3ESQA 3DXFA 1MB0A 2V0CA 1NVVR 1QYIA 4JWKA 5EJGA 3B7PA 3JVVA 4U5QA 4X1IB 3Q0EA 2QLFA 5K3SA 2E4UA 2JF0A 1V5GA 2O2XA 3A2MA 4OHWA 2REBA 4YRZA 1Z5GA 3OIYA 3CLRD 1WMBA 1D2MA 1KZYC 1TM5E 2YVQA 1CERA 3AU8A 3P9KA 3WKDA 5AVRA 2BV3A 3AW9A 5JD6A 5IKOA 1GNTA 5LCXA 1KXJA 2WUDA 2HQRA 1O1YA 1JF8A 2IXFA 5AW6A 1SVUA 4FS8A 4O4JA 1Z75A 4W5OA 1GZ4A 5DNYB 3TBFA 3C3WA 2ZTMA 3WI7A 1LNZA 1KC1A 1WLYA 3LIPA 4XGIA 5JW6A 2IEYA 3QBEA 4DIFA 5HFJA 4F1WA 4DIDA 1L5HA 3UVEA 4GEGA 3WYFA 4ALNA 4LISA 4BATA 1Y8CA 3DTYA 4CMIA 5BSEA 1R5BA 3QYAA 5EN4A 2I1LA 3LDHA 3QMMA 2UAGA 1K7XB 4JAVC 4EH1A 5BXQC 1PEYA 2GPAA 4GPD1 4M0DA 2YFHA 3ZHCA 4KRYA 4E88A 5DFAA 1MGPA 1G1MA 4J1TC 4OBXA 5ECGC 1TGYA 4PZAA 2PEYA 3CN9A 4OHKA 1OH6A 2LV8A 1VIAA 4P3NA 5T6BA 5C4IA 1A4XA 2X4GA 3ITNA 4NI5A 1E2NA 1KI3A 1D7AA 3QA3E 3H2BA 1Z73A 3FPEA 4LYEA 4DNFA 3Q9NA 1XR3A 5TMDA 5JJIA 4EX7A 5I7OA 1KI6B 4ZOBA 1G21B 1QF9A 4YXWD 1TC1A 4BQQA 4DDVA 5J4KA 2LPMA 4G5OA 1D7OA 4R69A 5JXIA 2A1IA 3STUA 3GWZA 3WQSB 3K9WA 3E27A 4N6NA 4NX2A 3QJ5A 4LW8A 1KSGA 4DZRA 3L1HA 4EYEA 3HY3A 5JS7A 3GNLA 5HVNA 4C21A 3A32A 1TA4A 2HK7A 5CB8A 3CSSA 3ZIAA 4C6TB 1JAZA 3VMMA 3S2SA 2ERYA 2Q29A 2XMDA 5K8IA 1XD2A 4JEIA 5EJ2A 3WNQA 5BYAA 1XMJA 5D85A 1RYNA 3GFPA 4BNWA 3QTBA 1A5ZA 2B8NA 3DHYA 1QH8A 3DE2X 4ENRA 1OX6A 4QXAA 3WRVA 5AD1A 3B5IA 1NBIA 1ZD5A 1Z68A 3VR4H 3G7SA 2YMMA 2L19A 1WCWA 2P0AA 3CPHA 3GOHA 4JT8A 1CQJA 5EHXA 8ADHA 2PM8A 4TTPA 2RKWA 2UXDB 1IPEA 2X6TA 3QPCA 3JRXA 1HK7A 2B2NA 1CY0A 5KTSA 2I9KA 2IH5A 5DBEX 3I0ZA 4O2AA 4Z1MD 5JDCA 1BWPA 4EPXA 3MFQA 3WADA 2BMWA 3PRHA 2QR5A 1QMPA 3RYCB 2CFTA 1F8XA 1I7PA 1EP9A 1RLIA 4V3BA 1X1SA 3W6NA 3A14A 1Y1TA 3BBPA 5HFAA 3CY6A 3PJRA 2AZ4A 3GEMA 5LA6B 2Z4SA 2AMVA 4V0SA 4AK9A 2EFYA 4FFLA 4ZT7A 3M70A 3EAGA 3H8JA 2BCGY 1GYQA 2HADA 1GT6A 1KAGA 2WJ3A 4ND6A 2FSVC 1RQNA 3B3FA 1VKNA 5TC4A 4D02A 2C31A 3RAPR 3D7RA 3R9IA 4MGYR 3SK0A 4AMGA 4HCJA 3WBFA 4TKLA 4BWFB 1QO7A 3DBIA 4HNVA 2OZVA 3QEAZ 3VDNB 2JIDA 4BV3A 3PFFA 6REQB 1LV7A 1I01A 1N2BA 1LSSA 2FPPB 3AUFA 4H7FA 2EX4A 1IHDA 3N86A 5BSVA 1NWCA 4U2GA 4DJJA 3BCHA 2ADFA 1OA1A 3MCZA 3ZJUA 1MVLA 5DYTA 1ABEA 3QIVA 2GYYA 3AFGA 4OM8A 1E4EB 2GCIA 5E4JA 5C5CA 1E2HA 5AW9A 1L5HB 2R97A 3ELBA 1KF0A 3NWBA 4C2TA 2HEGA 3KPYA 5AXCA 2MSKA 2WF7A 1QRTA 4N3AA 1KP9A 2BI7A 2QUKA 1V7QA 2B25A 2C7PA 2IF0A 2FHSA 4LZLA 3UPTA 3DP7A 2R1UA 4EGJA 2RC6A 4P4GA 1T8YA 2X1MA 3LW8A 3H1EA 4RORA 2C3MA 4CFZA 3RFCA 3FVQA 2RGDA 4WBSA 3U26A 3LWDA 1SXJE 1MB4A 4KYIB 2C9CA 4O1HA 5AM3A 1A2KC 1B43A 1YFLA 4O29A 1JTVA 1SEPA 3GGOA 1QF7A 2Q9UA 5LP6B 4IR7A 1CYDA 5E9WA 1Q0UA 1YQQA 1SCQA 5A9SA 2R0QC 1SCIA 2OCIA 3E53A 4ZI2A 4HGNA 1E3JA 3KTAB 4ZFNA 1WOYA 3GA7A 4BX9A 3LO5A 2B5VA 3Q7SA 3K9BA 1WSBA 4PPGA 1R3DA 3DXXA 3NHRA 3TB4A 1N92A 3TXAA 4BGVA 4AQYB 4MWDA 1VYTA 4B44A 1SNYA 2NXCA 3BIFA 4HS4A 3TLGA 3UH0A 1ESMA 4KQIA 1XXHB 3AZOA 3SX2A 5D6NA 2PZFA 2WPDA 3BAZA 2XXBA 3MSCA 1MJGM 1FYDA 4JJFA 3BM5A 4QOJA 5TE9A 1VGQA 2O2CA 4BNTA 2YNMC 1E2BA 3R0ZA 1M5RA 2G0NA 1XD2B 2NO5A 2IEZA 4FHGA 5EMJA 1ILWA 3RS0A 2WFMA 5A04A 4ER3A 3E8SA 3EUWA 1IY8A 3VDRA 2FSIA 1C7ZA 1AQ6A 1J24A 1Q3KA 2ACEA 1PQWA 1SHUX 2V4UA 4FFBB 3MBIA 4QUHA 1YB1A 3FTQA 4DMCA 4G25A 1Q95A 1E1QD 2JI6A 3STYA 5BNTA 1U6IA 2G0AA 3OMLA 2Q3BA 3X1KA 4EY6A 2IZZA 4BOYA 1IC6A 3LBAA 5H9VA 4KAFA 3C6XA 4Q1EA 4BPRA 3K70D 2OMEA 2QQ0A 4WH0A 1ACLA 2WYUA 3GYGA 1V3TA 1IEVA 2HIMA 5IULC 4DKXA 1V48A 1UC9A 3NDPA 2R00A 1P8AA 3NOVA 5A7HA 4ZOAA 6GPBA 3ASZA 4BN5A 1GY8A 4ESEA 5KYUB 4BVKA 5AKYA 5HBRA 1VG1A 2RSLA 2FUNB 1HG1A 2VOJA 2HSZA 4BNUA 5BP7A 2QX8A 3V3TA 1OU4A 2KYRA 3DE4X 3WLJA 4JA0A 4BNFA 3QNMA 2LIVA 5EHGA 3G5TA 1SCNE 4DGQA 4HB4A 4AICA 1Z06A 1MZVA 1MENA 4WAUA 1AE1A 1L4YA 1EG2A 2IE0A 3V4ZA 3WRXA 9LDTA 2FOXA 1SBYA 3HADA 2WEKA 1ZNWA 3DQQA 1H0SA 3H6GA 121PA 3DMYA 4I4LA 4G5XA 3ROKA 4NBLA 3FZQA 5D00A 1PI3A 3R76A 1FQJA 4JX9A 3VX4A 4A8HA 2WSSD 4M8NE 4ZOQI 4KR3A 1UDCA 4TXHA 1T0UA 2YMLA 3HL4A 4QJ5A 3JY6A 2HXGA 3RS7A 2VN8A 1HMPA 2CE2X 1C4OA 1B6GA 2YJ6A 3JQFC 3D3KA 2A33A 5HZMA 4NXNB 3EFOB 1L5RA 4P3YA 3HABA 4PWZA 4R1UA 3W5JA 3DJFA 1QNFA 2W2VA 4O2RA 1HC7A 3RJ5A 3PYXA 2ECFA 5TQ0B 4BU1A 5AMXA 3PIDA 2UVQA 1A5SB 5D3MA 4BUJA 1YR3A 2FZ5A 2D0DA 4GVLA 2O3JA 2AEMA 2FCAA 2XDWA 2CHGA 3UH1A 5DTRA 4L4RA 3GDOA 3OIVA 2FSHA 4FU0A 3RUAA 2QSJA 1S96A 3O8NA 5CCBA 4OJQA 2CY0A 5AVJA 1BCSA 4PXSA 1DOAA 4JBHA 4HZIA 3SC4A 1EWYA 1RWMA 1MRSA 2D2EA 3FSGA 3USES 4CBVA 5JAUA 2J9ZB 1GSHA 4BO5A 4E12A 4FB5A 2OO7A 3G5LA 4OAPA 4LF9B 5DX0A 4BGIA 5DGHA 4FIZA 5BWCA 4RVHA 5FPKA 3M6IA 2OGUA 2C7RA 4Y6QA 1VIDA 2OQVA 3TRIA 4D3ZA 3C3CA 2WYIA 3BTSA 5FI0B 1NI3A 2OVBA 5KNBH 1BYUA 1IZ0A 3N0XA 4GPTA 3SBOA 4RMGA 5KNBD 1UPUA 2Z43A 1DEXA 1JHYA 1W19A 3VKVA 4GIBA 2XY4A 4REOA 4JI6B 1QLHA 5LP6A 1L4EA 3C8UA 4FEAA 4BJ1A 3FHJA 5JRJA 2DT8A 2M9MA 1VIMA 4CHGA 4DXHA 5CP8A 3THRA 5A7FA 1E8DA 2K4MA 2NLOA 2EHJA 4QOEA 1EFVB 1W9HA 4G56A 4EFLA 1KJ8A 2AN1A 1A8QA 2JA2A 2Y1XA 3EZ7A 2OV6A 1ESNA 2W6CX 1TJ4A 3AJDA 3BMCA 3F96A 3FLEA 3R0VA 4QECA 5SZJA 1F2UB 5C37A 5L6MB 1UKEA 4GI5A 1BQ3A 2BGNA 2FW7A 2PRKA 3LGAA 1QJ4A 5TRTA 3GMIA 3L05A 2PWPA 4C2AA 1I4LD 1X1TA 4A6PA 4EJSC 1OAAA 2P5UA 2OHJA 4II7A 1H4SA 5K8LA 3BHNA 4M1YA 5TY0A 4CR6A 3MG9A 3DAYA 3BTVA 3IJEB 1KGDA 2O5VA 3ABRB 5LN1A 1EVLA 5FIUA 3QXGA 2VSOA 5EZSA 3K16A 3R3UA 1QYCA 4PF1A 3GFQA 4TSKA 4EQ6A 3X3HA 2GJ9A 3FCEA 4LTDA 1QGYA 2VZEA 3UG7A 1AK2A 5ANRB 4TYQA 4Q3LA 1GT91 1PJQA 1JLSA 2Q62A 3HJGA 3UMBA 4UHBA 2IS2A 1DKQA 2IHTA 1Q1BA 4Q7JB 2EL9A 2BSAA 5BOSB 1U98A 1LLUA 2FK7A 3TLZA 4E70A 1CJCA 2QI9C 4LHSA 2A9KA 5T8KC 3UAVA 2ZYIA 4OP3A 5JCOC 1KEKA 1XDZA 1HQYE 1Y7PA 3A3OA 2QU8A 1X7HA 4K1XA 2CNWA 4Z9BA 5SZIA 1FSPA 1G8HA 1GFZA 2C0QA 3H1BA 1DKNA 1A04A 2KM1A 2ZI4A 2NYRA 3G49A 3GZNB 3FVTA 4N7BA 1VXOA 3TKAA 1U1GA 1G5HA 2P4EA 3MGKA 4JOBA 4ZT4A 4HBGA 5EGSA 1G5QA 1Z15A 3QX7A 2EKZA 2OHVA 3OX3A 4N3CA 5IH3A 4F8JA 9ATCA 3PHLA 4JUIA 5DSXA 5IPFA 3AVVA 2H1FA 1M75A 2HU7A 3E2PA 2GH1A 1TYBE 3CG0A 3RUHA 4E6PA 5K9ZA 4OHVA 1Z12A 2BFNA 3V55A 3VDQA 2O8BB 1GQRA 2BJHA 3P9CA 1A8HA 1PT5A 4U7FA 4NHOA 2X4IA 1E4OA 3H2GA 2Q45A 2AG1A 4KQEA 2C5LA 3ZX4A 1M1NB 1TUIA 1FBTA 4HGQA 2PFSA 4X66B 4RY9A 1SB8A 4EENA 3D6TB 4BL5A 4BO4A 2QP9X 1RRFA 1CQWA 4I5DA 1SELA 5JE8A 5CK4A 2C2GA 1RQ2A 4YJKA 2MSWA 4HNAA 5I51A 4EF6A 4MKRA 5IYZA 1H3NA 3O8CA 2LDBA 2YR0A 5AJHA 4D9HA 1FPMA 5FAXA 3ASUA 1ENOA 1SIBE 5E7IA 4O8ZA 3ZIDA 4D2IA 4DQKA 2HMUA 2PBFA 3BTOA 1M0TA 4HH3C 1Z6TA 4ZOLF 4KQGA 3UMYA 5GJBA 4KR0A 2GR9A 2VYQA 1NKSA 3DNMA 4Q3BA 4RSMA 3G0HA 3HN6A 4ZZ0A 4ES6A 4JLSA 2WRZA 2WUGA 3BB1A 5D5QA 4IUDS 1XELA 5H3LA 1QK3A 3ZWQA 3SC2A 2OBXA 2QR2A 4ITRC 1UBJS 4G2TA 2Z6VA 1W581 1E2PA 5HGJA 4RE5A 3SHTA 5BQXA 1XTUA 1Z34A 4FCTA 2HA4A 5T3YA 2WFLA 5IXYA 3BL5A 4GOJA 3R0JA 5EPUA 2ZSKA 3S28A 1CV2A 1L3BA 2DGDA 3BSWA 1K7SN 4NXMB 3ZEIA 1S2DA 3FD8A 3KYDA 1OX4A 4URFA 4R2KA 1VJRA 3FPGA 3TQFA 1E2KA 3GLFA 1TM3E 1V6CA 3GGCA 3HJRA 2IZ6A 2Z8YA 4DWWA 5MFPA 1GM5A 3C6MA 1RPTA 4K8RB 1PJ2A 3ZHTA 2GJ8A 1CY4A 1P2SA 4E5DA 1SBNE 5JCJD 2JFHA 4L5CA 1VBMA 4GZMA 4JBWA 3PF8A 1PGOA 1RD4A 1JAXA 2QR3A 2HBRA 1CF2O 1A50B 2RGYA 1Q11A 5K3AA 2C2BA 1KK1A 1VKOA 2FU5C 3DDWA 4YH1A 3KKQA 2QN8A 2H31A 1Q0SA 1U6JA 3U7RA 1H9BA 1CRZA 1NSYA 1RWNA 1H2WA 3JXEA 3O31A 4I50F 1RYZA 3VM6A 2IDJA 3VV3A 4C7KA 4N8SA 2DTDA 1C7EA 2YYSA 3FAKA 4E4TA 5KQPA 5MGNA 4X1YA 3P9SA 3A1VA 3O8OA 2Q46A 3H9UA 3TMKA 3T4EA 1PSWA 4HTFB 1XMVA 3UG6A 2YY6A 4OTZA 4PSAA 1AQYA 2PZ8A 3OM0A 4LK2A 5FPPA 2O8VA 2I66A 1DB3A 3TSYA 5BMVF 2D5AA 3LWNA 4Y6OA 2NQ2C 3MJVA 3HCCA 4LF4B 1ZL2A 1PD1A 4JC0A 2B6NA 1H2YA 2GBIA 4B3BA 5H82A 1TF7A 1NZJA 4HPXB 2VTBB 2O2JA 4UFOA 3TFWA 1NBOA 3IXQA 3B82A 2ECPA 4EI7A 5TXGA 1ES9A 3JASA 4YRRA 2O7VA 3L8DA 3L0SA 3LBIA 4LY0A 5ER9A 4ZCMA 2VK1A 1KY2A 4MV1A 3BUSA 2FFHA 1UJCA 2VDPB 3BQ9A 5AI0A 4MV9A 4TZKA 1N6HA 2MYPA 3OPYI 3HNRA 3QJGA 4HUJA 3WE7A 1LWOA 1S2MA 5LP1A 2SCUA 4FLMA 5KDLA 3V1UA 1Z25A 3UAZA 4L5BA 4A2QA 4IMPA 2BEJA 3QWBA 2I8CA 3MOIA 4YQFA 2BYTA 1RCUA 1U0LA 1Y37A 2AFIB 2GBPA 2BHRA 3ORRA 3EA5A 2YV3A 3IUPA 4UBNA 5BVGA 1CUCA 4HF7A 3D5EA 1I2ZA 4WECA 1ENZA 2QPOA 4MTCA 1Q77A 4MOWA 1JG3A 4WNAA 4B6GA 5BPFA 5A5DA 4YJFB 3NTVA 1XTPA 2I34A 3CW2A 2NZ2A 3CUYA 4P7FA 1UFQA 4Z4IA 2XH8A 3KKOA 2AQ8A 3B7WA 3QE4A 1KZ7B 4YQEA 5TJHA 3BN3A 1AURA 4DRZA 3PWZA 1K89A 1M67A 1CETA 3BDAA 2HEIA 3ETHA 3SZ3A 1JR3A 3W3AD 3OUUA 4C20A 1H9CA 1C9YA 1FSZA 5F1YA 1IEXA 3U49A 3RQIA 1K8ZB 1HORA 2J09A 3EHEA 2O48X 2GTIA 4GI1A 2XHEA 1P73A 4IOMA 2DH5A 4WERA 4B2LA 3O91A 3B1ZA 1PFKA 3MWGA 5BYJA 1L9XA 2JCGA 3WMGA 4DT1B 1SD1A 3KOWA 4TV9A 4F3RA 5H4GA 1OTYA 4UARA 3IBGA 2YWDA 1JBQA 2QQ5A 4MVJH 1ZMRA 5CM9C 5DM0A 3SI7A 3UUFA 4Q9NA 4ZOLB 1H94A 1U9JA 4JHLA 1H2AS 1WDMA 1N2JA 2B83A 1H1LA 3MPOA 4JLOA 4L02A 1WVIA 2EBWA 3HSYA 3ILSA 4JL5A 4UKDA 3T99A 3IIIA 5FWXA 1KDOA 3ZD9A 4AY3A 4AX4A 1RC1A 4BP3A 3RLIA 1LBIA 4BJ3A 1WUYA 3MMSA 4NZNA 5C81A 3NXKA 4M8LA 2AJLI 1J90A 1TNDA 3NJRA 1X9GA 1Y7HA 5DYIA 3RRFA 1JE0A 4HMQA 1NUAA 3ESAA 5HGXA 3EVEA 3P0FA 1HNNA 3UWPA 4YRSA 5K3OA 1F51E 2ZSIA 2O20A 2WJWA 1TD1A 3FVRA 3ILVA 1NQOA 1V9CA 3WQHA 4LX0A 5LIPA 1DOHA 2EGGA 2V54A 1JPUA 3ESRA 3O3OB 4MYRA 4ND8B 4R0MA 4PIMA 3IPYA 4C29A 2P2ZA 3GJTA 4PZPA 4Z6KA 4CQNA 4XPIA 4M21A 2VQDA 2A35A 2DPLA 1NBEA 3SDSA 3WGYA 4UTVA 1UT5A 4FT4A 5FUMA 5H1YA 3V4VB 3LQ2A 2P6PA 4E2WA 1EFTA 1DXQA 1OYWA 1NVDA 2W22A 1UWCA 1HEYA 1Y5LA 3JAWB 1XRSB 4PIVA 1I3MA 3Q6MA 4N6GA 3VYSB 4BRSA 1D09A 1X2EA 3EDMA 3O9MA 4MUJA 4A0RA 1QDEA 3RVNA 4D9NA 2RAUA 4GGPA 1RQRA 1E3WA 3K6JA 1Z13A 4OHFA 4PCUA 1DE0A 1BQEA 2WUFA 4B85A 1VLLA 1CEXA 2H1VA 4HFNA 3V8PA 4C4RA 5B3LA 3THWA 1WXGA 3MM4A 3IP3A 1BHJA 3D31A 3A6FA 2VHXA 3JAKA 2Q8PA 3KEMA 4GXQA 1TJ5A 3K32A 3QG5A 3ECCA 4U39A 2ZWAA 2YHIA 1UXGA 4FX2A 3RYFA 4P4LA 3W8EA 3WLOA 1QGOA 4RZ2A 5JLJA 2CLSA 3ZCQA 1PBNA 1SG0A 5KNCD 4HWPA 1CF4A 3VAAA 3FRIA 3TW8B 4NMWA 1PJ4A 2HZ7A 3PVZA 4NFLA 2CLKB 3OT1B 3WSTA 2BUBA 2ZR8A 4A73A 4QT4A 5KJFA 5KAMA 1U1IA 1UPAA 1JR6A 2D5LA 1MO3A 1XXHA 3LUPA 5BSHA 1R64A 1SN7A 2AKYA 2RKOA 4GPIB 1G20A 1VE1A 4HAUA 1MQ8B 4AZ0B 1HNXB 1WHSA 4ER0A 3NIDB 5G02A 5BYBA 2VJDA 4HNUA 3EZ6A 3FE2A 4MS1A 1QP7A 3DC2A 2SECE 2MCFA 4KWTA 3E5MA 5BSUA 2ZDHA 4MI9A 4ZT2A 3VR3A 1GPYA 1CBUA 4ZMSA 3ET4A 1EK6A 4YMLA 2C4MA 5EMKA 1JB1A 4PX3A 3AG6A 3CR8A 4X1KB 1ZG3A 1U8AA 3GJXC 4JP5A 3WWDA 2C07A 3EFHA 4PAWA 2PS0A 1C41A 3H7AA 3I42A 2I99A 2PPVA 3COPA 4BQOA 1CS0B 1FLVA 2YJZA 1NMYA 2MOKA 3H0KA 5AQEA 3WV4A 4BMPB 3VPGA 1IXKA 1ZX1A 4RTMA 1X15A 1HH4A 2Z58A 3BFXA 3IJPA 1TEHA 4RJJA 3K09C 5CGZA 3KV3O 1H1TA 5J2UF 1P1FA 3TIXB 2C4TA 5A7GA 3S44A 1GRRA 3DR5A 2DB3A 2B1JA 3KOUA 4MUNA 4TT3A 5LPNA 1ICIA 1UDXA 3NYIA 3MUFA 2KBFA 3GK3A 4PG7A 1LEHA 4V02A 4CKBA 5L40A 1M8PA 1LFDB 1QR2A 2IXAA 3LX5A 3ZNQA 4B47A 5B3JC 3NDRA 1IATA 2QWXA 4RH1A 4DJAA 2X3UA 2JATA 4Z4GA 1UKZA 2R11A 4BNLA 4LRTB 2J0UA 5LDGA 1V47A 4ZYVA 1QAOA 1VXRA 3GLKA 2RKBA 3QUAA 4LCJA 5KNBA 2IZ5A 4UOQA 2O7RA 2VP6A 4HXEB 4KGZA 2O07A 5K3BA 3ZZMA 1F8FA 4F38A 3E61A 1XKXA 3WA7A 1NBWB 3LCCA 5C1OA 4DLUA 2G70A 1P6UA 5KX5B 1V5WA 4U3JB 3JALB 1YQUA 4L57A 2H1HA 4BKOA 1TC2A 4V0OA 4FM9A 5LQJA 5DT9A 5EC8A 1ND5A 1ADJA 4RCYA 4XB6B 5HX7A 3GRFA 4LY3A 2C29D 1IG3A 1TIBA 3CNBA 4OXNA 7MDHA 2QRVB 1F2TB 2GUGA 5JEDA 5KNCH 1LDEA 4FS3A 3TOZA 2BRUA 3BD6A 2ZUTA 1I5OA 4HDNA 4MCIA 1C7QA 4L76A 3BSFA 2Z95A 3G6WA 5BSGA 1DAOA 2FFJA 3JU3A 1UBLS 3B8HA 1J0BA 3O75A 4ZQEA 5EZ5A 4A0SA 2R8BA 3C3MA 3RWBA 4IH9A 4AF6A 1R0XA 3G9XA 3H42B 5FI3A 2F1IA