2ZYDA

Dimeric 6-phosphogluconate dehydrogenase complexed with glucose
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
464
structure length
464
Chain Sequence
KQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 169
structure length 464
sequence length 464
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zydA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zydA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zydA01
1ONOA 1EQUA 2Y0DA 5ICSA 3RUAA 1T2AA 4P8RA 5IFLA 3JQCA 4RLHA 2W98A 4OXYA 3FR7A 4GX0A 2ZYDA 2NU7A 5DT9A 3H9QA 1PJLA 1MXFA 4UVEA 4C7JA 2FPGA 1DJNA 1T2FA 2C82A 1PWXA 2NUAA 1JKJA 3KSZO 3IP3A 2G1UA 1X1EA 2YDXA 4XZ3A 1IE3A 3PQFA 2VHYA 2X0IA 4P38A 5CG1A 1FDUA 3TQHA 4K6CA 2X8LA 4XDYA 5B4UA 4BUCA 3ZNOA 1D4FA 4CQMD 3FBGA 1O0SA 4XRGA 2C0CA 3LQFA 4IMRA 1N1EA 4Y6PA 4DLLA 2VYNA 1E7QA 1PJTA 1LTHR 3FPCA 3I9LA 5DBFA 5GMOA 4JJIA 1QSGA 1E3EA 4XGKA 3L6DA 3DTYA 3JQFC 4CLRA 2HRZA 2I66A 2DAPA 3PZRA 4FW8A 5IZ4A 3WMWA 4S1VA 3PWKA 5FI3A 1PQPA 3QWIA 3JQ6A 3RAJA 3TDKA 1F06A 3E6AA 3FBTA 3W6ZA 3I83A 1Y6JA 1KC1A 1U9JA 3QW2A 3HB5X 3H9GA 3KM0A 4PG4A 1KIFA 3GVXA 5EL0A 5A5EA 3H9UA 2VUSA 4UUMA 1EE2A 2Q2VA 2Q46A 5CDYA 3WYEA 3ADOA 5TF4A 3GF4A 4TSKA 3SEFA 3ZWNA 2OBYA 1T25A 1Z75A 2GO1A 2Z1MA 5IZCC 2HMUA 1ZKMA 1GPJA 4FOSA 1I01A 4NU6A 3CEAA 1QG6A 4LSMA 1I3NA 5AXBA 4YAEA 2Q50A 3H7AA 1PS8A 3V1TC 3PTZA 1PZEA 5L3ZA 4E2ZA 5U1PA 2IYOA 3JQGB 5AXAA 3UGKA 3ENKA 3EHEA 1DC5A 4HXYA 3JD1A 2VRCD 1I30A 4H15A 4JGBA 1GAEO 2O3TA 1KY5A 2NTVA 2BFMA 4QT0A 1Q0QA 3LZ6A 4R9SA 2D3TA 5HS4A 3PLRA 3AUSA 3GPIA 4MVJE 2CFCA 3WGOA 4YT8A 1XHLA 3PDUA 2NU9A 2B37A 2Y0EA 3GAFA 4JK3A 5ITWA 3GK3A 1ZSYA 1ZK2A 4HV4A 2IXBA 1GUYA 1LLQA 3PI7A 3AUTA 3ZWVA 2G76A 4A2CA 4BKUA 4HFRA 3RU9A 4UEOA 4CL3A 2OFPA 1UZMA 1WW8A 3JQBC 4JIGA 3QJ5A 3OJOA 1Z82A 3WGZA 4CLEA 3VOSA 1YQDA 4CM1A 4IDFA 4PGFA 4WNCA 2VQ3A 2RCYA 3Q2KA 3SLKA 3WMXA 3DFZA 3O8QA 1LRJA 1N9GA 3I6QA 4ROSA 3WWZA 4ZRMA 3HN7A 1OAAA 2GDZA 2J6IA 2CVQA 1DDOA 1M67A 1MUUA 4W6ZA 1M6HA 2D5CA 5B37A 5G0WA 4CMKA 2BGKA 3RWBA 4CM4A 3GOHA 1KEWA 3GMDA 3MOIA 5A4DA 1LDYA 2EP5A 4FCCA 4WASA 4TKLA 5CAEA 3KSDO 4Z3DA 2BFOA 3JQ9A 3Q6IA 2NVUB 4XYGA 5KJ6A 3BZUA 5MGBA 3NT2A 4FFPA 2PY6A 7MDHA 1GZ4A 3DMYA 4R1NA 3NDIA 1LSUA 4CM4B 3HSKA 2D4AA 3GGOA 5THQA 2FSSA 3PQEA 2VWPA 4JCOA 5TJ9A 2EKQA 3L4BA 3DTTA 4R3WA 1WDMA 4J1SA 1DBVO 1UJMA 4YRDA 3K92A 5G0SA 2B0JA 5L4LA 1BVRA 1BDBA 3B1KA 4H7PA 1IPEA 2HCTA 3OJFA 1UAGA 2QIOA 2V6FA 3HUDA 3LT4A 1CQIA 1XDWA 1E3SA 4Q3AA 4W9NA 1PR9A 5T57A 1Y8QA 4ZQEA 4CMEC 4XIJA 1BG6A 4RVFA 4BNVA 3WGQA 4J4TA 3UF0A 4D3FA 2Q1WA 1UXKA 5I9MA 3WNVA 3U09A 4B79A 1IPFA 1CF2O 4KUHA 2OORA 1BVUA 3ZW8A 2D5AA 1P74A 3WX0A 3PPIA 4XJTA 5JO0A 5KKCA 3BMOB 1E7YA 1BXKA 1LDGA 1VE9A 2QHXA 3C8MA 3PFFA 3KBOA 3IUPA 1AGNA 4NIMA 3ZNNA 1LJ8A 5LCXA 4JN6B 1ZW1A 4NPCA 1EEHA 3WIDA 4NHEA 4L73A 3ZHXA 1AHHA 4Z9XA 1YBVA 5K9ZA 1Q2XA 1YGYA 1YWGO 3GVHA 3M1LA 3AFMA 4R4JA 1LXCA 3KVOA 3BMCA 4YJGB 3DWFA 1UAYA 3GG2A 2NQ8A 3HFSA 4FJ2A 3ZV5A 4RV9A 1UP6A 4JXKA 5KVSA 3DBLA 1K6XA 4ZD6A 4MVJP 2YFQA 1B14A 5BT9A 5HRUA 4L4RA 4FC7A 3MCVA 5GZ3A 1YL6A 1RKXA 4KWIA 3BMCB 2VZ9A 4XGNA 4FBGA 2GN8A 4IDEA 4YVFA 3DBLB 3PXXA 3JQGA 1NAHA 3HJAA 4WCDA 1R0KA 3DO5A 5EIOA 4HFJA 1Z45A 5KJCA 4GX5A 3WJ7A 3D64A 1C14A 5DCWA 5JCJD 5KVCA 1KYQA 3WG9A 2YHUA 2JFHA 3NTQA 4DYVA 1BW9A 1P1JA 3C85A 5I7FA 3G17A 4BNIA 2G5CA 1NHWA 3AUAA 4B8WA 3EC7A 4GGOA 1YOVA 4NJMB 5COBA 4OL9A 4KQWA 1YL5A 4QX6A 2JHGA 4NDNE 1JWBB 1U7HA 4UVDA 5LC1A 3KETA 5TT1A 4RVGA 3FPLA 4PG6A 5KCZA 3ADPA 1NAIA 4FJ0A 1A7KA 2ZJ1A 3E82A 4PVCA 5C5IA 1ORRA 1ZSVA 1E3JA 1X15A 1HT0A 4A27A 3EZYA 2X6TA 1YOVB 4BNTA 3WGGA 4WEOA 1WWKA 4K1LA 3BTSA 3GZNB 5EINA 5TT0A 4N5NA 2G82A 3ORFA 1GUFA 4MVJM 1H94A 1XGKA 4PLFA 3PHIA 3BHMA 3UVEA 4GVXA 4L8VA 4WUVA 4AJLA 4J2OA 5COQA 4N54A 3JQAB 4UUOA 1PZHA 1ZSNA 4JBGA 5ES3A 4IQGA 3EZLA 3JQ7A 5IXYA 2IYPA 1ZVMA 4BKPA 2IZ0A 1PZFA 1SPXA 3ZU3A 5U4QA 2VRCA 1C3VA 3VH1A 3AU9A 1O8CA 4EYEA 4OO3A 1J4AA 5L51A 3ZGYA 2HU2A 2VN8A 2VZ8A 3PRJA 2X0JA 4DYDA 1BMDA 1QR6A 1ZO8A 3GR6A 1V3VA 1EE9A 4YAJA 3LU1A 1P31A 4CMCA 3ZI0A 3LLSA 2X22A 4B7CA 3DFUA 2PK3A 5B4VA 1HDZA 4RPJA 5TX7A 2PD6A 4IPTA 1A71A 1RYDA 2ZTMA 4NQZA 1ZXLA 2GYYA 3CUKA 1WZEA 2C5EA 4HP8A 1P1KA 1ADGA 2WD7B 4IDDA 5L53A 2Q4BA 2XOXA 4K9DA 5KVVA 3JYQA 4O6VA 4WLNA 4R9RA 1A7AA 1C1DA 5K0ZA 2AEFA 3QQPA 2NVUA 4KOAA 2V65A 4B7XA 5JDIC 1FDTA 3DAFA 3N7UA 4B4UA 4GMGA 5JYEA 1XIVA 4ITUA 1DLIA 4BNFA 1PS0A 1H2HA 1PSDA 1V0JA 4GMFA 4YJFA 4BQRA 4ESOA 1LRLA 3R0IA 4IZHA 4A7PA 3FD8A 1SEPA 1JN0A 4KMSA 5DOZA 3ZWXA 4E2YA 3I3OA 3L6OO 4M89A 3SBOA 1XQ6A 2DTXA 3GA0A 4DIFA 5TLSA 4LCJA 2YHIA 1DRUA 1EQ2A 1ISHA 4L4SA 1B3RA 2E4AA 3INRA 4Z0PA 1DIRA 3VAZA 3ZU5A 4IGFA 1I3LA 5KJFA 3FR8A 4DQXA 3PHGA 1AUPA 4RL6A 2CDAA 1TI7A 1V3UA 3K2EA 5GY7A 4P4LA 1PJCA 3ULKA 4WCFC 8LDHA 3AOEA 1ISMA 1EVJA 1EDOA 3SX2A 2I3AA 3INTA 2B35A 4E13A 2PD3A 2R2GA 1ML3A 5G4LA 1CDOA 4XCVA 3CMMA 3ZV6A 1VI2A 2EWMA 4BOYA 4M1QA 2J5KA 2P5UA 2QZZA 3GC6A 1PGQA 1FDSA 4J9UE 1C0PA 4BO1A 1MGOA 4I9NA 5IDYA 1NTOA 4OSOA 5ICMA 3KLPX 1Z6ZA 2DQ4A 3QP9A 4RLSA 1HZZA 3SC4A 3Q9UA 3HNPA 4Q3DA 4GWGA 3F47A 1H6CA 2BGLA 3M2TA 4KWHA 3V2GA 1W4ZA 3HDQA 2W2KB 3GFGA 3U4CA 5H83A 1I33A 3NT5A 3PGXA 4Z0HO 1ISJA 1UP7A 4NBVA 5LDHA 4OKIA 3ICPA 1R15A 1XR3A 2ZQZA 3I9NA 5FFFA 4PLWA 4BNWA 3BMQA 3L4SO 1K89A 3F6YA 4CM9A 1HTBA 3LK7A 5JBIA 3O4RA 2VUUA 1MC5A 5CG2A 2H63A 2CNBA 4N7RA 5JY1A 4GSLA 3CPSA 2NV6A 4WK6A 1VC2A 1UXGA 2VOEA 3D4PA 4BNMA 4EJMA 4LVCA 3WBBA 3KEOA 1HE5A 1I2CA 2I9PA 4YQZA 1LSSA 1H9AA 3WSWA 5A04A 3H3JA 3PVZA 4A73A 2X5KO 3DBRA 3HN2A 5T8KA 1HWYA 1M75A 4U6SA 1T2EA 4R54A 1DLJA 1P9LA 2AXQA 4XRRA 1MFPA 3DOJA 2FR8A 1T4BA 3JQ8B 2XAAA 3AM3A 3ROKA 4PG7A 2EHDA 3DL2A 1HKUA 1HE2A 1JDJA 1ZMOA 3O03A 1GR0A 1F0YA 4GBJA 4OQZA 5ER6A 3IJPA 5JDCA 2Q49A 1GYQA 3QVOA 5JDCC 4OXNA 3F5QA 1ZK4A 5A9SA 1DJQA 2PH5A 3GZNA 2J3JA 4E2WA 1SOWA 1CRWG 5A9RA 3A9WA 3P2OA 4OKNA 3VZRA 1CQJA 1JA9A 2XPCA 3GVPA 4OQYA 1PGOA 1I10A 5F21A 3AFNA 4RF2A 4YDRA 5G4KA 1CERA 2R00C 3RBZA 1NX6A 2BELA 3ANNA 2PGLA 1EDZA 2X1HA 4HY3A 5ITVA 3GVCA 2WWRA 4WCFA 4BNNA 4NR0A 4DVJA 4DQVA 3RC7A 2O3UA 3E48A 7ADHA 4BMNA 1BSVA 5AVOA 2GGSA 1EBFA 2EV9A 1P1FA 4XQ9A 5EQFA 1YQGA 3ITKA 1TLTA 3GDFA 4WJZA 1XLTA 1O95A 3PIDA 4YJFB 4DL9A 3JQFA 4NI5A 4YT4A 2OL4A 2VWHA 3ITDA 3WIEA 2C59A 4BS9A 4Z3KA 5JMPA 4HKTA 4DGSA 4MP8A 4HX5A 4W99A 2P68A 3JCZA 4WGGA 1WZIA 1NAYA 1DC3A 4QFDA 1NFFA 4CM5A 1ZFNA 2YDYA 4EEZA 4B3JA 4BKQA 2PV7A 4I5DA 1JQBA 1U2DA 2YW9A 3D7LA 3M2PA 4DTIA 2OP1A 4OH1A 3LC7O 1R16A 4H3VA 4I5FA 5L9AA 3A06A 4NBTA 2EKPA 3OJ0A 4URFA 2GLXA 3VH3A 1ENOA 3BHIA 3G0OA 4QECA 1DAOA 4RVHA 1DFHA 5CFZA 1W73A 1U28A 4YRAA 4R5HA 4YAGA 2X9GA 2BGMA 3MZ0A 3FTNA 4F46A 4HADA 4D7AA 1R37A 2EP7A 2I99A 2OOSA 3GT0A 4U6QA 4DA9A 5I8WA 4PLPA 3ONDA 1DRWA 4I5GA 3GHYA 3DHEA 4Q3CA 2GCGA 3FTPA 3I52A 1ZK3A 3KYCB 3IS3A 4MINA 3L07A 3QLJA 1SBYA 4O63O 4CV1A 1Q7GA 4TVOA 3ON5A 3COSA 4CUKA 3IKVA 5F5NA 2EJVA 3Q9NA 2CMDA 3JTMA 4K6FA 4DBZA 4ALNA 5IF3A 2BKAA 3HB4X 1Q7CA 1P1RA 2ZB4A 5JPIA 1DB3A 3KO8A 1O5IA 1WP4A 2QW8A 4IUYA 1I32A 3VPXA 3K96A 1D8AA 2OGUA 2Y1FA 5K6AC 4I5EA 4NBRA 1DIGA 4QXMA 4ZVVA 4PG5A 2DBZA 3LDHA 4TRRA 3WLEA 3MWEB 2J5QA 5I7EA 1JWAB 1KY4A 1LLCA 5JFOA 2GSDA 4DQUA 1X13A 4LN1A 1QYXA 5CEFA 3DBVO 2WJPA 3AJRA 2Y1EA 4BO8A 3DZGA 3G79A 2CF6A 4MKRA 4CQLA 2ZKLA 1WMBA 3AI1A 3ONFA 5JS6A 1GZ3A 3NGXA 3DBRB 1GQQA 1B26A 4RORA 1B3BA 2H6EA 1A4UA 2ZB3A 3DZIA 4EUEA 2VYVA 3ASUA 4UUNA 3KOUA 1LC3A 4CM3A 4CM8B 4RO0A 3RFXA 1VL0A 5L45A 4LSWA 1B8UA 4JP3A 1VLLA 1E3WB 4M55A 3RASA 1ENZA 1T2DA 3ZH2A 3BAZA 2CF5A 5ADHA 5JXWA 4ALKA 2GN4A 2AE1A 3WGHA 5JO9A 1E3IA 4CMHA 1FF9A 1MG5A 1KC3A 5HM8A 1LLDA 5I7VA 2O7QA 2D0IA 4J9VA 4N18A 5A9SB 2Q1UA 1X0VA 2O7SA 1B7GO 3PJEA 1VJ1A 2AE2A 3EDMA 1SNYA 1LEHA 1K5HA 4FJ1A 1E7MA 2WYUA 4FIZA 2C2YA 3P7MA 3JD3A 5G4KB 4YJDA 3EAGA 3UUWA 1GPDG 2QX7A 2EXXA 1G1AA 3DBHB 4EEXA 2AQIA 4QQRA 1U7TA 2HJSA 4P22A 4UVGA 3VDRA 4YR9A 2EG9A 5C37A 3MWDB 2C20A 1Q0LA 2RH4A 5B1YA 2ZK7A 3GHHA 2F1KA 1ZEJA 3PIIA 5TSDA 3D3WB 3UICA 2GZ2A 4E3ZA 3H5AA 4ALJA 1PJ2A 1U3VA 1R6DA 2Q1SA 1ZCJA 1Z73A 3CIFA 1MXHA 4ZQHA 1P3DA 4L4XA 1IL0A 1VL8A 2H1SA 3OBBA 1U4SA 4W82A 3CTMA 5CDUA 4XR9A 2R6JA 3F4BA 1B2LA 5KVQA 2OZPA 3QIVA 1HDRA 4DMLA 3IOYA 2RHCA 8ADHA 2V6BA 1Y81A 2VUTA 2J3HA 1XELA 3ZHZA 2QQ5A 4IGEA 2BMAA 3ONEA 1YO6A 5DF1A 2Q1TA 3F3SA 2WEKA 2FN7A 4MP6A 3RD5A 3OFSA 4ZJUA 5TGDA 2GR9A 4E2XA 1R0LA 4LMRA 5CPBA 1QYCA 2X86A 3DZJA 4HFMA 3VZSA 1XKQA 3ZU2A 4A5OA 4CLDA 4RDHA 1UXHA 4O1MA 4CMBA 5KWEA 1B0AA 4TZTA 1UDBA 1VM6A 2ZCVA 2V6MA 4ZRNA 1B15A 1YDWA 3VPFA 3LT1A 1N8KA 5EN4A 3LVFO 3KV3O 2Y1DA 4II2A 4GGPA 2WSBA 4YJHA 5B4TA 1TT5B 4MIOA 4YTEA 3TL2A 4I8XA 4R3NA 1NFRA 3OQ6A 2GERA 4TRJA 4BNGA 2O2YA 4WOKA 4E5YA 3FF4A 3HDYA 1WLYA 2CSUA 3ABIA 5JAMA 3BMNB 1GADO 1T1RA 4OM8A 2YHIB 3C7AA 4IDAA 1SC6A 3RCBA 5KJEA 4GL4A 1HF3A 4BMSA 5T67A 5C7IO 2NVWA 4MKXA 3LLVA 3LYLA 2POQX 3SJ7A 4U5QA 1X0XA 1SMKA 4QEDA 1JKFA 3TZHA 3JSAA 5ILGA 5BSFA 2LDXA 2DTEA 4UUPA 2X9VA 3WQSB 4XX0A 4HNHA 4J0FA 3IL2A 5JCJA 3AOEC 5L7YA 1Y5MA 4RPGA 4BNXA 2VCYA 3ZU4A 3GY0A 1ZXBA 2HMWA 4MO2A 1J49A 3BMOA 1B8PA 3GUYA 4FPXA 4NFSA 2XXBA 3I5MA 3CZMA 3UCFA 2YV2A 3AOGA 3OF2A 1YONA 2EGGA 4DIBA 1F8FA 3GNTA 3R3SA 4DUPA 4LRTB 4PFJA 5JLAA 3KYDA 4A26A 1YJ8A 5BR7A 4MPDA 3TJRA 2ZTLA 1PL7A 4FFLA 4N5LA 3DZFA 3A14A 3QY9A 4I9HA 3ZWBA 3QVWA 4EZBA 4IIVA 1U1IA 4OHUA 1QYWA 3H4VA 4BB5A 4CR7A 1BXGA 3WGIA 3I6IA 3LT0A 3S2GA 3WYBA 3NJ8A 1HZJA 1IY8A 3FRJA 4OYRA 2HAEA 1KETA 4XQGA 3V8BA 1SB9A 3I9OA 3ZWYA 5C3MA 3E9QA 3TFOA 5H81A 1E3LA 1MV8A 4RQTA 3RFVA 2IRWA 3DBHA 1Y9AA 3GGPA 1E3WA 4RVUA 3TPCA 1KVTA 1JW9B 1LLUA 3CMCO 3E9MA 3ETGA 3D4OA 2GZ1A 4OGWA 1U3TA 2P9GA 3GAZA 4ZHSA 2EW2A 1HEUA 1PS9A 1L7DA 1QLHA 3RJ9A 2HMVA 2AW5A 1RWBA 4PIVA 1KEPA 3LC1O 4CV3A 1HDYA 2VHXA 5FWNA 1G0NA 4UVIA 2HLPA 1ZJZA 1FMCA 1ULSA 4MVJH 3X2FA 4J43A 3D3WA 3MJ4A 3CE6A 1GFSA 4WE3A 4GSKA 1P0FA 3AY3A 2IEDA 3DMTC 3FI9A 1JKIA 4WNIA 3RJ5A 4RGBA 3JYPA 5I7SA 2C29D 2X5OA 3GQVA 2HK7A 1KVQA 4AJJA 3P19A 5EJ2A 2QYSA 1CEQA 3H2SA 1E7SA 2VHVA 3NJ4A 5HS6A 3QWFA 1QP8A 3VC7A 4JBHA 4WECA 3VZQA 5JC8A 3QV1A 1PQWA 2BI7A 3ZZNA 4CMJA 4DMMA 1T26A 4R69A 2E6UX 3AY7A 3AW9A 3QVXA 3B1FA 3KTDA 3ZV3A 2CZCA 3CZRA 1YBAA 1UZNA 4J91A 1NWHA 1Y8RA 4ID9A 3K31A 3PEFA 1WXDA 3I9KA 3M6IA 5HBRA 3EMKA 2PKQP 1E6UA 5DN9A 3FNEA 3M1AA 3NDRA 3WGTA 3ICCA 3HHPA 4BO2A 3BXXA 1M6WA 3MJVA 2AQKA 4X54A 2HKIA 1N7GA 1DOHA 1U8XX 2Q45A 4W4TA 4XYEA 3C7CB 2JCXA 4CMIB 4YAKA 2B69A 1H9BA 1HYEA 3HDJA 3JV7A 4P4NA 4PRLA 3K2BA 3OA2A 5IDQA 5A3JA 3WNQA 3A28A 2FMUA 3QVSA 3PJGA 2FR1A 3VZPA 1H0KA 1W8DA 3E1KA 2YQ4A 5IN4A 5KIAA 4QSMA 6ADHA 3ROQA 4TKMA 4E4YA 2DPGA 4BNZA 4IM7A 3RUEA 3H6KA 4LW8A 1TXGA 2H9IA 3EK2A 1N5DA 1KEVA 2IZ1A 3C3XA 4B4OA 4IXTA 2PGJA 1C0KA 2VT2A 2PKQO 3OEYA 4I1IA 2Y93A 3FWZA 4QUKA 1UDAA 3AUUA 4TWRA 2A94A 1EFKA 1BHSA 1LBEA 2C7VA 4DBVO 1DRVA 2DKNA 4BGEA 1NR1A 1NVGA 3OIGA 2O4CA 4JNKA 5T8KC 4RF4A 4RF3A 2BFPA 1QYVA 2GASA 3N58A 4XJSA 1RYEA 1N2SA 1R4MA 3GNSA 3ZDFA 4Q9NA 4OAQA 1Y8QB 3ZWPA 3S2FA 4EGFA 4R16A 1HSOA 4DPLA 4YEDA 1JAYA 5EQDA 4O0LA 3TOZA 3X2EA 5JSFA 4E21A 1YBMA 2P91A 2FOIA 2ZYGA 3TZQA 1UR5A 2JJYA 2Q3EA 1DC4A 4IBOA 3NKLA 4PLHA 3VTFA 2B5WA 1GQYA 3PK0A 1I8TA 1ISFA 1KS9A 1I2ZA 1IB6A 3DXFA 3PWZA 4NK4A 5DBGA 1EVIA 1LDBA 1HRDA 2C07A 1XEAA 4CL8A 2UV8A 5C7LO 4NFYA 3WJAA 4AFNA 1QV6A 3NDJA 1A9YA 3BYZA 4MVJD 4PCVA 1A4IA 3U9LA 2GUGA 3JQBA 5TQVA 4PZCA 4DWVA 3KYDB 2AA3A 2GNAA 4TVBA 1EZ4A 3TF5A 1VL6A 1Q1NA 3GFBA 2J5RA 2FHSA 3GDGA 3QWHA 3G3EA 4IJKA 3RBXA 3AU8A 5CP8A 3ZV4A 4J16A 1P1HA 3TSCA 3WQQA 5TJHA 1ULUA 5JAIA 4Q39A 3ETDA 5F3RA 2B36A 4P4GA 1OOEA 2VOJA 3VPSA 3BTVA 4BO4A 3RUCA 4XA8A 4NFHA 1TT7A 5KNLA 4E12A 3E5MA 2ET6A 3Q0EA 1ENYA 3W1VA 1UH5A 4E0BA 3ROMA 4J4BA 1T24A 1PR3A 4PLZA 1C1XB 3B20A 4NG5A 4D0RA 4RPKA 4DLBA 1BDMA 4E30A 4AJIA 4IS2A 3I9JA 4NJMA 3FWNA 5AXCA 4XQEA 4JQCA 4FB5A 2Y99A 4NBWA 2GN9A 2DBQA 1A5ZA 5DBIA 2ZTUA 1K6JA 5EESA 4YT2A 3BHJA 1X14A 4DXHA 5DULA 1CWUA 3OETA 4FFNA 3AY6A 3OIDA 1H6DA 3GRPA 3WB9A 5GZ1A 4LGVA 2IXAA 1ZMTA 2TMGA 3H9EO 5FF9A 3U3XA 4PN3A 4ALLA 3GMSA 5DOVA 3HADA 4R5MA 1NYTA 5AOVA 1VJ0A 3GN1A 2E49A 3O38A 5L7WA 1PIWA 4ALIA 3GZ4A 4F6LA 3KRTA 1YE3A 1D7OA 3FNFA 3H2ZA 4M49A 4GX1A 3U4HA 1NXQA 4XYLA 5ILOA 1NM5A 4EITA 3HG7A 3UW3A 4CM6A 4D0SA 3WFJA 1CIVA 4FFOA 4AJKA 4DREA 5B12A 1ENPA 4RPHA 2WD8A 1GEGA 2FWMX 4DIOA 2E82A 3SXPA 4O5OA 1EK5A 4WLUA 1LSJA 4M54A 1HSZA 5J23A 2Z5LA 4DPKA 3CINA 4K28A 5JAQA 4AICA 4CMIA 2RBEA 2C54A 1YKFA 2UUOA 3K9QO 3SJUA 1NQTA 3JQAA 3PP8A 3UCEA 3H8VA 5KTKA 3I4FA 2Y68A 2ILTA 4EUHA 1E7WA 3H3FA 2RAFA 3WDSA 1VPDA 2A35A 1C1DB 2OP0A 1LA2A 4XGIA 2Y66A 3ASVA 4TROA 4CV2A 1OMOA 2YQ5A 1PJBA 3MEQA 4RZIA 5G0VA 4BNKA 3T7EA 2E48A 1VSVA 1DHTA 3ZWOA 3W4KA 2P2SA 2OMEA 3K6JA 4OSPA 3V1UA 1RM4A 1JAXA 4J1QA 4E33A 2E37A 3OP4A 1E0DA 5G2OA 4B4WA 5AXDA 1OFGA 3QWBA 3DZHA 3GEDA 3DZBA 2BH9A 4OMUA 3TL3A 5HA5A 1IYZA 1NPYA 3OQBA 4PZEA 4PLTA 3QA9A 4M8SA 4IZIA 1B8VA 3U0BA 3W8EA 2QZ9A 3JQEA 4G65A 3DONA 4BKRA 4ZGWA 1G0OA 4N5MA 4ZICA 1Y7TA 4QTZA 4KUEA 3NTRA 2X4GA 4I08A 1KVUA 1LX6A 4IS3A 5TS3A 3DZKA 1PTJA 4ND5A 4CLXA 2XF8A 3T4EA 1WMAA 4JP2A 3UH1A 1D1SA 1R66A 5JE8A 3LC2O 1Y9EA 3V2UA 1OC2A 5JAZA 2AHRA 1PU2A 4CLRB 1DC6A 1AVYA 3E03A 3GLQA 1Z7BA 3OMLA 1O89A 3S55A 1EVZA 1ID1A 2PZKA 2EJWA 3FSRA 2DBVO 2W2LD 1NVTA 1SAYA 2YJZA 1DFIA 5LDGA 5BSEA 5EMHA 4A10A 1NWCA 2W2KA 4CODB 1GYPA 3AI2A 2B5VA 3WR5A 2PZJA 3TZCA 2HDHA 2DU8A 1J5PA 1MG0A 4Y6SA 5DDIP 1MB4A 2W2LA 4BV9A 3TWOA 2PA3A 3F9IA 4JJFA 4IXWA 3CH6A 3QRWA 2VZ0A 3PJFA 4L76A 5ENDA 3IAHA 3QWAA 3NV9A 4A0SA 1ARZA 1NBOA 2YZ7A 2VTEA 2D59A 2O3RA 3RU7A 2Q2QA 1XQ1A 3VPHA 4CM8A 5HTOA 4R41A 3HWRA 4A03A 2ZIZA 5FYDA 2CUKA 1QLJA 1DFGA 4MVJI 2XXJA 4IDBA 2DVMA 1P44A 4NBUA 3AM4A 4AJ2A 5IG2A 3WQRA 4TRMA 1GEEA 3ZN2A 3HDHA 2P9EA 1LDNA 1C1XA 3U5TA 1BXZA 3F1KA 3A4VA 2AMFA 1N7HA 4IQ0A 4INAA 3VKVA 3L9XA 1HE3A 1NR7A 4J6FA 2PR2A 4B3IA 2PZLA 1KVSA 4JROA 2NADA 4KDFA 1SZJG 2CVZA 1NPTO 3N74A 2UDPA 1EK6A 1U5CA 4WLEA 1PL8A 4CMEA 2FR0A 3WS7A 4D43A 3ZWWA 1Q7BA 2IE0A 4RF5A 2O2SA 3DAPA 3LSYA 1U2GA 1X7HA 1Z7EA 3C7DB 3TN7A 1E6EA 3CSDA 1HL3A 1I3MA 3JYNA 4HUJA 3NGLA 4MKZA 3K30A 5DP1A 2NACA 1EUDA 2HMTA 4XB1A 1SEVA 3KLMX 2CDBA 3RQSA 2EIHA 1PJ4A 3WFIA 4G5HA 1XSEA 4D79A 4LMPA 4FGWA 4GPD1 3OEWA 5CDSA 2EKLA 2P4QA 2HMSA 1DEHA 1PQUA 3H65A 4E6PA 2PTGA 4CR8A 1F14A 4CQMA 4FFMA 3ANMA 3RC2A 1SCUA 1VJTA 1FK8A 5BSHA 3L0DA 4MVJA 2GPTA 3B70A 3PHJA 4XR4A 1V8BA 3JYOA 1W6UA 3LT2A 3ROPA 5I9LA 1NP3A 1I5RA 4YQYA 1N92A 1K2WA 3ZWCA 4C7KA 4IJWA 1RM5A 3SLGA 4CQMB 2VWGA 2PWZA 4FR5A 3VHRA 2X5JO 1TVEA 1UDCA 2DFVA 3OJEA 4UEJA 1KVRA 1V6AA 1MX3A 1W0CA 3AM5A 3GEMA 5MDHA 4UREA 1P1IA 5ENVA 3QHAA 4Z6KA 1UUFA 1GY8A 3HQ4O 3I1JA 5IAAA 2DFDA 4F45A 4B4VA 4MJLA 4KUGA 4MP3A 1YH3A 4XIYA 4D41A 4BNHA 3T4XA 4J3FA 4YRBA 2FPIA 4ONEA 4EI2A 3PFWO 2EERA 4XD2A 4R01A 1TT5A 3GPDG 3ZNPA 5G0TA 2I6TA 3GUCA 2X0RA 2RIRA 5F1KA 4R1SA 2O3JA 2AG8A 2JAHA 3UKOA 2OO5A 4BKOA 2GZ3A 2QRKA 4Y9DA 4J7UA 4NJOA 3VKUA 5BNTA 3LF1A 1O94A 1ZBQA 4JLWA 4D3DA 1E92A 4JBIA 4YB8A 3JQDA 2VNAA 3D4NA 3ENNA 3WGYA 2AEMA 3BTOA 5BQFA 4BO7A 3STHA 1JVSA 4EJ6A 4PZDA 4FC6A 1C0IA 3Q1LA 4FOOA 1UXJA 4AG3A 1EMDA 2VHZA 5L7TA 1T4DA 1UXIA 3AI3A 5A1TA 1E5QA 3WLFA 2DBRA 3V1YA 3I23A 5KJ1A 4AJPA 2B4TO 3B1JA 3PQDA 3GVIA 3UHAA 3E9NA 5F1OA 1PEDA 1YJQA 3PDJA 1I2BA 5F1PA 3WOHA 4Y67A 2OHXA 1IULA 4GI2A 3UCXA 4RVDA 2B83A 4WEQA 3ST7A 1P0CA 1I3KA 3QVTA 1AHIA 4UEKA 5IDXA 3ZNQA 4DRYA 2B4RO 3KUXA 4J4HA 3OM9A 5TRTA 3JQ9C 4LRSB 4B7UA 1PJSA 5AQ1A 3RUDA 2NLOA 3K73O 4OOFA 1E6WA 1ZH8A 1WAMA 3MJEA 4LCEA 1R12A 2D2IA 4NH4A 3F46A 4RDIA 2Q99A 2ZATA 3IQDB 3V2HA 3L77A 2G17A 3RKUA 3H5RA 3UXYA 1PZGA 2G0TA 2HJRA 4YPOA 5BNIA 2W4QA 1J0XO 3EW7A 3GNQA 4WOJA 1WDLA 1QKIA 2FY8A 4B8ZA 2JCVA 2NQTA 1F8GA 4CQLB 4CR6A 3CXRA 4W9NC 1P33A 4R1UA 4AJNA 5AYVA 4QO7A 2O48X 1RM3A 4UAGA 3JQAD 1IHYA 2P4HX 3RVDA 3QSGA 1F12A 5L4NA 2V6GA 1X7DA 3RC1A 5GZ6A 1BW9B 1YL7A 1LQUA 3E8XA 3IMFA 4ZQBA 3S2EA 9LDBA 4EJ0A 3JD2A 3GGGA 4ND3A 3OA0A 1T2CA 2BLLA 5G0UA 2P5YA 3BIOA 3MTGA 4IY1A 1NNUA 3H9JA 2Z1NA 5CDGA 3D5TA 1YB1A 2I67A 2O3SA 3HZZA 2RH8A 4L75A 1N1GA 4YWJA 2PFGA 2AQ8A 5DCYA 3C1TA 3IIEA 4Q3EA 2HUNA 5IXSA 1XA0A 2WMDA 3OH8A 3AWDA 4J1NA 3RUIA 4AJ4A 1HLDA 4FDAA 4FGSA 4NMHA 4BNUA 4D44A 2W90A 5DCUA 3JQ8A 4HBGA 1OC4A 4MVJG 2FRDA 3W4JA 5U9CA 2DM6A 3PLNA 5IN5A 1M66A 3INGA 1LDEA 4Z9FA 4B3HA 1M2WA 2QRLA 3G1UA 4BO0A 5L4SA 2NU6A 4AL4A 1V3TA 2BF7A 1J6UA 4ND2A 3UN1A 3NYWA 1R4NA 3D3EA 3P5SA 1UP4A 1Y8RB 4IQ8A 1ADFA 2YV1A 4IDCA 4ALMA 3T7CA 1RM0A 2WD7A 1UZLA 1LI4A 5C7OO 3UOGA 2JCYA 4H16A 4F6CA 2DC1A 2Z95A 1GL3A 3H5NA 1HYHA 2JFGA 3D1LA 3ZHBA 4YA6A 1VKOA 1HYGA 2DLDA 2O23A 4BGUA 1X1TA 1MP0A 1I24A 3ZCXA 3RC9A 4E5PA 4U8GA 1KEUA 1WVGA 5T5QA 3GG9A 1ADBA 4YACA 5THKA 3EVTA 3ZHYA 5TIIA 3PHLA 1U3UA 1B16A 4L0QA 1HXHA 4BMVA 3R1IA 1NHGA 4D42A 4YJHB 3MJSA 2YY7A 3WSVA 4ND1A 3C1OA 1U5AA 4WLFA 4E5KA 2C5AA 2HO5A 4QFCA 1AN9A 4GQAA 4J2HA 4RZHA 4DC0A 1QRRA 4IJVA 1YQXA 3FNHA 4NK5A 3VH2A 1L1FA 4R1TA 4FQ8A 3U4IA 4WPGA 2QG4A 1XG5A 5IZCA 2Y0CA 4CLOA 1F17A 1GZ6A 1ZEMA 4ZU3A 2PH3A 3EY4A 4GH5A 3FCOA 2BD0A 2VYND 3B6ZA 4XEHA 4CM7A 2JL1A 4BNYA 2AEJA 1K6IA 2IODA 5L40A 4W7IA 2I5PO 1JU9A 2BI8A 4ZQGA 4W7HA 4II3A 1R4MB 1ZZEA 2ZQYA 1FDWA 1C0LA 4CLOB 4CJXA 1VKNA 3RIHA 1U8FO 3RFTA 3OIFA 4G81A 1QMGA 2Q4EA 2NSDA 3RSHA 4O59O 4L9RA 1DXYA 2O3QA 3BTUA 3C24A 3FN4A 3KHUA 3C1AA 2I76A 1Y5RA 5A02A 3QE3A 3TOXA 3MTJA 3IUSA 2IDZA 4GLLA 4CV0A 3D0OA 4Z0TA 4PVDA 2I65A 4BV8A 4YCAA 2NVBA 3F1LA 3NTOA 2EEZA 1MFZA 1AXEA 4MDHA 1U4OA 1E77A 2NU8A 4YJGA 1IZ0A 4CLHA 3KXDA 2B4QA 1BXGB 1E5LA 4IDGA 2VYVD 1Z74A 1ZK1A 3JD4A 1V9LA 1AE1A 3FHLA 3EUWA 3RROA 4IMPA 1R0SA 2NM0A 4RJTA 4WKGA 4GAEA 2UUPA 1P45A 4QO8A 2PGDA 2NTNA 2HQ1A 3DR3A 2J3KA 1QXSA 3U62A 1E1KA 5JDIA 2JAPA 4U0KA 1YB4A 4L74A 1EUCA 3DQPA 2FP4A 1EUZA 4J1TA 1O9BA 3KB6A 3VH4A 4IJUA 3WXBA 3BMQB 4GWKA 1BTOA 2AG5A 2NNLD 4KTTE 5CDTA 1LQTA 4GKBA 3P2YA 2NWQA 1E1LA 2AQHA 4K26A 4Y8VA 3W4IA 5A06A 3VDQA 1NASA 4CM9D 4DLAA 1XWFA 2JD1A 3WBFA 4FFRA 5A05A 5KKAA 1DIBA 4XWYA 1P77A 4Q3BA 4NU5A 4U7WA 3RI3A 2QRJA 1ZIDA 3MOGA 3L4BC 2X7HA 4BNLA 4BGIA 1WPQA 5T64A 4ILKA 4J49A 4CPDA 3PYMA 3OSUA 3LF2A 1K0UA 2UVDA 1X7GA 5EERA 1L7EA 5TC4A 3NAQA 1NPDA 1R4NB 3SVTA 1RJWA 1D1TA 1ONNA 4YBZA 4ZQFA 3IP1A 4I9UA 2O4UX 3DHNA 1YS4A 1IOLA 3WTCA 1CYDA 2A4KA 4FS3A 4AJOA 5DNAA 1ISIA 4WCFB 4XYBA 1XYGA 5JMWA 2VHWA 1QYDA 2Y1GA 2QYTA 2YYYA 3RBVA 1FXSA 1SO8A 4CUZA 4EDFA 3CTVA 1GCOA 2JHFA 3WTBA 1DO8A 3DC2A 1M76A 6LDHA 1ADCA 4CMGA 4U0JA 2NTJA 5EPOA 1GQ2A 2D8AA 3PZBA 2YFHA 3D5QA 1CETA 2X0NA 2LDBA 4LISA 2DTDA 3F4LA 4KQXA 1ISGA 2C7GA 1E1NA 1LRKA 3V5NA 1KBZA 1TB4A 2Y1CA 3W8FA 4DPMA 1S6YA 2FZWA 5IJZA 2HK8A 1FDVA 4DC1A 1HE4A 5KOIA 2ZYAA 3O9ZA 4IINA 2WM3A 4AJ1A 4CMAA 1IZ9A 3A1NA 1DHRA 1GDHA 1YDEA 2RHRA 4J7XA 2UAGA 3OHSX 2X23A 4LK3A 3JYLA 2J8ZA 4BO5A 3W8DA 2R00A 3DOOA 4BNJA 5CHEA 4TMFA 3O26A 1FJHA 4D45A 2DPHA 1IUKA 1EFLA 1I36A 3Q3CA 2JD0A 1KERA 1U3WA 4NZ9A 3S8MA 5JYDA 2OUIA 4UVHA 1JTVA 3KYCA 1GUZA 4GX2A 3CKYA 1NQ5A 4JX8A 3U49A 5H82A 3TNLA 3G1TA 1HLPA 5A03A 1LC0A 1V35A 4BVAA 4KZPA 1XU7A 2O50A 4PRKA 1HDOA 1H6BA 2SCUA 2WTBA 1LU9A 2JKVA 2JD2A 1BRMA 3F5SA 3L6EA 1BWSA 1TEHA 1OZAA 1ONPA 4XKJA 1DPGA 1VRWA 5BSGA 1YB5A 1MLDA 2IEBA 2VNSA 3NRCA 4GVLA 1AXGA 4Y6RA 5TNXA 1NQAO 2I3GA 1A9ZA 2Y67A 2WYVA 1EVYA 4FN4A 1QORA 1CJCA 4BIIA 4E32A 3K5PA 5CEEA 1LSOA 1GTMA 3KZVA 1EBUA 2PLAA 4EUFA 4OJNA 2PKRA 2WDZA 3NUGA 4PLYA 3RUHA 4FD3A 1O6ZA 5HWSA 3I4CA 4C4OA 2VRBA 4E5MA 3EVNA 3L9WA 2Y1OA 3PYXA 2JFFA 2GF2A 1IHXA 5DZSA 4EBFA 3UAGA 1DIAA 1JLLA 1PJQA 2J3IA 4GKVA 2WE7A 3R3JA 1A27A 3KYBA 1H93A 3IC5A 4RCVA 1BGVA 2ZB8A 3NX4A 2OBNA 4XYMA 3WWYA 4ZN6A 2PNFA 1PGNA 4ND4A 1NVMB 5JCXA 1RPNA 5DP2A 3HE3A 4AJEA 3KSUA 1TA4A 3R6DA 1PGJA 3TFQA 3JD0A 2GD1O 2BHLA 2X58A 4G2NA 4BO3A 5FI5A 2HSDA 4M87A 1PGPA 2HK9A 5CPFA 1T1SA 5A3VA 4OIMA 5A5FA 1GU7A 2CVOA 3PYLA 3VVCA 4BO9A 2H5LA 1H2BA 1YRLA 2UYYA 1E7RA 4RPLA 3PHHA 1PL6A 3TZ6A 2Y05A 4HWKA 1NFQA 2DT5A 1PWZA 2VT3A 3G49A 3WICA 4J90A 4YAIA 4HNGA 4WLOA 4AJHA 1OX3A 3PGJA 3PJDA 3Q2IA 3ZWAA 2ZCUA 4BHTA 3OICA 5I9NA 4MIEA 4S3MA 9LDTA 1LDMA 1YVEI 4LVUA 4PLGA 3K8ZA 2F00A 3TRIA 4BGVA 4Z9YA 3EGOA 4NNJA 4MVJF 5JC1A 2CY0A 4TRNA 1WNTA 3BA1A 3OQ1A 4JJGA 5JW6A 2FZEA 3DAGA 5ER9A 3UFXA 3VPGA 4Y98A 1KOLA 1ZK0A 3ANLA 3WYCA 1ZNQO 1D3AA 1I0ZA 2TMDA 5COAA 1H5QA 3W6UA 3IJRA 4UULA 3DEYX 3ZWMA 2W8ZA 5JY6A 5IDWA 2GN6A 3AK4A 2EGHA 3ETEA 4D3SA 2WYWA 4ZA2A 3ZW9A 3KEQA 4OOEA 4J7CA 2EW8A 3DHYA 2ZTVA 4MIYA 5I8ZA 5K6AA 2A92A 5CEJA 4YXFA 4D46A 3VTZA 2VTDA 3RUFA 3OECA 3FNGA 2IZZA 2V7PA 1A72A 5A9TA 3HFGA 3RKRA 5JNLA 4PLCA 4YYZA 4E5NA 3NT4A 4R51A 1GV1A 1S7CA 1GYRA 3SC6A 2ZJ0A 1NQOA 3VVBA 4R68A 2BFAA 2D1YA 4OXKA 1OBFO 2DUUA 2YV3A 3GDOA 4F3YA 2DUWA 1XU9A 1DSSG 1E1MA 1SOVA 1DIHA 2P9CA 2ZB7A 4M86A 1G6KA 1Y1PA 1HDCA 3O8QB 1MA0A 4KTVE 2Q2WA 3S2IA 3JQ7B 2VWQA 1JVBA 1PX0A 4YT5A 1HETA 5BNFA 2A9FA 4XB2A 1LUAA 3MJTA 4BO6A 1GV0A 4XDZA 1VSUA 3NEPX 3IKTA 2WE8A 2EF1A 1YXMA 1Q0HA 3PWSA 1H6AA 1PJ3A 1QV7A 2FPPA 4MOWA 4GLOA 3MJCA 3GEGA 1WDKA 3IDSA 1LNQA 1OI7A 3DB2A 4RVSA 4HFNA 4WLVA 4E31A 1MC4A 3GH3A 2GRAA 3TZKA 2PD4A 4J0EA 5FEUA 3Q11A 4TZKA 1K3TA 1AA0A 3S1LA 3E18A 2CDCA 4CUJA 1HDGO 1N9GB 1GD1O 2C2XA 1HDXA 4RQUA 3U4DA 1SB8A 4IIUA 3DDNA 4EW6A 3OJLA 3GRKA 4AVYA 4BB6A 1ZJYA 3GN2A 1ZUD1 3I9MA 5F5LA 4BQPA 2CD9A 2YUTA 3EYWA 2HRBA 3E5RA 4TQGA 4PLVA 4PG8A 3DMTA 4XQCA 4KP7A 3DOCA 2FSVA 5T6BA 3BMNA 5L95A 1DAPA 1GCUA 4Q3NA 2X9NA 4FSHA 4BL5A 4KDEA 2BRUA 2OXIA 1XCBA 2PZMA
chains in the Genus database with same CATH superfamily
2XCTB 2GS9A 5IVIA 5ICSA 3GF3A 4J29A 3AF3A 4FE4A 5DW0A 3RUAA 4B43A 1KMHB 3A4YA 3JQCA 3K1YA 3KHTA 4OXYA 1I4LD 3TLGB 3U40A 3VNSA 4GX0A 2ZYDA 2VK8A 1XTQA 3ZLVA 4H08A 1QFXA 1ZBDA 1C9YA 1QEXA 1MB2A 1QNLA 4HWTA 1JB0J 2JBAA 4PO3X 3GRCA 3L41A 1SQPJ 1SOMA 1TVMA 4UVEA 2C82A 3QNUA 4KPFC 3L5OA 5T4BA 3D6MA 3NANA 5CH3A 3IAUA 3QELB 4JOQA 4RZQA 3NOXA 5ALNA 2QJYB 3R3YA 3IN6A 2FEXA 2KS1A 2JGLA 4MWTA 3I01A 2GNOA 3SD7A 4K6CA 3TQHA 1Y4ZA 2NZXA 2QDXA 1AKEA 3HXLA 1LFDB 5B4UA 1OLSA 5B2FA 2JBAB 2I4TA 3HCNA 1SQFA 1FSGA 2ETXA 3KAKA 5TXGA 1DEKA 2GHQA 2O5VA 1XN1A 2OXEA 1W88B 2ZTHA 1N8TA 2F64A 3CLUD 1EXDA 3GBSA 1YS7A 3MTEA 5ARDA 1IUNA 1GL6A 4TLAA 1NY5A 2N1BA 4FTWA 1ZRTD 3FPCA 1E7QA 1PHRA 1PJTA 5DBFA 2C7BA 5IAGA 1GILA 4FIDA 2NZYA 4X20B 1MX9A 3NXKA 2IFTA 3I37X 3L6DA 2V58A 1KYXA 2OGTA 1CB7A 3DTYA 3JQFC 2I66A 2XMSA 2YMLA 4G5XA 4QPPA 1JG6A 4CLRA 5HKOA 4S1VA 2K5UA 4MCJA 1LTIC 1H2RS 1XZNA 4GQIA 4N49A 1QGUA 2ST1A 3RAJA 3E6AA 4E07A 2GAOA 3EEOA 3W6ZA 2C9LY 1L4MA 1Y6JA 1GG2A 2J6HA 3N75A 4I4NA 1OFUA 4PZYA 1J1EC 1IK6A 1G1JA 5EUQB 5C81A 3A3KA 1KZ1A 5C4MA 4AQYB 3HTXA 3F6SA 2IKSA 4UW9A 5BMVA 3R3ZA 3H9UA 1P2FA 5E4YA 4GXQA 2H2HA 2IOHA 3HACA 5EJIA 2AHOA 5ALZA 2M32A 4LVOA 3THSA 4C0HA 4YPVA 2KIKA 3KQMA 1YR8A 5NLLA 3ADOA 2KK7A 2Z2IA 3DVAA 5EWMA 3BVHA 5TF4A 3ROFA 3O6QB 1W0JA 4QDUA 2HFKA 4Q37A 1M0EA 1Z75A 2E55A 2GO1A 1QO9A 1F6DA 2H8KA 2HMUA 4Y99C 2Z1MA 3TMAA 1I01A 4DLVA 2O19A 1D6MA 4JJZA 3CEAA 1JQ5A 5ITZB 3AFIA 5I8PA 1P4JA 3V8RA 3R7FA 4AUEA 2IDBA 1G3UA 1P2GA 2CLSA 2Q50A 4ZI7F 3FMVA 5BMVB 3ROZA 1PZEA 2C2GA 3C3PA 3GT4A 4HDKA 4KACA 5L3ZA 4B6PA 4B81A 4BFCA 1MMFB 3WLHA 1J42A 3KKOA 3UGKA 2DE0X 1XC7A 4KVZA 1GRCA 4HXYA 4JUDX 1BSNA 3S3TA 3SQOA 1TK9A 3QBTA 1YV9A 4H15A 4JGBA 1IQ0A 1OTHA 2JATA 4QT0A 4EQZA 1EAYA 3LZ6A 5KLIB 2JZCA 3KJQA 4FFBB 2B2NA 1M6YA 1QMPA 2YWHA 3O95A 5C31A 5INTA 4W5JA 3GPIA 1P6UA 1UKBA 2A33A 4N0EA 4W7SA 4EUKA 4BFVA 3WHKA 5KLVE 1SUAA 4YT8A 3KLBA 3OQMA 3B5NA 3KTFA 5FAXA 3KOXA 4N8DA 3ZOZA 3GK3A 2XCQA 4Z7QB 2FYTA 4I3HA 3EDRA 4HV4A 2IXBA 3A32A 2NUPB 1LLQA 2NPSD 1V41E 3BM5A 3MQ4A 5JMTA 5KNBD 1X7ZB 2QTFA 3AB7A 3PE3A 2FA9A 2CCKA 2R8OA 4A2CA 4HFRA 4QXPA 4HEA1 3RU9A 3ND9A 2ETVA 1CE8B 2OV1A 2OXTA 1OQAA 5KOJA 2WHEA 2PUTA 2XMDA 4CLEA 2DB3A 3WJ1A 3OPQA 3KKLA 3LUGA 1MOQA 1QDUA 4LIPD 3A05A 4PGFA 4WNCA 2X1MA 4XIIA 5EKUA 1DQSA 1UPTA 2PVSA 3I6QA 3O8QA 4OGLA 4TKVA 5JBNA 5A3RA 3B3QA 5AVKA 1F2VA 2DX7A 3G9ZA 3L46A 2I4IA 1DXHA 1MQAA 2GBGA 2QV7A 5FFMA 4B3BA 1J0EA 4B9EA 3F67A 2WQZA 3ASYA 4AP6A 1IJDB 1DDOA 2PG3A 2TECE 4TYPA 3TLJA 3SQXA 4Q01A 4P36A 4W6ZA 4RTJA 1U0OC 1OZHA 2B92A 5KOJB 1W2WB 1DAFA 3V1NA 3W5JA 4M3NA 3AEBC 3GOHA 1BE8A 3GD5A 4BC1A 5JH7F 1KEWA 2X3YA 3GMDA 1KI4A 1LDYA 3OWXA 2EP5A 4FCCA 4R2IA 2H4YA 4K87A 4UUBA 4WASA 4U7DA 2BUBA 3FMGA 3W04A 5A2GA 5CAEA 1L4GA 3R5SA 2XWPA 2FAXA 5BVGA 1QP0A 2VBCA 4Z2YA 2Z5FA 4XYGA 3WAJA 5IJXA 1AF4A 4FMCF 4G97A 4DGQA 1KWKA 3K7EA 4CL0A 2I29A 4RETA 4W5HA 3NT2A 1K86A 4FFPA 3T3GA 4C2AA 1IVYA 7MDHA 1KKLA 3ITEA 4BMOB 1SC1A 3NDIA 3RM3A 1TAUA 2GB4A 3GGOA 1MO6A 1IEWA 1KI9A 2JB9A 2FSSA 3IIKA 3PQEA 2PMBA 4FGJA 1CY6A 1YJXA 4JCOA 3U3KA 3GJSA 5TJ9A 2RKBA 3ER6A 2RJOA 3TI7A 1QJ4A 1JX6A 1Q81Q 2EKQA 2FUG6 4R3WA 3DTTA 5TPZA 4J1SA 1TKRA 1EVEA 2WY2D 2XECA 1DBVO 1UJMA 2JBWA 5L4LA 2VDPB 2H16A 3O4JA 2QE7A 4BY9E 4H7PA 1VQ4P 4X1KA 3OLCX 4CHTA 4LHEA 1IPEA 2G1PA 2BH2A 2FV8A 1DJMA 2EKBA 2BM8A 2DUMA 3GRFA 4EG7A 4WZBE 4BDTA 3HA3A 5AT1A 1H8AA 2FPMA 1HC7A 3HUDA 4EVRA 2I6UA 1JIIA 2EFEB 5HUJA 3FZEA 821PA 1SVNA 2J7PA 2QKYA 4F3NA 1VFNA 1UC4B 5FULA 3KD3A 4LDNA 2Q7OE 4Z49A 3NNSA 4D80A 1ZHOA 4IXNA 3LLCA 4GF5A 3ZGNA 3TNDA 2ROQA 2H2WA 5I9MA 4J0DA 2QV0A 2H43A 3U09A 2GTHA 1CF2O 2ODAA 5I3CA 5KLIC 1SELA 2OORA 2NUTA 1BVUA 1L3IA 4DRXB 4JSTA 3WX0A 3CNOA 4XJTA 5BYJA 5KKCA 1G21B 1ESNA 3BMOB 1H89A 1E7YA 2A6PA 3EVAA 1BXKA 3A0HH 1VE9A 2QHXA 2QT0A 4NIMA 3KBOA 2Q5LA 1PG2A 1ZGHA 4NY1A 2BDTA 1WXXA 5JCPA 1NM5C 2ZIXB 2PMEA 2X19A 4HVAA 3AVUA 2WUVA 1IN1A 4UDYX 1EEHA 3I5UA 1XZEA 1THGA 3MMPA 4NHEA 4L73A 2JGAA 3ZI4A 1H2XA 3UG7A 5FNVF 4X6XA 2YKOA 1N7IA 4HDNA 1A8SA 3EQ2A 1OKKD 3BMCA 1G21A 2PAJA 5AVUB 4FJ2A 5E0KB 2VPYA 4U4AA 1ZD8A 4PZAA 3ZV5A 1UP6A 5KVSA 5DIFA 3SE7A 3KZNA 4QL3A 4L4RA 3L72D 2OQQA 3U7JA 2PJZA 5K0GA 2AXTH 1TVCA 1U7PA 1NMXA 2JJ2D 3MJRA 3SSMA 3P45A 4ZPXA 3V97A 4BLPA 1E2BA 2H8GA 4A6EA 2V7BA 1I80A 1RKXA 1R27A 3BMCB 4KWIA 3D81A 1WT6A 1SQBE 1OWOA 1SVIA 3FNRA 1I51A 3FPBA 3ESXA 4FBGA 4L1KA 1UIRA 2RHJA 4EUSA 2ZS7A 4G1EB 4L2IB 3JQGA 1NAHA 1H0HA 4U2FA 1DUIA 2E89A 1OF1A 1RBMA 3VSCA 1H69A 5EFZA 3VKGA 4HFJA 5H4GA 4BTLA 3CUTA 3JR7A 1NN1A 3D64A 1C14A 3EEBA 4CG2A 4EY8A 3WG9A 4Y6LA 4DJGA 1Y3DE 4JC0A 4TL8A 1E6KA 3P9PA 2BGWA 3SVLA 1JDBB 1KO7A 1BW9A 2WI8A 2C83A 4BP1A 1PFVA 1O6FA 4RZ3A 3VJMA 3WDLA 1ZD9A 4B8WA 1JMBA 4GGOA 4ZANA 1SQVK 1U5BA 3TXAA 4DOJA 3V1KA 3W5IA 4C6TB 1EHIA 2XV1A 3PF9A 1JWBB 1NIPA 2GEUA 2YIDA 1V47A 3CCJP 1FAVA 4M9ZA 5K51A 3FPLA 4Q6BA 4CKYA 4HNQA 3NOQA 4K3AA 2AUNA 3CUWA 3H83A 4JB0A 4BX2A 3F5FA 3ADPA 1NAIA 2DHDA 3RYTC 3FIUA 4KC0A 1J5EB 2ZJ1A 2JI7A 1M0SA 3E82A 1NXTA 5CX4A 3O47A 3EPLA 1X15A 3IPYA 7YASA 4A27A 2GO7A 3T3EA 4CKCB 1U5BB 2ADOA 3M81A 5IUNC 1Z47A 1XP8A 4WUTA 3KPJA 2ZFUA 5AMXA 1JY2O 3GZNB 1R3UA 2XITA 2ZT6A 3CX5D 2H31A 3ZDMA 1NW4A 4MVJM 2A14A 3JALA 5FA6A 3VOBA 3ZXIA 1Y6QA 2I3ZA 5EZYF 3RYIB 1M74A 3PHIA 4K9PA 1HTTA 4FYJA 3TPZA 1KJQA 1YMUA 5FT9A 1SHJA 3UVEA 4E5VA 3TTYA 1EFHA 2OFWA 4GVXA 4X97A 3H1IG 1XAJA 3W5UA 5G41A 4HQ0A 3VP8A 4IL5A 3JQAB 1MF7A 1OXUA 4UUOA 1OX4A 3M6XA 1SUWA 2AOTA 4MLZA 1UOQA 3PX7A 4I2LC 2CLDX 3C15C 1WXEA 3FM9A 2A57A 3N0RA 4KGDA 4DLTA 3JQ7A 4U00A 1U8TA 3EGIA 3MYRA 5JD3A 4YMUA 3TNUA 1ZVMA 2IZ0A 4UAJA 3ZU3A 3HJFA 1VHQA 5I9TA 3R23A 2GFHA 3VH1A 2BEZF 1RAFA 5CBPB 5CCBA 1O8CA 4ANFA 3NIBA 4YIKA 3N8GA 2PSEA 2P6OA 5J2UB 4ZVRA 1OX4B 2VN8A 4QIHA 1FU4A 4DYDA 1UKZA 2OQ2A 4FU0A 4UHCA 3RF6A 2H57A 1QVRA 2X5NA 3I5AA 4IIXA 4LV8B 4EFDA 1FIUA 4CMCA 2X22A 3RTEA 3WGLA 2X8JB 3VSBA 4B7CA 1X9GA 2ZCJA 4K9RA 4A16A 3T3PB 3NJRA 2NPSA 3GV0A 1JI0A 2ONCA 4NYJQ 3KXLA 1A71A 3HJRA 3HUSA 1U2EA 4B17A 5CA0B 4YCLA 3OG9A 4YUZA 3WJ2A 1NQWA 3RFCA 1FOSF 1LVHA 2K88A 1IHDA 1WZEA 2B94A 1AUQA 1ZI9A 3JAKB 3IPCA 3LE8A 4NBSA 4IDDA 4UB8H 2HU5A 3OOWA 5BSVA 3AVVA 1PNOA 3JW8A 3G0CA 3TDNA 2BASA 2SICE 1MJGM 4C29A 1U1EA 1C1DA 2AEFA 1NF8A 2FMKA 2JH8A 1WV0A 2FGKA 2NVUA 2P4SA 2V65A 2ZAOA 3DE3X 4HWOA 3H1KJ 1RXEA 4B7XA 3DYBA 1YAJA 2JHCA 2G8YA 1WCXA 3LKDA 1RBZA 4KAJA 5CT6A 1Z0FA 5AIAA 1XIVA 4QQKA 1XAIA 5EHGA 5KHOC 2A1TR 3QM1A 2A9PA 3HM9A 1BCCJ 1Y4SA 4KO4S 1UOOA 3RRXA 4ESOA 4IZHA 4KMSA 1N2CB 4Z86A 5DOZA 4GZ3A 5KQPA 3VR5H 3TLMA 1UINA 1XQ6A 2DTXA 2HM7A 4DIFA 1D4AA 1AKRA 4ZCRA 5CM2Z 4KFUA 1DO2A 5C1OA 1W2HA 4BP3A 5KYXB 5KNDD 4U3FE 1IY1A 1I3LA 2ZGVA 3FR8A 3G2PA 1YQ3C 2VZLA 4EY5A 4BXOB 1EX7A 1AUPA 3KTAB 4RL6A 3V55A 1V3UA 4Y6OA 1NXVA 1DUSA 2WWHA 4P4LA 4UMEA 3T0FA 4WCFC 1AO0A 1H66A 4DQ0A 1N0WA 1TUBB 2QL7A 3D8BA 2OVBA 5HIKA 5LWHA 1SK9A 1G5PA 6GPBA 1ZI6A 3GLFB 2NZWA 4UCXA 3VYWA 4NPHA 4XX0B 3IT1A 3TIGA 4TWBA 5G4LA 1VKHA 3BEDA 4KO3S 2PBLA 3K1TA 3NBKA 2J9RA 3ZJ4A 4LTNA 1A5SB 1CJBA 4RVCA 3V2QA 2ADMA 3ZV6A 2EWMA 4EVQA 2IELA 3HNOA 4M1OA 3U37A 3KIPA 4YBRA 4ZEMA 1P80A 1JWLA 1FDSA 4J9UE 2BCCE 3FCCA 3DWEX 1OXKB 3R0QA 3W1EA 1TEVA 1VG1A 1JQ3A 3FLEA 4KXQA 3IEKA 4EG3A 3BATA 1NTOA 1Z5NA 2F3UA 2DQ4A 3G0DA 3QP9A 1HZZA 3PE6A 3SC4A 4YMIA 4TXJA 3LBNA 4D4JA 1H6CA 1XLUA 3AFOA 3GO4A 3M2TA 3ORHA 3QLEA 5K4GA 1JFTA 2X8BA 3HDQA 4JI3B 2QP3A 3BRVB 3OW2O 1X8JA 5FTLA 1MIHA 4QHYA 4EM6A 3PQ8A 3WKEA 1I33A 1USDA 2QJPB 3EH2A 4X91A 2V7QJ 3EZ6A 3LDUA 2GZAA 3ICPA 3HP7A 4OKIA 3HBLA 1QR2A 1D7AA 1XMQB 5FFFA 2ZQZA 3WUVA 4BNWA 3OTGA 4IQ4A 3U7HB 1U4NA 3GPCA 1IFPA 4ZKEA 1GGJA 5JBIA 3ZBPA 2Z6AA 4FHCA 1SKAA 1F2UB 5CT4A 1NOIA 4LQCA 4XASA 4YALA 4N7RA 5TGTA 4JXXA 1XVTA 3CPSA 721PA 3GP5A 4WK6A 4OA5A 5FO1A 1ZUHA 1TO1E 5GTHE 2HRCA 5EKDA 2QM3A 3DFFA 4FI3F 1IEXA 4DG5A 1I2CA 4Y2JA 4LF7B 3WSWA 1DPFA 3S44A 4A73A 1Z6TA 2V03A 3G8BA 3HN2A 5DHUA 1NJ6A 2V4UA 5IYZB 3W5CA 1K98A 1U2PA 2YXNA 1ZUIA 2QSJA 5AWFC 3AV0B 3QUCA 4R54A 4Z53A 1KYOI 2CK3D 1WETA 3LCJA 1MJHA 3IT0A 2PO7A 3FOEC 1MDFA 4LVNA 4UXHA 3SR0A 3JATB 1EUCB 3B60A 2I8AA 2I1JA 4LZNA 4NBLA 1P0PA 2FSFA 3REOA 2QVXX 4C04A 5C32A 3F98A 3OTOB 1P75A 3HMQA 1M2HA 1NQVA 1T8RA 1XB2A 3FFXA 3HSSA 4CRWB 1FYVA 3AM3A 1GNVA 3ROKA 5FOQA 1COZA 2R4TA 5FOXA 3ZCSA 1TRKA 3M06A 3HC7A 3N07A 4L0DA 1CUIA 3OJXA 1HKUA 1HE2A 2B1GA 2FPSA 2KWIA 3O03A 3ZVMA 4LF6B 2QVBA 4XJXA 1XTKA 2Q49A 2G9VA 1GYQA 2HRDA 2CW5A 1U9IC 1WS6A 2ODWA 3KKPA 2E6KA 1TYCA 2J9FB 3LO8A 5GGXA 1Y3AA 2QG9A 1IY2A 3HCAA 3IUYA 4V03A 3LTEA 3ZHUA 3IQXA 3S8EA 1F5NA 1DJQA 4I1VA 4E2WA 2OVFA 3OKFA 4IDHA 1CRWG 2CDNA 4Q7LA 2XE8A 1NKVA 4TXHA 4MX8A 4A2WA 2XPCA 1R9MA 2C1XA 2DSNA 3IB6A 3AINA 1PGOA 1QO7A 2YWRA 4OGGA 4YCBA 1ZN8A 3SYKA 5F21A 4RF2A 2HD4A 1CQZA 4Z1MA 3FZNA 3F78A 4CU2A 4UJ3A 3V4WA 2ERYA 4Z7NB 1LNZA 1CU1A 3GIWA 3U6BA 3E1GA 3QX8A 3C8DA 1NX6A 4FNOA 2BELA 5IMSA 2QLTA 4HY3A 3L71E 2GK4A 4WCFA 3EHDA 4DVJA 2OQVA 3UWMA 2EP8A 1Q22A 3DHVA 1VCIA 4EGJA 2HF9A 3RC7A 5D8DA 1M3SA 3AG6A 3OFJA 2QUHA 4QREA 4BMNA 1T5LA 1BO6A 2JI8A 4CXMA 1BSVA 3PNLA 3R4VA 2GGSA 3CI9A 3I6MA 5FCDA 5HKBA 2DCMA 1P1FA 4M3LA 2ZBUA 4JYPA 2C3OA 5CB0A 2DPYA 1I94B 1P81A 4R1LA 1QQ5A 2HDWA 4OKSA 4WJZA 2GM9A 1F6WA 1E9SA 2WAOA 3OAKA 2X1VA 1N2EA 2N0SA 8OHMA 5ESWA 1B1CA 1U8EA 1QCCA 5BWBA 3QEKA 4W8GA 3NH6A 1N3BA 2VFAA 4CIXA 4DGSA 1W49A 2CVHA 5JSUA 3G6KA 3IE1A 1DMSA 3IHTA 4ZAXA 3S5JA 1QTIA 1DU4A 1G3IA 5FBKA 1EXIA 2M2IA 3TAUA 4P7FA 1CUVA 1SFRA 4OMCA 3L1KA 2YW9A 4GLBA 1J9ZA 1FU1A 2A5FA 5JQGF 3TGLA 2R8RA 1QIDA 3ANTA 5HP4A 4YP5A 4N5IX 4FGUA 4FZRA 1D8TA 3OJ0A 1XX6A 4RAOA 4EH1A 5APYA 4ZALA 5BVHA 3OIYA 1ENOA 5JXJA 5EJFA 1I7NA 3BHIA 4EYQA 2WWXA 5AVXB 1S02A 5CBKA 3G0OA 4PZLA 4V38A 3KLNA 4IHAA 1W73A 2ZYHA 4MCIA 3N6RA 4JHLA 5TV2A 2X9GA 5DHRA 4PZZA 3NQ41 1JRLA 5EE9A 1QIIA 4UZFA 2EP7A 2OOSA 1MB3A 2O01J 2GFIA 2I99A 3B78A 3GT0A 4IILA 1PO7A 4KO2S 4LZZA 4PLPA 1ECCA 1NW7A 3C45A 1ES9A 2GCGA 1KJYA 4L9AA 3FTPA 4EG4A 2OV2A 1T34A 1ZK3A 2JGFA 4DJTA 3LP6A 4DRZA 2C0QA 1FP2A 2ESRA 1EHYA 3IBFA 3LA8A 1NZJA 4BPBA 1SBYA 2FEOA 1P72A 3R20A 1Q7GA 4LYFA 3KCQA 4O63O 4HAIA 2Q5CA 4TVOA 1H2FA 1LWUB 3L8GA 3MAAC 2CMDA 1P84D 3JTMA 1I14A 1EE1A 3EF0A 3Q9NA 4HEJA 2BKAA 4K6FA 3SXJA 3ZLJA 1A9RA 4O8ZA 4AY6A 2XVAA 2ZJBA 1UIIA 5F5XA 1O96A 4PD4D 1P1RA 3GGSA 3TLGA 3UA3A 4AZSA 5M7EA 3V8QA 1XYYA 2J5XA 5K7SA 2FN8A 2R68A 5B5EE 2WR8A 3EZ2A 2AR7A 2O2DA 4QAJA 5G02A 1D8AA 4NULA 2Y1FA 3G4SP 1NBMD 2OCDA 3B3GA 2AMJA 4HEA6 1BQEA 2RONA 2IPNA 3LDHA 4P83A 3COVA 4PG5A 4ZVVA 2H1CA 5KWSA 1G8JA 2J5QA 1KY4A 1HGZA 1M90Q 1X13A 2EBHX 2ZROA 2XNCA 3M6WA 4LN1A 3DBVO 4CF5A 1O96B 3WQHA 4Y0VA 4BO8A 4RJKA 3DZGA 3PUVA 4O2BB 4BTEA 1W5FA 5TY0A 4MAAA 5KNBH 3M8KA 2ZKLA 1PX2A 1SN7A 1WB5A 1WMBA 1GGFA 5LLTA 2W6BA 2AI1A 3O8DA 1BYIA 3G9QA 2OENG 5HRUA 3DBRB 4D8VA 1GQQA 3HRHA 4RWZA 3N8KA 3T12A 5AW0A 3LCVB 2P6UA 1M1JA 3DZIA 3AEUB 1LK5A 4JZYA 1E59A 4LRYA 3ASUA 3KOUA 4MHOA 1LC3A 4PFKA 4U9HS 4F3KA 5LXTA 1VL0A 1SQVG 2CPBA 1B8UA 5D7NA 1J2TA 4JP3A 4WY4A 4M55A 4FMDF 4OYHA 4C88A 1ENZA 5A6VA 1Q6ZA 1LPSA 2WWTA 3DXXA 3DO6A 3GFOA 3QXCA 4BVGA 5JZBA 2QD5A 4ALKA 1B0PA 4ZT6A 4IXDA 5CLFA 2AE1A 3CNQS 2J0UA 5BR1A 1M1JB 1QDLB 3O31A 2VP2A 3DB1A 4I5IA 3ZCPA 3SWWA 1KC3A 3DCJA 4DLNA 3GLGB 3GIDA 4PO1A 1AQ6A 5I7VA 1PP9E 2W6JH 1GGKA 4RK5A 1RAGA 1K04A 3K4QA 2A9QA 1XQXA 4BV2A 4HNAA 1ORHA 2O7SA 3KQVA 3Q3HA 2IOFK 4BFLA 4RTLA 4MVXA 1VJ1A 3AP2A 3ETNA 4AZ3B 1TEZA 4DMRA 2FETA 1LEHA 3F90A 4LJ7A 1M5UA 1VQPP 2H2GA 4PRZA 4BNKA 1E7MA 3DQQA 4FIZA 1D03A 3BQ9A 5BRNA 1FZCB 3Q72A 4BRWA 3N5KA 16PKA 1DINA 1TJ3A 3OP1A 4MW1A 4ZIRA 5B1HA 3UUWA 1GPDG 3G1WA 2FZCA 1G1AA 1HFJA 1REQA 1AN0A 1OTYA 2WSYB 5CCHC 1UBMS 2HJSA 1Q21A 2FQ1A 1YDFA 2WT8A 3VDRA 4B35A 5B1DA 1P6QA 1TNDA 4YR9A 2WFAA 2C20A 1N6OA 1SGWA 1MHPA 2RH4A 4H6WA 3R74A 4WA7A 2PZAA 3T5CA 3T6KA 4AZWA 4F4UA 2VF2A 3QK7A 1NG1A 2WF7A 2OYSA 1RWNA 2AYZA 2GN1A 4R8RA 1YA8A 1WM1A 2HA0A 1ZVKA 3OIVA 4GM0A 5BU8B 2WYOA 2I87A 2QIPA 3ZGOA 3PIIA 4AYTA 3QKWA 1RRMA 4ZAZA 1XYVA 1J0AA 3EIEA 3PR2B 3LK6A 4CIVA 3IEVA 2B7LA 2NSHA 1II8B 4N39A 3CVXA 1TAQA 4TMXA 3RIMA 1DTEA 3IDAA 5KYWB 5AW5B 1E1DA 3TQQA 1ZCJA 1QOQB 1Z73A 2ZI6A 3CIFA 4JI6B 3R4YA 1VL8A 4K7JA 5BYKA 2QAGB 3PXDA 5CB6A 4QUIA 2WSCJ 1YIJP 3HR7A 4XR9A 5KVQA 1VGRA 1KMQA 4DMLA 1GFWA 1JILA 4YP0A 8ADHA 5JZOA 2J3HA 4QEZA 5AJWA 2PKYX 1QL1A 3L02A 1JR4A 4ER5A 2FN7A 4LWOA 1JXAA 3CLTD 3HY4A 5HIJA 2J9YB 2HIGA 4BVHA 2LD4A 3D6VA 3OFSA 5B3KA 2B4AA 4CZ2A 2OT3B 1SM4A 2DQYA 4YS6A 3EW9A 1UBGA 3TH5A 4X8OA 3R2PA 3TRFA 3UMCA 1JPNA 4HFMA 1XRPA 3VZSA 2XUGA 3ZU2A 4AMYA 1PKXA 1J2EA 3UGTA 4CLDA 5B5EH 4X94A 1SJ9A 2AF3C 2OYIA 1BKYA 4K3VA 5AK3A 1B0AA 2JGJA 2OBFA 3GLIE 3IDZA 3F7MA 5KMGB 1EJBA 1YDWA 2RB5A 2V5VA 4I55B 4PPGA 3LT1A 4AX4A 1AK9A 1TCBA 3A2MA 2NZUG 3VDMA 1EJ2A 3IUMA 2WSBA 2V8BA 4YJHA 3GF7A 4KGZA 3T7SA 2SNIE 2D5IA 3L0IB 4EA6A 2GVDC 2C58A 1HOTA 3BN3A 1KY3A 4H44C 3HSYA 1EFDN 5IPFA 3L5KA 1KI1A 2QLFA 4R3NA 4TRJA 1Y7LA 4BNGA 2PTHA 2WSIA 1AD2A 3H1GA 3O94A 4FCWA 1EFRA 3FF4A 4XSHA 1BS1A 2JLWA 1WLYA 2DPLA 3BCSA 1NP6A 3GMIA 2FQYA 3JWHA 4ZV7A 4EX7A 1T1RA 1GITA 5JYBA 4DNPA 3ZD6A 3BGVA 4IDAA 1DH3A 3RCBA 2PS9A 4ZYWA 4MW7A 4PNEA 4I6MC 4UASA 3TE6A 3TIFA 1NC1A 3E9YA 2CMHA 5BU5A 2W2QA 3LLVA 4MKXA 5JECA 1KTVA 2POQX 3BS4A 3Q1KA 4MHSA 4LNUA 4IHJB 2POCA 1U0HC 3NWEA 2F1HA 1SMKA 1D2EA 4U5QA 3GLTA 1JKFA 3HYTA 3NHLA 1WMEA 3SF8A 5H7XA 1N2ZA 4HK4A 3TQTA 4UUPA 4DLWA 3RYCB 3O93A 5AVYB 1H3FA 2QT9A 4CT4B 2J3EA 2RJNA 5L7YA 1Y5MA 2QA5A 2VCYA 1JKJB 3DDHA 4DCMA 4RTNA 4DV3B 1KHHA 4KMRA 3ZU4A 4AQRD 1P4HA 3GY0A 3O1LA 1R0BA 1J49A 2ZAYA 1O6BA 3BMOA 3CU5A 3GUYA 1KORA 1WZ2A 2CBXA 2GBLA 3I5MA 3CZMA 1E9EA 4M0DA 5KYUA 3UCFA 3P9YA 4EGSA 5JASA 2EGGA 5CFQA 1F8FA 3GNTA 1N4DA 4D4IA 3AETB 4A26A 5LP1A 4JVNA 4PQRA 5BR7A 4QT4A 3AHEA 4KGXA 2YV4A 2ZTLA 1RAIA 3LWZA 4FFLA 3TJRA 2RD2A 4KRYA 3QY9A 3ICEA 4EZBA 4OLJA 3ETCA 4HDNB 4OHUA 1HZZC 2P69A 2UKDA 2OCKA 1AM4D 3IMKA 2UZ1B 3KDPA 3G9RA 5AFSA 2JVJA 3KYQA 3EVGA 3RSOA 3BRTB 4DF3A 1CKEA 2WP0A 3WGIA 4UZEA 1K06A 4R8SA 4E51A 5BSTA 1OKKA 2Y9MB 3WYBA 3NJ8A 3H4IA 4E14A 1BMFA 2BM9A 1S8NA 3AHJA 3RARA 4E22A 2FW1A 3CF4G 5H70A 1ODSA 4YRFA 4R1PA 2PGIA 1O94D 1S2NA 4LE0A 1XKLA 2YRFA 5C3MA 2OGZA 1CVRA 1SG0A 3DZ8A 3E9QA 3MGGA 4I9FA 3QF7A 4JDUA 1U6JA 4W9RA 3GYBA 1OU0A 4QXMA 2QBYB 1MV8A 4WADA 3IAS1 1Y3CE 3L1VA 4RQTA 2V59A 2K7FA 1Y9AA 4EMTA 1QQ6A 1JSCA 3U59A 1G63A 2HPCA 2Q6IA 4RVUA 1JW9B 3MERA 3ZCQA 3E9MA 4MV1A 5ALYA 1L4LA 3ETGA 3KJNA 2O2EA 3MTBA 3S7TA 2GZ1A 3PNMA 3SX0A 4ZHSA 1TJ5A 2EW2A 2BCCJ 1HEUA 2GPSA 2RHWA 2YZNA 4R8VA 2WPVB 3RJ9A 1L4AD 4XD7A 5T6MA 2IUEA 2REQB 4PIVA 1OWNA 4CV3A 2KNCA 2VHXA 5FWNA 1G0NA 1S5PA 2O0KA 1MOZA 2QTVB 3PGA1 1ZJZA 1SBZA 2NPFA 3X2FA 3R40A 4L5JA 1K73Q 3KOZA 3UM9A 3ESDA 1E1QD 3DMTC 4G01B 2F1OA 1U0RA 1JKIA 4WNIA 1KSGA 4RGBA 1DO0A 2O0MA 5CJPA 1E3TA 4CQNA 4IIJB 4OSEA 1G21E 1QE3A 5CB4A 1AQTA 2QYSA 5HFNA 3KQWA 1SXJD 1GFZA 4M98A 1QANA 2VHVA 3NJ4A 4KPYA 5CMZA 2ITAA 2XQVA 5EP1A 3NYIA 4PX3A 2V9CA 4DJ5X 2EKZA 3LQYA 1ZAKA 2ZANA 3UATA 1EFVA 2IPXA 2IUSA 4BQNA 2EKDA 4JYMA 5IM4F 1AK1A 3VZQA 4MMYB 5KU7A 3LT5A 3ZZNA 3Q85A 1CJVC 3OQJA 1JG7A 2YS6A 3TGWA 4ZVTA 1OA0A 3MAJA 3QVXA 3B1FA 2PGNA 1CY1A 3ZV3A 1QU3A 2QUBA 1RQPA 1W4RA 2ZPTX 3PSHA 4LYEA 1UZNA 4Q9JA 3Q9LA 5A0TA 1L4AC 1Y8RA 3CZ5A 4J2TA 1RHMA 5JQGB 3VVMA 5CVCA 1XF1A 3VC2A 3V4RA 5DN9A 3H0EA 3M1AA 4WWIA 5GJWC 1H8HA 3WGTA 4CQJA 3QJYA 4EKEA 1EDDA 5AI8A 3HXKA 2XCUA 1HT3A 1V4NA 1Z8FA 3IUQA 4JP1A 4PHFA 4X54A 3TMYA 4P32A 2C7QA 1HK7A 4CMIB 2JCXA 4DUYB 3NYRA 4I0WB 4P4NA 5DHFA 2RCNA 2R8EA 3OA2A 1FLAA 3QMWA 1TIKA 1C8LA 2GD6A 3REFA 4HQNA 5JWOA 5J2UA 2DT8A 1FBNA 2EFYA 2XI4A 2FMUA 3A28A 3AKZA 1RI3A 2FR1A 1MO3A 2FW6A 4QDTA 1QAQA 4PYNA 3N6XA 3ZK7A 4CKBB 1H5UA 5AVJA 1FTSA 2WVGA 1RPAA 1Z2CA 3D7SA 3EGCA 3TO5A 4C0AC 4EK9A 4BNZA 1MA3A 2R48A 5CX1B 2LCQA 1YK0A 4BBZA 2LGJA 3EFBA 4D8TA 5IAOA 5ARCA 2O8VA 2NSJA 1NL3A 2FCRA 4B40A 2QE7H 5LR6A 1XZIA 2PGJA 3GW6A 3O4FA 2P77A 4RLFA 1IZYA 1Q83A 3OEYA 3PA8A 3GFFA 5PGMA 3FWZA 1MH9A 4JEHA 4BLUA 1GFIA 3DC7A 3QG5A 5H4HA 2ZYWX 3AUUA 2AKEA 4DBLE 4TWRA 3CCFA 2Z2KA 1VYTA 5D87A 3RTDA 2C7VA 4MO9A 5DNVA 4DBVO 1U99A 4HPXB 2IWHA 2DKNA 2F1JA 4BGEA 2WAMA 1H3NA 2BZSA 1E9BA 2C2OA 1AQYA 1NVGA 4L8WB 4QELA 5LQSA 3OIGA 4AY3A 1U9YA 5M1BA 5T8KC 1I6LA 2ERCA 1KTIA 1QIMA 4O4LB 1VPLA 4RF4A 4Z51A 1IM2A 1YDHA 3HCRA 1D9ZA 3KT8A 3NI2A 1XPUA 2MR6A 3OA7A 3HR4A 3AF2A 2NQ2C 1XTIA 4GI3A 5ERGB 2WT7B 1T3SA 4ZHQF 2VF5X 2WTNA 1JAYA 2FR8C 5JG7A 2X2OA 5A4AA 5HZKA 3RL0C 5JSFA 4EW3A 2H0AA 4G8JA 2YHSA 4R98A 1TX4B 2P91A 2ZJ6A 4WWHA 3SBXA 2E76D 1J0DA 4O4LA 5DEIA 3THRA 4R0MA 2LPMA 1W46A 2IC5A 1NOJA 2XAUA 2CWDA 1UMBA 1VSQA 3JVVA 4R0VA 1DC4A 4MEBA 1E1CB 2H3EA 4ZTBA 1MD9A 4NCBA 4ENTA 3CJTA 4WGGA 4S1OA 2B5WA 2P4UA 4RKWA 1F38A 3Q41A 1W1UA 4HDOB 1Z38A 2KSQA 2DKFA 1I8TA 2A78A 4B6JA 1NX9A 3MNFA 3Q98A 1VMKA 3SHTA 4RMIA 5ECGC 1EVIA 1HWTC 4OQDA 1ZPDA 2BCEA 2C4MA 5HEKA 2XWJI 2NX2A 1MCZA 4XDHA 2N75A 5TGZA 2HBYA 1OI2A 4NFYA 3WJAA 2DH5A 1QV6A 3NEJA 1TPYA 2JZNA 5KSOA 3H3XA 3NDJA 3T5GA 1WUYA 3TL6A 4PNHA 2YZMA 3JQBA 2WQ7A 4MRSA 1VQKP 4PZCA 2ZUCA 4DWVA 3CWBG 1SQBG 2NRGA 2IDKA 3KYDB 3U39A 5L3SA 3DF9A 2AA3A 2GNAA 4ZVKA 1U8AA 3H84A 1VL6A 3ICWA 1PFYA 5T3UA 2IUTA 2FHSA 3SQDA 3RBXA 2PRYA 1RE4C 1X38A 5CP8A 4J16A 1P1HA 2FYZA 3FYDA 2YMKA 2H07A 3PCXA 3OCUA 4XCXA 3TSCA 3WQQA 5IF9A 3ER9A 2M6KA 1SXPA 4HH2A 3ETDA 3H1FA 1WD7A 2B36A 2Y76A 3D6FA 3KZCA 4G5YA 2FSPA 4P4GA 3VAAA 4EI7A 1J8FA 2YOHA 4MYSA 5KNLA 2Z2YA 4F2DA 5HUQA 4E12A 1TM1E 3DE4X 3ZY3A 2XB4A 5BPFA 1VJCA 1UH5A 2AJCA 2A9RA 2JFVA 4QPJC 4J4BA 1KQGB 5EZ6B 4PLZA 3PX2A 3K8YA 4L85A 2RGEA 3RVPA 4E30A 1E8NA 5A5VA 3D6ZA 1LWNA 1F4LA 3M83A 4LC1A 3I9JA 4ZEXA 2WLSA 3FWNA 1SBCA 4AYXA 5B7QA 4LRUA 2N9BA 3ZW7A 3AE5C 3E4DA 4KCGA 4WXMA 3DHWC 1S89A 5TARA 1EGMB 1Y48E 1Z5ZA 4FB5A 2YV5A 4PSDA 4EWLA 1T6YA 1KMIZ 3RR2A 4GPAA 1V16A 1RP1A 3DMNA 4H1VA 5DBIA 5EESA 4AC9A 4AY5A 3BHJA 1TTQB 4Z9BA 5E95A 5CFNA 4B1FA 4FFNA 5DXFA 3OIDA 3GJ4A 1WULS 2H7CA 3F7TA 3GRPA 4LGVA 4RGVA 5GZ1A 1QFJA 1QVFO 5LDDC 1N5KA 4U2CA 3MWKA 1WCV1 4KR7A 3IAEA 3M6FA 3A4MA 1I9CA 3TGUG 5FF9A 1LZKA 3U3XA 3RC3A 1BROA 1K4YA 4TM8A 4Y2UA 2VJCA 2GCEA 2W37A 3HADA 3GMSA 4MEAA 4S0XA 2PM8A 2N47A 1PL0A 2H54A 4L08A 5AOVA 3Q8KA 1VJ0A 3GN1A 1XEWX 1UEIA 4XE5B 4ALIA 2O2ZA 3BE8A 1JH8A 1RR6A 1Q90D 1EVKA 3GZ4A 1Z0ZA 2O8NA 4TMTA 1N36B 2HIMA 1KAOA 1VI6A 3KKNA 2VK1A 1D7OA 3I3SR 1EXNA 3L93A 4I55F 4D8YA 4KXNA 3BIJA 5B30A 1ZU5A 1NXQA 3RJTA 5JNRA 1EIZA 1QFZA 2IQ5A 3IBSA 4XAQA 3HXQA 3CZPA 3HDTA 3HG7A 3ND5A 3QU9A 5TMEA 1RWWA 2IF2A 3WFJA 2RHDA 3FVRA 1CIVA 5DE3A 3ZXXA 5B12A 1SQPK 1O4WA 4ESEA 2JP3A 1PK7A 2WD8A 2XWSA 1FLNA 3A0RB 3MCUA 3PXAA 2QRMA 3WYNA 4DIOA 1I7QB 4CEHB 2O8EB 1I5EA 4NU8X 2XMQA 4GODA 1EK5A 2W0MA 3EG9B 4Y1EA 3T4PA 1O2DA 5DTIA 2PS1A 2B9VA 2A4MA 1L5MA 1X74A 4KVFA 1IQUA 1AGPA 2C2WA 4WKNA 4K9LA 3U31A 5J23A 4GHWA 3ISJA 3SIPA 1ZMRA 3OE5A 4TLDA 2GLTA 2RBEA 2YZGA 3H17A 3MMSA 1ZN2A 4EVIA 2O54A 1YKFA 4HH4A 6ABPA 2GFQA 2VNIA 5CCEA 5HQ3A 3LQQA 5FI1B 3GNLA 4YAFA 4Q7QA 1IRXA 4A4DA 3GU3A 2WHRA 2R62A 5ECYA 1XZPA 2Y68A 3GXOA 1R50A 2EHJA 2RAFA 2G9NA 2A35A 1HMPA 1U11A 3AEZA 5DI3A 4LJLA 2OA0A 2M1XA 5IC6A 1NI4A 5CHXA 1AMNA 1ZD3A 2YQ5A 3MEQA 4U1RA 1GSHA 5KKZC 4X65B 1VZ3A 2QN9A 2XMBA 2PXAA 3Q2OA 5A1JA 1RQLA 2E18A 1ECFA 3EPJA