4LHWA

Crystal structure of rab8 in its active gppnhp-bound form
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
171
structure length
171
Chain Sequence
DYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-8A
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 58
structure length 171
sequence length 171
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lhwA00
4XSHA 3LAWA 4ZKEA 4BASA 5FOSA 1DO2A 3D7MA 2RH5A 4KV9A 1JALA 2CBZA 2RGEA 5BYJA 2GF0A 1XD8A 3RHFA 4D80A 2CXXA 5FUVA 2OFXA 3HDTA 4L5BA 1W36D 2ZRFA 4QFMA 4QNRA 2D7CA 1U0LA 1S1MA 3BS4A 3NBZC 1Q1BA 3QENA 4E09A 2ZE5A 5A0FA 3SZRA 4AYTA 4BQSA 3IBGA 1UBCA 4QKQA 1HA3A 3QG5A 4EFLA 1SXJB 4MDEA 2YKGA 1R0XA 2GZDA 4TMZA 4TN1A 4W5HA 3BJIC 5H1YA 4F4IA 4URUR 1QHHB 1KDTA 2ZXUA 3I4LA 3EIEA 1RE0A 2FA9A 1ZM4A 1UKYA 3NHAA 3R8CA 4S35A 1YRAA 4O2RA 5L3SB 1WP9A 5DYGA 1SXJC 3TSZA 1UF9A 3QXJA 1ODFA 3V4FA 1NIPA 1MO3A 4L9WA 4OHXA 2FPMA 3AF2A 4TL7A 5G3YA 2A5YB 3X2SA 4O0MA 3KZ1E 4IEIA 4DT1A 5FBVB 3DM5A 4BZXA 1MR3F 1XXHA 4LGMA 4XTCS 5FBQB 5BN5A 3RSOA 2AWNA 3BB4A 5SZJA 2WWYA 1CS4C 4ILEA 5CLLA 1GRRA 1UKZA 2HT1A 4PPGA 2YWGA 1TUIA 1ZD1A 2AL7A 2ZRJA 1SXJA 3GJ0A 4DHEA 3U3OA 4OQMA 4TTQA 3NH9A 3V9PA 2VHQA 3QPUA 2JDID 2HUPA 1IXZA 4EIWA 1G7CA 2OEPA 1JBKA 1VCIA 2VTKA 4Q9JA 5L8VA 1G21E 1XEXB 4NKRA 2H8KA 2HCBA 1R0WA 3ADBA 4GL2A 2WHXA 4A8JC 2FOLA 1JQLB 4AKIA 4PHFA 2NO1A 2OUKA 5GJVC 4GI7A 1EWQA 1Z6YA 3UMRA 4LC1A 3LD9A 4BUJA 3Q5DA 4GZLA 4DUGD 3Q7QA 1F6BA 2ZVQX 3ZH9B 3WMEA 4DDVA 3QUSA 3VTKA 1NSTA 3AKYA 1JAIA 3BB1A 2CCGA 2DFLA 4DZZA 4F4CA 1KMHA 3OIVA 1KDOA 4RZ3A 1WB9A 4CEIA 3BAFA 4TL9A 4AC9A 2CLSA 4CT5A 3BWDD 4B6EA 2YVUA 3AVVA 3T1OA 3BIFA 1RKBA 3KJHA 1JEEA 5EXXA 3NBYC 4DC9A 2D4HA 2KE5A 4BFUA 1OXXK 2FN4A 4Q18A 5TB5A 4PQYA 1HQCA 2NPFA 1MO6A 2Q6TA 1BYUA 2W2TA 1WA5A 1KSHA 1ZNZA 4J0QA 1UDXA 2RHMA 1D6JA 4E07A 3WMGA 2VSFA 2FMXA 5EE1A 4FINA 1QRAA 3CIOA 2ERYA 4PZYA 5AJXA 2WMOB 1ZVQA 1R4AA 3NTUA 1Z6AA 3WRXC 4HYYA 2WMNB 1Q44A 1TF7A 4AG5A 2GXSA 2PL3A 4MRSA 3FOZA 3VU9A 5EE9A 2ZJAA 2GILA 3HP1A 4URWR 4AWXA 3ND8A 4HB3A 3BC1A 4A0RA 3EIQA 4AI6A 1IHUA 4G5QA 1X6VA 1CP2A 1J8MF 1T9HA 2PZEA 1G8GA 1Q3TA 2CNWA 2XNSA 3EW9A 2O8FB 3NC0C 5TVKA 1AK2A 3RS3A 3NDPA 3ZZUA 1UJ2A 2J7PD 3DM9B 3GFPA 4IDOA 4JMPA 1FX0B 3PCRB 4H1VA 2WSSD 1E9DA 4LHWA 1G1MA 1A2KC 3KKMA 4JL6A 1BMFA 4Q66C 3WBKA 2HEIA 4C0KA 1ZYUA 1ZUHA 4HAXA 1Z47A 3H1TA 3MCAA 5L3VA 4FD2A 4HLDA 2ZJYA 4I1VA 2IUUA 5CM8B 5LD2C 4G5GA 4R9UC 2O8DB 1VCMA 1SVOA 1GKYA 3RRNA 4B74A 4JLAA 1W0KD 2D7DA 2ZQ5A 2D2FA 1E0SA 4HAUA 2IYTA 2XJ4A 5CIQA 5GVSA 1FL9A 4IHQA 4JLBA 4DVGA 1E9EA 5EJEA 2WJYA 3OZXA 4Q1BA 2VIIA 4GNKA 2C9YA 5FH9A 4RD0A 2O8EB 2H5EA 1R0ZA 3H0KA 6Q21A 3THXB 2J59A 2XNDD 2QSYA 4QRHA 3ZD7A 2DFTA 3GJ3A 1TMKA 5TV2A 2XXAA 3CH4B 4E22A 5JEEA 1YR8A 1IOZA 1Z83A 2W0MA 4WZBE 1M74A 4LJ7A 2ZANA 3KL4A 4LUCA 2NO9A 521PA 4TYPA 2VP0A 3WMFA 3GMTA 1M7HA 3M4YA 4C7OB 1RRGA 2ZRCA 4BFXA 4LZZA 4WVFA 4UNPA 5JI2E 2C98A 4B47A 4TSFD 2GJAA 5DI9A 1IAQA 1Q57A 3FMIA 4TT3A 5H70A 1RRFA 2FX3A 1W7AA 3HYTA 3RLFA 3HWSA 2HJVA 2O5VA 721PA 4XVRA 1TF5A 3QJYA 1XZQA 3MWKA 5JSZB 1YR9A 1E2EA 1R8SA 4PXAA 5D3QA 2PX3A 1LS6A 2GAAA 1OXVA 3GD7A 5AJVB 3UPUA 4IXMA 4BEJA 2BVNA 2PMDA 3PUWA 5F3WB 2IS6A 1EX7A 2J45A 2FDCA 1E69A 4FXPA 3QOFA 2CCKA 1VIAA 5HCIA 1VYVA 1NRJB 2MSCB 4NYMQ 2JCSA 3F0TA 1KZ7B 1G5PA 4QHYA 3D3QA 3WXMA 5JZVA 3K8YA 5L3QB 4TZ6A 4C0AC 1CR2A 2GEUA 1IN4A 1G7SA 2NO7A 3TBKA 2ZYWX 2YWFA 3LDAA 3T5GA 1IN7A 1M6NA 1F60A 1N25A 1Z5ZA 1XJCA 2GETA 1Z63A 4JT2A 2V1XA 3TAUA 3K0SA 2WOOA 4Q4LA 2WAXA 1P73A 4UKDA 1MABB 5A4JA 5C18A 4NYIQ 2ZI5A 1OIWA 3K9NA 1U8AA 3T1VA 4F93B 3FHCB 4BFSA 2ZU6A 5FUXA 2JGNA 3ADKA 4GOKA 4DCSA 5CITA 2WOJA 3THWA 5EZ5A 5JRZA 4ESVA 1E9FA 1OXTA 2ERXA 3GP8A 3L43A 1ZU5A 1W36B 5FL3A 3LRPA 3P20A 4LHYA 2P5SA 2QBYA 2BIFA 2NO0A 3P32A 4IXNA 4EJSA 3JVUA 3I62A 1JECA 4LY6A 3UIEA 4TQUS 3B1ZA 2KBEA 1GSIA 2VA8A 4Q7MB 1V43A 3PEVA 4GFDA 2UKDA 4B34A 1HH4A 2R65A 4YXWA 4H9GA 1EFRD 2ZRAA 3OEHA 4C0SA 3CR8A 3X1XA 5FPSA 3DEFA 2AKAB 5FBRB 1ZD8A 4C30A 4ACAA 4XVUA 3RAPR 1IN6A 2G88A 3OESA 2WWIA 4LPSA 4MGKR 3VHLB 1OV4A 3R20A 1R7RA 1G17A 2DFKB 5J4VA 4BZPA 5IHPA 2EFHB 3K0FB 3SI7A 4UQOA 4M9SA 1Q21A 4BRWA 5E3HA 5KU1A 2R6FA 5JI3E 2RGAA 4DSUA 2GBLC 2NZ8A 1OIVA 2WICA 3CZQA 5HKKD 5DH9A 1DAKA 5CJ2A 2XZLA 3D31A 1R8QA 2RGNC 3FFAA 3F8TA 3OFNA 5JECA 3CZPA 3SC3A 1UEIA 2QSZA 4P4SB 2IWRA 3CONA 1ZM2A 1FP6A 2UZ3A 4A0FA 1A2BA 1ZP6A 2ZR9A 2W6JD 2I1QA 2GWHA 1OH8A 3FKSD 4QBGB 4LOAA 1HY3A 2IHBA 5H68A 4MRVA 4C0HA 2VBCA 1ETUA 1RRCA 3EPHA 2A78A 1SVKA 5J4HA 3ICQB 1OXSC 1EFCA 3BK7A 3T1QA 1JR3D 1OB5A 3B1XA 1T3HA 3W8RA 4YMUA 2DB3A 1TU3A 3R9IA 1J8YF 5K8TA 5DE3A 5HZKA 3I72A 1UBFA 3I1FA 5KTYA 4KYUA 4JZKA 2AKYA 2Q21A 3NVAA 5JHHB 2BJWA 2AN9A 4M1TA 1KJYA 2EYUA 4JVMA 4RSGA 3LV8A 1S96A 2C04A 3U4QB 2XB4A 3RRYA 3TSOA 2F43A 1XTSA 4D26A 1AZTA 4MYHA 1JJ7A 3CNNA 3VR5A 4HAYA 4XVQA 2OXCA 4KFUA 3O8CA 4DDWA 3HU2A 2F9LA 3UMSA 4AIIA 2IK8A 3ZS8A 1NVVR 2DWOA 4P4TA 3FYHA 3MWJA 4V0OA 1YZLA 3VHXA 3BOSA 2BV3A 3CF2A 2OCPA 1N6IA 4LJAA 3BH0A 3JZAA 2N42A 4R2HA 2HXSA 1NSFA 3LX5A 2OXRA 2IYLD 1VCOA 1ZM9A 2BMJA 3B8HA 1HTWA 3PIRA 4LJ5A 4FCWA 1OJLA 3SFZA 4DLRA 2O8FA 1PLJA 2QPTA 1VG1A 1IJEA 1YU9A 4JS0A 5BQ5A 1CBUA 4JLKA 3SJCA 4C3ZA 2PCJA 2QQEA 1AQUA 5BW8A 1OFIA 2CDNA 4A8JB 4FCVA 2QMHA 1LS1A 1S3SA 2ORWA 3LVRE 2X77A 1N5IA 4JBXA 4OHZA 1F48A 2VH5R 2FG5A 5E7JA 3SR0A 4YLGA 1OIXA 1N6LA 1QHYA 2AFIE 2JA1A 3X1DA 1NBME 2L0XA 4JLPA 4KODA 3VFDA 1E0KA 4V0LA 4HDCA 1E2DA 1ZBDA 4B43A 1UFQA 2O8CA 4HLUC 3KQKA 2GK6A 5FR2A 2XSZA 1DARA 1EFUA 4LSGA 2AHOA 4C0LA 2PBRA 1S4QA 1CU1A 2NGRA 2ODBA 1U2RA 1SQ5A 4JJKA 4Q1EA 5HKKA 4JLVA 4I4LA 4C2UA 4RD6A 4POAA 1KAGA 1RPZA 5K8LA 1NN3A 4OHWA 4FMCB 2N46A 2XX3A 2AX4A 2OCBA 4HDQB 5GJCA 3B78A 2H18A 1DBSA 1E79A 4OK6A 5E7IA 3SNHA 2F1JA 3B1YA 1NI3A 3U3RA 3A1UA 3DDCA 1W0KA 2QAJA 1WE2A 2WKRA 1HE8B 2GESA 3CPEA 1D9XA 1T91A 3ZZTA 1GL9B 4B3BA 2WPDA 4B3FX 1KSFX 4DB4A 4LK2A 3IQXA 5J5CA 2OFOA 2ZAMA 1NNEA 5FTKA 1UKVY 1QHIA 1P4SA 1GUAA 5KOYA 1DG1G 1T0HB 4BE7B 1TQDA 2WSMA 3W6PA 5L3SA 1PLKA 4LBYA 4JYCA 4MGZR 3MJHA 1DTSA 4UXHA 4Q03A 4D0LB 4GDFA 1CRPA 3B82A 2VP6A 4FMDB 5EXPA 1DAMA 4DIEA 4Y0VA 3WBJA 2ZI3A 2CL6X 4U00A 1DELA 3SFVA 2BBWA 1TU4A 4GOJA 1E2KA 3R8FA 1FMJA 1OSNA 2KB0A 3MWYW 3H2YA 3CWZA 4LHZA 2BEKA 2PLRA 3TNFA 4F7WA 4CGZA 2QT1A 3IILA 4KAXA 3X1WA 2FE4A 3MFYA 2O52A 4JBYA 2YJTD 4LHVA 4MYTA 3P4YA 2F1IA 1G6OA 4PQFA 1OH6A 4Q00A 3CM0A 3FHOA 3KKQA 1KDRA 1FUKA 3WHKA 2QP3A 3IIJA 4MKFA 2RGGA 4NL4H 3ZLJA 1X86B 2IHYA 2ZRIA 2IWHA 1L8QA 4RVCA 4IFEA 4WBSA 2BMFA 3ONWA 1E99A 3W8NA 4E5UA 2OAP1 4BZQA 4WW0A 1XB2A 5AJYA 1G9XA 2ZE8A 2ATXA 3AKDA 3FMFA 3QXHA 1HUQA 2JAQA 1CJMA 1NVXQ 2V6JA 2ZTSA 4IOJA 1CXZA 4TTPA 4TL6A 1AM4D 2C99A 1T3LA 1XTJA 2OM2A 3GJ5A 4YQFA 3BRWD 3RC8A 1NN5A 3BFKA 2DPXA 3DMNA 1IJFA 3SN6A 3GLGA 2ZSBA 3LW7A 2P3SA 2CK3D 2G83A 2NIPA 4LYAA 3FB4A 2IW3A 3P26A 3I73A 3WP0A 2D3WA 2HCJB 1U99A 5KSOA 1FQJA 2BCGY 3FKQA 4MH0R 4AK9A 1E9RA 3FE2A 1N6OA 1ZJ6A 1IXSB 3PFIA 1GP2A 2QL6A 4F4JA 4UXJA 4QHTA 5IDVA 1E2NA 1GM5A 3AKEA 3B7GA 1GTVA 4OYHA 1KSGA 2V3CC 5AR1A 1VYUA 3T35A 4L9SA 1VG8A 2G1KA 2XZPA 4US0R 5AJZA 3O47A 2IYXA 1N3BA 2A5GA 1FQKA 4JLOA 3QXXA 5H8WA 4IW3B 3CNLA 3A58B 1P72A 3A1VA 2QTVB 1AZSC 5EE5B 3FWYA 1Z6GA 1Q1EA 1W5SA 4WOPA 1FX0A 1L2TA 1DO0A 2JLXA 2EFCB 2WPDD 4XH9B 4NDZA 4Q02A 2F3RA 1L7VC 3TK1A 2EW1A 2REOA 4OK5A 3FTQA 1NF3A 2IS2A 4CYMA 1KAOA 3FVQA 3W6OA 4JT4A 5DSZA 4KCGA 3OEED 2OSBA 3LQRA 4Q9HA 3T06B 3GLHA 2GA8A 3WYAA 3GEIA 1KI7A 3REFA 5SZIA 4DBLC 3Q7PA 1G6HA 4TT3D 3DZ8A 3EARA 5CK4A 4DLUA 3R7WA 3TUIC 4X8OA 1UEJA 1E9SA 2IYWA 1X8KA 1OB2A 1N0WA 3AUXA 1NL3A 1SULA 4PANA 5CYPA 3U6BA 3W6NA 4TLCA 4KBFA 5EUMA 4A8JA 2IXFA 2OLKA 4KFSA 2J46A 4HZUB 3DOFA 3U7EB 4PZZA 1LNZA 4CZ2A 1MKYA 3CR7A 2QG6A 4QG7A 3NDBB 4D0GA 1W49A 3MLEA 4DLSA 5CDFE 1X1SA 1T8UA 4BFTA 4XWAA 3U61B 5HPYB 2B8TA 4GP7A 1CRQA 3QVUA 2G0NA 5C4GB 2W6JA 3DKPA 5FOVA 4LWZA 4EPVA 4JBWA 5J40A 1CR1A 3GLIB 1Z08A 2QRZA 4EUNA 4QXAA 1SVMA 1N5KA 3T5DA 4NCKA 2QQ0A 3AKCA 2RGDA 2WWXA 3L2OB 4URYR 5J4KA 4B76A 5CK5A 5EQTA 3VKGA 3K9GA 3B2EA 4D2IA 2H92A 2RGNA 1EK0A 3SOPA 4DXAA 2EWVA 1CLUA 2ZI7A 3QKRB 1E2JA 4PC1A 1KI9A 4LX0A 2PZFA 3GJ4A 1KY3A 1RJ9A 2NO6A 2C77A 1W2HA 3M1IA 3JVVA 3GLIA 5FTLA 2XOKA 4Q7KA 2NMVA 1CULC 3T1TA 5FTMA 4IFBA 3W34A 5KNCA 2QGZA 1GIAA 3MSXA 2ZYVX 4FN5A 4DLVA 3QSYA 5EP2A 1ZW6A 3BBPA 2VP2A 3L8ZA 2R2AA 4QHSA 2PZGA 1XTQA 2Q9BA 3EXAA 4EPXA 5DGXA 2RCNA 2VP4A 2REXB 2WWWA 2C03A 3P27A 5KYKA 3SQXA 3AVPA 1EGAA 3IUYA 3BORA 2LKCA 4II7A 2AFHE 4HDOB 3K70B 1E32A 3Q8XB 2PJRA 5LDDC 2UZIR 1F2UB 4NYMR 2F3TA 2GAOA 3FPAA 2IL1A 4GSYA 1FFHA 3VR1A 3ADDA 2CK3A 1QHHA 1XPRA 1ZCAA 3CBQA 5HE8A 1WMSA 5FI0B 5CYOA 3K70C 2QMEA 3EWSA 2ZROA 3W5IA 4EKDA 2CVHA 1LW7A 5F2EA 4A6PA 3AV0B 2PLFA 1ANKA 1S1CA 2BBSA 4G0NA 3NWJA 4PHGA 2XTMA 3UG6A 5L3RA 1U94A 3WNCA 1BOFA 2W83A 5C4MA 4US2R 5K8IA 5G41A 3AP2A 3U44A 4RZUA 4TLBA 5LPNA 1XXHB 2A9KA 4MYUA 3OAAA 1YZNA 3FHTA 1GITA 2WZQA 4Q4JA 2IC5A 2EVWX 3RWMB 3QKSA 3AF4A 2PT7A 1II8B 4ON9A 1KK0A 1TADA 3L8YA 5TARA 3K53A 4NCJA 3UG7A 2JJ1D 2QTHA 4D6PA 1P62B 3L82B 4B2IA 1W4RA 1XMSA 2CCJA 4M0LA 1D9ZA 1WRBA 2DHRA 2VHCA 2ZR7A 1W46A 4Q7JB 3AVQA 4N3NA 2GBLA 1NP6A 3C5HA 1E79D 4ZDJA 2FSGA 2P65A 4WXPA 5ELXA 1S8FA 3E1SA 4BLTA 3K70D 1DAEA 5DHFA 5P21A 4NP6A 4Q4JB 2N1BA 3QVVA 2B7BA 3UXMA 5F9FA 2MSDB 4LJYA 221PA 3FGNA 3RVBA 1SVWA 2NQ2C 3A8TA 1U90A 4TMTA 2QROA 1I2DA 1MABA 3L0IB 3TUJC 1XCMA 3ASYA 3RANA 1GFIA 1I4TD 4CW7A 2JLRA 2E1RA 4ZIRA 2QE7A 4U7DA 2HF9A 5HR5A 4QL3A 3PXGA 4B3CA 2HLDD 1E98A 3BH7A 3NG1A 4BLRA 1ZINA 5LB4A 1S2MA 3I32A 2Z0MA 2ZSEA 3EWAA 4RFSB 1CJTC 1IN5A 4FWTA 4TQAA 5AK0A 2J0VA 2ZRHA 3PUZA 5DO9A 5JMTA 1RC8A 4BRUA 1TUEA 4TWZA 3DHWC 3KX2A 4O3MA 4QM6A 4FIDA 4OQXA 3PJRA 4EJSB 3EAQA 1M8PA 2ZEJA 3W3AA 3ZQ6A 4A15A 4LBVA 4KITB 5FL7A 2GXQA 5CJPA 4PSVA 1X8JA 2WTUA 3OIYA 1E1QA 3PEWA 3KXLA 5FOXA 1XBTA 4HLUA 5EXSA 5HCNA 1E2QA 2RGCA 3LLUA 3SHFA 4M2LA 3HU1A 4PPNA 5CIWA 3GLIE 2O8BA 2GHIA 1M7BA 2W2VA 4JIMA 2GZAA 2C5LA 3TVTA 1W5TA 4QBFA 1BMFD 3EZ9A 3SYNA 4Y0AA 4KVGA 4A2WA 1ZIOA 1K8RA 5AUNB 5IT5A 2ZJ5A 4CEJB 2P0EA 1G8YA 2PCLA 1U0HC 3CLVA 4IJMA 1KMHB 2HF8A 2BC9A 1XWIA 4IDPA 1RVDA 1XEWY 2FJUA 4N0EA 1OLOA 4YDHB 5B30A 4R98A 3RRMA 3N5CA 3U7FB 1FW6A 3U7HB 1YZUA 3PV0A 3QIAA 1SVIA 1S3GA 2I3BA 2P6RA 2Z43A 1TTTA 1KKMA 3KQUA 2GKSA 5DN6D 2IXEA 4P4UA 3M6AA 2XAUA 4K81B 4DWJA 1R10A 1SXJD 4EQ6A 5J4YA 1GKUB 1D2EA 3W9YA 4EFNA 1NVVQ 2VL7A 1XCPA 1MOZA 1P2TA 1Z3IX 2A3RA 4FW9A 3REGA 2A7QA 2E87A 2JLUA 1GDDA 4AD8A 3VNUA 1B23P 3I8XA 3C16C 3QY0A 1WCV1 1GRNA 1LF5A 4P33A 3A6PC 2EFGA 3GFOA 5HZHA 5EP4A 4D4LA 4QJ5A 4IKEA 3ADCA 1VIYA 1P61B 1XF9A 2GXAA 2JIZD 2P6NA 4PC2A 4M22A 4W5WA 2ZYUX 2OCAA 4GP6A 4PO9A 4CT4B 5TDHA 1SHKA 1JR6A 3S1AB 4HUQA 1KDPA 2BEJA 3F3YA 3K0CC 1GOTA 4DKXA 1CR0A 1MV5A 4LC0A 5KDOA 4AY2A 1AS3A 1N6RA 4CDGA 1G7RA 3TKLA 1A5TA 8OHMA 4DB2A 1XFAA 2J0UB 1GNPA 3ZVLA 3IIMA 2BCJQ 1BIFA 3I61A 2QAGA 2PEZA 4Q9IA 3B1WA 3X1YA 1QBKC 4BLSA 1NLFA 2J1LA 3AVYA 3LY5A 1Q12A 3W90A 1D2NA 4KI0A 1T6NA 1ESNA 1AS2A 5FBLB 5JS7A 1A4RA 4A6XA 1YZQA 3DO6A 2IEZA 2JDIA 1UDWA 3MWLA 5G3ZA 3TIFA 4Z51A 2HXYA 1JR3A 1FMLA 2LWIA 2MMGA 3TQFA 5DISB 4UJ5A 3VR2A 2QP4A 4D4MA 2RMKA 4MDFA 1M34E 3AVUA 2G1JA 4DJTA 1X3SA 4ZPXA 1TQ2A 1UM8A 2G3YA 2VQSA 2IBMA 1KOFA 4PO1A 1Q1QA 3QE0A 4X8LA 1DS6A 2IUSA 3HPRA 2O8EA 2Q3HA 5E7MA 4DSNA 4QOSA 1NJGA 1DAFA 3HR8A 3DPUA 4QGFA 4RD2A 3VAAA 4IOKA 3SYLA 5DYIA 1E2PA 3MAAC 4LV6A 3OIUA 1T5IA 2V55B 3TLXA 3EZ7A 2ZI6A 3PUYA 2PH1A 4EPRA 1NG9A 3EPLA 3TMKA 4G5OA 4HATA 3HPQA 2WM9B 2OV2A 2ORIA 2J9RA 1LF0A 5IK2A 2IYQA 1QHXA 3MG9A 1US8A 4PPQA 2DBYA 1XNJA 1P9WA 2ASEA 3D6TB 3EA0A 3Q72A 4TLEA 1CIPA 3HJNA 4TMVA 1W48A 3Q3JB 1K6MA 4ITRC 3RNLA 2GCOA 4EPTA 2G6BA 2SHKA 2GJ8A 1FZQA 4OJKA 2ZM5A 2AWOA 2Y8EA 4GMXA 5DHAA 3MGCA 4U02A 3SJAA 1A1VA 3HU3A 4G1UC 1XTKA 2Z83A 3QKUA 2QBYB 2W6ID 1KTVA 2CMKA 3OEHD 4EPWA 2ZVPX 2CL0X 3DVLA 4Q21A 4JVLA 3HR7A 3VX4A 4YXWD 3IPYA 1KO7A 1LV7A 2ZJOA 4Q47A 3WYGA 2RGXA 1NKSA 3GPLA 1E0JA 1YKSA 4B3DA 2GEDA 5FI1B 5J4LA 1Z06A 4PAMA 1M1YE 1XJQA 1T5LA 4NE2A 2QA5A 3LBHA 4UJ3A 4QBHA 1E2MA 2LCFA 5C1BA 2P2LA 4BFYA 2GCNA 1ESMA 2WV9A 4JL5A 4L16A 2A2ZA 4D25A 2VRWA 4HEJA 2JLVA 3TSWA 1GILA 4Q4AA 4CRWB 3CW2A 2ZR0A 3ZS9A 3OFND 1U8YA 3H84A 3IIKA 4A9AA 3A4MA 1P2UA 2DR3A 1W0JD 1F2TB 2BM0A 3C4JA 2Z5FA 1J2JA 1JR3E 1DE0A 4LYFA 1TEXA 2FGJA 3BE4A 3L0OA 4KHZA 1XMIA 3U60B 2CHVA 4XIGS 2OILA 4P0TA 3KQHA 2HYIC 4HB4A 3P4XA 1YVDA 4NCHA 4XWKA 3AGPA 3ZVNA 1GZSA 2JLZA 3NKVA 4GPTA 2H7VA 4AKEA 2WWHA 2ZIAA 3UKDA 4E03A 2YOFA 1F3OA 4V0ME 4G3XA 1UAAA 2YC2C 1N0VC 1Q20A 4RZXA 1R5OA 3CPJB 3K0AA 2WKQA 2J0QA 2C8VA 4ZDIA 3SHWA 3PQCA 5KPDA 1S0UA 4GZMA 4RZ2A 3TR5A 4PHTA 2FPLA 1QZXA 3AEZA 3NEYA 1R2QA 5G40A 2ZITA 1KJZA 1T4GA 5SZHB 4DLZA 3CWQA 5B58C 2VHTA 2VO1A 2VP9A 2DFNA 4B3XA 4ZDKA 3KJEA 1XEFA 4MKHA 1OYWA 3ZJYA 3GLGE 3IO3A 1D2MA 3UANA 4DLTA 4W7SA 4TQ9A 4AKGA 3IKJA 3KB1A 2XGJA 4NCIA 1IY1A 5E95A 1ZUNB 4Z1MA 3U2QA 1HEIA 2OG2A 4Q1DA 3LX8A 1KK2A 3KFXA 1NLYA 1OFTA 2ZJZA 2XOKD 1GL6A 2QORA 3QBTA 2NZJA 4F92B 1NJFA 1HT1E 1P5ZB 3IGFA 2NG1A 2QE7D 1E94E 4ZO4A 2QP9X 3FMPB 3THYA 2ONKA 2AXPA 1I4LD 3K9LA 4BPBA 2QNRA 4XOIA 1HQYE 4CEHA 1BH2A 3AGQA 2MMCA 2AXNA 3QG1A 2O8BB 4MRNA 1TPZA 3G0HA 5KHOC 4M21A 4DCVA 1XD9A 4I1SA 3RC3A 4GRAA 2B6HA 3RABA 2GEVA 1WBBA 2W58A 1VG0B 3OHMA 4L15A 1KNXA 3LBIA 2VP5A 5SZKB 1G3RA 1W36C 3AVTA 2GF9A 2J0UA 4D81A 2V7QA 3A36A 1Z8FA 3G82C 3N2EA 3THXA 1P6XA 3QF7A 1E4VA 4XD7D 4BGDA 1Q22A 1MH1A 1GRQA 3RDPA 1C4OA 2BKEA 4I1OA 5LBIA 2R9VA 2BWJA 4RD1A 3WY9A 2FH5B 3CF6R 1QHSA 1UKEA 1E1RD 3LWNA 3QKRA 4M1KA 3WNBA 4TTRA 2JLYA 1AGRA 4G5SA 3O8RA 4NYJR 3T12A 1E2LA 3R9WA 1M2OB 3ZVMA 3PEUA 1J90A 5EE3A 2AD1A 4S2EA 2J0SA 2IS1A 4V0MA 1R0YA 5KSYA 821PA 3NBXX 3ECCA 1X8LA 1OFUX 2DCUA 5FPKA 2V4ZA 4OBEA 1K5DA 1FPMA 2JLQA 2JLSA 3KJIA 4K8OA 1NG1A 5JSZA 5KNDA 4AURA 1G64A 2ZRLA 1E9AA 1EXMA 1P2SA 1T0JB 1NBMD 2OESA 3LBNA 2D06A 1COWA 2X1VA 3GQBA 4UNSA 1IY2A 4PQRA 2VSXA 3CX8A 4Q1AA 3KQLA 3DMDA 3A1WA 3KXIA 4WZAE 3C5CA 1KMQA 4Q7LA 2RHDA 4JSTA 4LJ4A 4NMMA 5D3MA 1P2VA 2WJHA 4LJ9A 4WXRA 4KLNA 3U7GA 1E9BA 3J81k 1IY0A 4OI0A 621PA 2CVFA 4IDHA 1VHLA 2JIZA 3DOEA 3BFXA 4HAWA 2YNMA 2ZJ8A 2EFDB 4JJZA 3SBDA 1MO4A 2DYKA 3QNUA 3VR6A 2XXAB 1KI1A 4PO8A 1YZTA 2QUZA 4Q48A 4A0GA 4XSGA 4PR0A 4HI0E 3PEYA 2VSOA 2P67A 3UATA 2IF2A 4NHOA 2QMUA 2XB2A 1G5TA 1LTQA 2ZU0C 4C7OA 4PHHA 1QVAA 5C2JB 5D3MB 3GLFB 3JZMA 4JVSB 1AGPA 3VX3A 1GVNB 3GJ7A 2A5JA 1KK3A 4KYIB 2KSQA 1NKTA 2BDTA 4US1R 2DWPA 4TMWA 4UNRA 2XZOA 3AF1A 4TZ0A 3O8BA 1VTKA 3C7KA 4OQFA 4Q1CA 1F2UA 1IXRC 3C41J 4QNMA 2YC4C 1U8ZA 1I2MA 5FTJA 2D74A 1G19A 4ZIRB 1JQJC 2FEMA 3ZZ0A 1DAGA 1N5LA 5JWHA 2OLJA 2GCOB 3SYKA 1IBRA 3CRVA 1U98A 1XMVA 1N6HA 1PLLA 2G0TA 1FUUA 4RFSA 3IPXA 2QPOA 2XTNA 3QPWA 1DAHA 4PC7A 4UXIA 2D62A 1Z0IA 3ZQJA 4RCZA 1JEDA 2GVDC 5BYKA 1Z0JA 3Q9LA 2O0KA 3AQ4A 1II8A 1Z29A 4KJZA 4OK3A 4P3YA 5AJWA 3A4NA 4MA4A 2Z4RA 3LA6A 4ASUA 1TEVA 2WSSA 3SS8A 2GJSA 4CEIB 3G5UA 2GJ9A 3QXSA 4B73A 4C0JA 3IEVA 3SQWA 4RKFA 4MGIR 3IQWA 1KY2A 4TMKA 4DEXA 3A4LA 1KO5A 1W44A 5FPYA 1A82A 2BOVA 4KU4A 1G3IA 2H16A 4DT1B 4FWIB 3LH5A 1U9IC 1ZM3A 4XTRA 1HURA 1RW4A 4H1UA 1VHTA 1NMZA 5DLQC 2I4IA 5JJIA 4FI3C 1OKKD 4B3GA 3N70A 2ZE7A 4R71A 1P75A 4CEJA 3VR3A 3AH8A 1NBMA 1RRPA 1TL7C 4BFZA 2RKOA 3UMFA 1XD2A 1E1RA 3RS2A 2VPPA 1COWD 3AUYA 2WJGA 1K5GA 2CE7A 2XSZD 2H1LA 2QTFA 3IDQA 4NPHA 4Z8YA 4Z54A 4ASUD 1QG4A 2FV8A 2X8AA 5DI3B 1SZPA 1FOEB 1JXMA 2WAYA 4N1AA 5EXTA 3GLGB 4TLAA 5B57C 4KVAA 3RWOA 1XPOA 1NY5A 2OHFA 3ZGXA 2WWFA 3GJ6A 1KGDA 4IOLA 1OFHA 4NTZA 1P9RA 1YE8A 4QC2A 1GL7A 1N6PA 1FNMA 2J3EA 4NCNA 2Q9CA 4OL0A 5E4FA 2ZI4A 4EDHA 3E70C 2YWHA 5K8UA 5FL7D 4YMSA 3QBVA 1ELOA 3FKSA 3CNOA 1OKKA 4Z1MD 1HYQA 4F38A 1O3YA 4P4SA 2QM8A 2F55A 1AJEA 3QI2A 2B92A 2O0JA 3MRSA 4JL8A 1KI6A 2NTYC 4LJ8A 3A37A 3B9PA 4BWYA 3T15A 3GJXC 2WVJA 4X8HA 1N0UA 2ZRMA 2ZUCA 3NC1C 3QPVA 4W5JA 4DSTA 5JJLA 5AWFC 3S1AA 1G4AE 1H8HD 3NIBA 1E2HA 1AKYA 2CLCX 3H4MA 4CF7A 4FCTA 4LJ6A 5JBQA 1AA9A 2P5TB 4DIDA 2PEYA 1WBDA 2A5FA 4R2IA 2F6RA 1J7KA 4JSYA 3AVOA 3MJRA 2FF7A 5TXGA 1OHHA 3E2IA 1Z6XA 2JJ2D 1OH7A 4OHVA 4CEHB 2YYZA 5M04A 2QT0A 4B32A 1G16A 5JRJA 3I92A 3LW8A 4IEEA 1E9CA 2EYQA 3P1JA 1A7JA 1MO5A 5FUYA 1TNDA 2EFEB 3GCGA 5FPHA 1DEKA 2F43B 2XITA 3IBYA 4LCBA 3WYFA 5IK2D 1JPJA 2H17A 3CRQA 3HYRA 3RYTC 1C1YA 3TAHA 2J5XA 4V0KA 4B75A 4CVNA 4O25A 1Q1ZA 3MUFA 4OI4A 1CJVC 4QBIA 1G18A 4B2PA 1NMYA 4QGGA 1DPFA 2IS4A 2GCPA 4ZCMA 4PX9A 2YZ2A 4EAQA 1N2CE 2B21A 3QF4B 4MUAA 4TYWA 2F1HA 4M8NE 1TAGA 1XU4A 1E3MA 5BWMA 2YWEA 3ZIAD 3RRZA 4RD4A 1KK1A 2KI5A 1ZC4A 2DWQA 4KSCA 4ZDWA 3DKVA 3Q5EA 5FFMA 1OHHD 3TH5A 1EESA 1ONBA 1Z6TA 4U5XA 1MT0A 2V1UA 2IXGA 1XX6A 4OQLA 1II9A 2EWWA 3KTAA 4Z8XA 5A5GA 5KO2A 2ODEA 1W4AA 2Q9AA 4DCUA 4DEYA 2WKPA 3D8BA 3KXKA 5IRCD 1E2GA 2A30A 1W0JA 4MKGA 4BEBA 5HTKA 2CE2X 4L8GA 3BH6A 4PAQA 1KO1A 1KI8A 1G291 1VG9B 2V8OA 3OAAD 2X19A 3B5JA 5DN6A 4AYWA 1R5BA 2FSIA 4PTLA 1W2GA 3GLFA 1P3JA 1KIMA 3OE7D 3SE0A 4A82A 1JNYA 1Z2AA 2ATVA 4NYIR 2XNDA 3IEUA 3FMOB 3BD9A 1CKEA 4Q9KA 1ZNYA 4P32A 1NVUQ 1VCNA 5BN3A 2ZRKA 4Q5IA 4M4SA 4DDTA 3QKSB 2OAQ1 2ZAOA 1YHNA 2PT5A 4KFTA 3ZIAA 5GVRA 2ZJBA 1BYIA 2P6UA 1OF1A 3KKPA 5CLQA 1KKLA 1G7TA 1TF2A 1N6NA 4A92A 2GTPA 3QQ5A 1IQPA 3PUVA 4FMDF 2IYZA 1GNQA 2V54A 1GAJA 2F7SA 1RYFA 3IHLA 2C9OA 2GNOA 1C9KA 3K0CA 5ANRB 4M53A 4KO8A 4HSEA 4B33A 1RFLA 2GXUA 2V9PA 1Z0AA 3EZ6A 4NONA 2PMKA 1QVRA 4NZYA 3ZDQA 1G8HA 4DLWA 4QJ4A 4RKEA 5B2ZA 2IYRA 2Q3MA 2ZRPA 4Q1FA 1CR4A 1XXHE 2Q3FA 4DSOA 1DG3A 3OEEA 2QY9A 4M9XA 5LB2A 2ZRBA 3RSLA 4CIDA 1J70A 2R6AA 1O87A 3CO5A 1NN1A 3AF0A 2C9CA 4TL8A 2OBNA 1SKQA 1YRBA 1EG7A 3VKWA 3U6KA 2E9SA 2H57A 3DZDA 1TX4B 1DVRA 2ZRDA 4IRUB 2EU8A 2BMEA 1PUIA 4PAOA 2O0HA 2KWIA 1F5NA 2CL7X 1H8HA 4Q19A 3WRYC 2IEYA 2FFAA 1T8TA 2ZRGA 3SJBA 3EA5A 5JJKA 3AM1A 2CJWA 3LXRA 2FSHA 3NH6A 1CEEA 1R5NA 3C8UA 2JLWA 5CM9C 4B44A 3L0PA 4BECA 1OH5A 4YMTA 2C95A 3IO5A 1ZNWA 4MKIA 2ZSDA 3KDSE 2BKUA 1XD2B 2FSFA 1R6BX 2HDNB 2UVQA 4MUBA 3T34A 4ZI3A 1CJUC 4GMDA 3TR0A 4W9MC 5J47A 1ZMXA 4TYQA 2EQBA 1VECA 3KB2A 2C96A 4XWOA 2KJQA 5GJWC 3EIHA 3U3MA 3TVDA 2YV5A 4OI1A 1XRJA 4LV8B 3GLFE 2ANBA 1EX6A 4Q4AB 1E2IA 2GK7A 1SXJE 4BLQA 2I1VB 2JEOA 3EZFA 3CPHA 2FEOA 4GOXA 4NBSA 4WA7A 4C2TA 5BN4A 2TMKA 4L4UA 1XEXA 1WF3A 3ETLA 3PG5A 4MITA 3CX7A 4RY2A 4PSKA 4QGAA 3TUZC 1GKIA 3B60A 4UNNA 1L4UA 1NIJA 1Z2CA 4ACBA 4C0QC 4JKYA 1GNRA 3C15C 1HE1C 2AK3A 3R7WB 3NBFA 1PUJA 1KO4A 3U3KA 4M1SA 1GWNA 1KHTA 2R6CA 5FTNA 5JWOA 3U4QA 2J41A 4EQ6B 4O2LA 1QF9A 1XTRA 1NY6A 5AUPB 1KYIA 2JJ1A 2ZE6A 3EG5A 4QM7A 1OT3A 1XMJA 3KKOA 2BM1A 4HB0A 4RD3A 3AVWA 1DADA 4G01B 3KUCA 3TQCA 5TMPA 3OIWA 4Q4HA 5DIFA 3ZYCA 5KSPA 3W5JA 3B9QA 4NYJQ 2NOAA 3UWKA 4TMXA 5DI3A 5JS8A 121PA 1N5JA 1Y63A 1S9DA 4TSFA 2K5UA 1SKYE 1PZNA 2WWGA 1ZNXA 3LXXA 4YMWA 4TYYA 4D4JA 2QENA 3WP1B 2QEQA 1KJWA 1G8FA 2ZYTX 4WAUA 2Z4SA 1WDTA 1J99A 2QAGB 1P9NA 4B2LA 4OKSA 4URVR 3LVQE 5KUTA 4Q9LA 2XEXA 1TQ6A 1L4YA 1TQ4A 2J87A 2CHGA 2YINC 1VPLA 2OBLA 4DUGA 4PC6A 2QAGC 5EUQB 3CH5A 3F5FA 1EFHA 5FUWA 1JXOA 2J7KA 1CTQA 1MRNA 2QGNA 5TY0A 1RJ9B 5GADl 2GJKA 5AUQA 2ONJA 5JLJA 1G20E 4B48A 3KTAB 4A0HA 2FZLA 4D0NA 4KBGA 2IF0A 1E1QD 3SEAA 1VMAA 2VYFA 4JYBA 2JASA 2ODNA 4LYJA 3I5XA 1LVGA 1Z0DA 4V03A 3VMFA 1VKJA 1ZIPA 2IA5A 2HT6A 4LHXA 3H86A 4BFVA 5KSZA 4X8MA 1OXUA 3CKLA 3THOA 2BBOA 4Q01A 2G9NA 4EJSC 2YOHA 4N0DA 1II0A 3FFBA 2F9MA 4EFMA 5FR1A 2IX3A 1PJRA 2ZPTX 4XD7A 2GVZC 4A2PA 5FOTA 2IYVA 1WQ1R 4P31A 3I3SR 4I1UA 2CNWD 3WHLA 3KUDA 5F9HA 4M9QA 1AS0A 3KKNA 5FOUA 1IN8A 5EE0A 5FOWA 3LLMA 2G77B 3AF3A 4A2QA 4I99A 1Z0KA 2QZ4A 4FMBB 4A1FA 3QKTA 2ANCA 1NMXA 3BB3A 5BXQC 4D82A 1W1WA 1S9HA 3EZ2A 3EC1A 5KDLA 1KZGB 3MMPA 2HJGA 1I4DD 2JATA 5L3QA 2QM7A 4B71A 3U5ZB 3QF4A 5JCZA 2JJ2A 1YR6A 4AKHA 1IONA 2AR7A 4WZ6A 1LB1B 1YZKA 1T3SA 3QXCA 3K1JA 4MQBA 2IT1A 1SVSA 2W6IA 3DL0A 2R62A 4NH0A 2O8CB 3NXSA 5JFGA 3V4RA 1XPUA 4ERNA 3CRMA 2OO7A 3OF5A 3EX7C 1AQYA 1U9IA 2R6GA 3RS7A 1XCGB 2ZS8A 3THWB 1Z28A 2YOGA 1Z07A 1P7CA 3LO5A 5B64A 3ZD6A 2W0SA 2CJWB 1NLZA 2B8WA 2ZSFA 3FDIA 2FPKA 2JJ8A 2KBFA 2CLDX 4MGYR 2HYDA 4JLNA 1G3QA 4KFRA 4LI0A 4RJLA 4K46A 421PA 5JHGB 1PVOA 2QRNA 5CDFA 1ZRHA 4URZR 3GLHE 4AYXA 3GEEA 4MYCA 4ESHA 2A5DA 4ZCIA 4IDNA 1KO8A 3ICEA 2R8RA 1EFTA 1U0JA 2AD5A 2FNAA 3K09C 4JLJA 3CF0A 1YJ5A 5EZ6B 2D2EA 4XJXA 5AUOB 2ZRNA 2W00A 1E0AA 1XEWX 4IDQA 4HAVA 4JKIA 2WJIA 3GEHA 2IUTA 1XZPA 4M1YA 1V5WA 4R7ZA 1ZD9A 3U44B 3BXZA 3CB4A 2ODWA 2VF7A 4PC3A 1OE0A 3LFUA 3TRFA 1HV8A 5G53C 1PV4A 1CJKC 1E6CA 3K0FA 1Z22A 3TW4A 3EPJA 5EP1A 2OE2A 3EASA 5LD2B 1JAHA 1G8PA 1UBEA 4DCTA 3K0AB 3KFVA 3KQNA 2IYYA 3R9XA 5UKDA 4ABYA 2VLIA 1XJ0A 2PX0A 4PPFA 5DNYB 3PR1A 1AN0A 4EPYA 4LBWA 2ZSAA 4JLDA 3PVSA 4GT1A 3CRRA 1SKYB 1YQTA 2WIBA 3GJ8A 3AB3A 3CUEF 2Q0HA 3RS0A 2BMDA 1Q3HA 2ZI9A 3MD0A 1B0UA 2ECKA 2AK2A 3SJZA 2FWRA 1E4YA 2GZHA 2HV8A 4NU0A 1DOAA 2R6DA 4LYHA 5FPTA 2OCYC 1FP7A 3VQTA 5HE9A 1QG2A 2HLDA 4M1WA 4V0NA 4ARZB 1G41A 4IVQA 1RIFA 2OBMA 2VEDA 4LV5B 1Q0UA 3I5YA 4LDJA 2REBA 2MSEB 2BHRA 3BGWA 3RS4A 3UK6A 3TJZA 5KPJA 1F2TA 5EP3A 1M7GA 1G3UA 1U81A 2GDJA 4BLPA 3SU8A 1G4UR 4PSAA 3VKHA 1AIPA 1H8EA 3THYB 4QJ3A 4Q4HB 2FU5C 1LFDB 1ZC3A 5CB6A 1H65A 2X2FA 2ZETA 3B85A 1SGWA 4PFSA 3AP3A 1UPTA 5JEDA 4JLMA 3LNCA 2QI9C 3PUXA 1RZ3A 2FFHA 4OHYA 1NN0A 2CHQA 4G5RA 1JB1A 1E2FA 4DDUA 1D5CA 1XDBA 3X1ZA 4ARZA 1RYHA 3EC2A 2XJ9A 3O8DA 4C0BA 2V7QD 4HAZA 4PZLA 1JPNA 5JWRA 2ZS9A 2R44A 1G5RA 2IYSA 2BJVA 2ZUDA 2VHJA 1OW3B 3TGPA 4A4DA 4YONB 1VDZA 3QEOA 4D4KA 3WNDA 2QMOA 1FNNA 1KNQA 3B1VA 2FFQA 3LQQA 1GG2A 4KXFB 1FTNA 2C78A 2VF8A 3IHWA 1BKDR 3TE6A 2WJJA 1P60A 2ZS7A 3E5HA 4BLOA 2BBTA 2RB4A 1QDEA 3OE7A 2GRJA 2WJVA 1W47A 5IF9A 4MRPA 4LRWA 1JI0A 3W3ZB 1KI2A 2Z6VA 3A1SA 4ZCLA 5CB8A 3A1TA 3CX6A 2YHSA 1SVLA 4FMCF 4I81A 4IVRA 2DY1A 4F91B 3BFVA 4ZKDA 2B7CA 5GJBA 1EFRA 2RGBA 5JCPA 2CEAA 1X1RA 4HUTA 4TYNA 3N2IA 1JJVA 3GLHB 3VU9B 2QN6A 3QEJA 4HZIA 3B13B 1MRSA 3EPKA 1ZU4A 4M1MA 1KSJA 4GBMA 4DCNA 1KI6B 2WBLC 3B6EA 3U3JA 4DLYA 1DAIA 1OYYA 2XTZA 3KJGA 4KLZA 1YZGA 3K0EA 2IYUA 3K9HA 4V02A 4UNQA 3RS5A 4M1OA 4MRRA 3VNVA 1NVWQ 1LY1A 1XP8A 3T61A 4QGHA 3ZVRA 4HZUA 3UWOA 1Z0FA 5FBWB 3SBEA 1QHGA 2PJZA 1SHZA 4WIAA 4AG6A 4DRZA 4KSBA 4C9BA 2WIAA 4LBZA 3GFTA 1YR7A 4YDSA 1VYTA 1ZCBA 3PENA 1CF4A 1OPXA 2F1RA 3L0SA 4LPKA 2O8DA 1IM2A 2V6IA 1N6KA 2ZUBA 1BO6A 2LKDA 2X2EA 1QHNA 1KI4A 4HLCA 3TW8B 5F98A 1ZM7A 2FZ4A 1UADA 3M0EA 4HUQB 4YMVA 4JVNA 1Y3AA 1WXQA 5KNBA 2QU8A 1AKEA 3C14C 4IVPA 3CRW1 4HB2A 1US8B 2OZEA 2OFWA 1FTSA 2NPIA 4TLDA 2QPAA 3ND9A 3PITA 1D8TA 1W4BA 2ZREA 2RAPA 3ASZA 3Q85A 3NEJA 2VHUA 3VR4A 1ZAKA 4M9ZA 1HT2E 4RFVA 2ORVA 4OJQA 4OQNA 2OT3B 2J7PA 4YC7A 3I8SA 1KI3A 3NHBA 1EWRA 4C4PA 1E96A 4RCYA 1BS1A 4B35A 1ZUIA 3K09A 4BFWA 1H8ED 1UBGA 4A36A 2FFBA 4URXR 2ZJ2A 1W4CA 3AVXA 4ZV4A 4ZI2A 4HLQB 4DLXA 3V00A 5C46F 3BERA 4OI2A 5KDDA 1G3MA 3AP1A 1XTIA 2W2XA 4B6FA 2C2HA 4IOMA 2FGKA 3SDZA
chains in the Genus database with same CATH superfamily
1BXRB 2AXEA 5DP1A 1U3UA 5FOSA 1DO2A 4BASA 5TGDA 1UCFA 2K4MA 2J5RA 2CBZA 2OWDA 5BYJA 3U4DA 1AB5A 3C5EA 3RHFA 4D80A 2OFXA 3UMJA 3GT7A 1HGXA 2ZB7A 1P7WA 5AM0A 5FORA 3O84A 4A5SA 2XMSA 1P1IA 1S1MA 2Q5IA 3L04A 2BY4A 4UDOA 2WIJA 3MF4A 5DM0A 2D1TA 1GCAA 1Z33A 2D5IA 3NKLA 3OZVA 4FILA 1EVQA 4QKQA 1HA3A 4EFLA 4GHWA 4L02A 3Q8LA 1M8JA 1R0XA 2GZDA 2QRVB 3EEQA 3QU7A 4TN1A 1SIUA 1GPUA 3SEFA 2YVLA 3TMAA 2EEPA 1MVOA 3JSAA 3KVNA 4RK5A 1NXPA 1V3VA 2D0IA 4H7FA 2NVUB 1E6LA 1RE0A 2D2VA 2FA9A 3FLAA 1B0PA 1C7EA 3O38A 3NHAA 2ZG6A 4S35A 1RTKA 1GCGA 1ORVA 1WP9A 2X6RA 3DTNA 5DYGA 5M29A 3TSZA 2ZATA 4B3TB 1M6EX 3U9LA 1HE5A 1W6RA 3UHFA 2POQX 4H27A 3V4FA 4TL7A 3A2LA 3CTPA 4BO1A 1KQOA 2PGLA 4NZ9A 4DT1A 5FBVB 3DM5A 3SSMA 3K31A 4RIIA 2H11A 1FLVA 4LGMA 5FBQB 2HLPA 4NR0A 2ZRQA 5SZJA 4KPFC 2WWYA 1OGIA 3Q12A 1FXWF 4ZANA 1UKZA 1QP4A 2A8YA 2HT1A 4M36A 5H81A 2YWGA 4MQFA 1GG8A 3IXQA 1ZD1A 5BOSB 1Y7TA 4G1BA 2IE8A 2B1GA 4J1TC 2NAPA 1LDGA 1UJBA 3NH9A 4FGUA 4JA0A 4B40A 1UANA 3HN6A 3V9PA 5ALPA 2VHQA 1V1JA 3RRBA 1PIWA 2NVUA 1S2IA 2RG7A 5EN4A 2ZCUA 4DGQA 1G7CA 2OEPA 4AB1A 3JR7A 1O94A 3WYNA 1XEXB 1YV9A 3L1VA 4LG1A 3HL4A 1R0WA 3BMOA 3ADBA 3DFKA 2BI8A 4GL2A 3F5SA 4KNWA 1O95A 5EZSA 2YIJA 2IVZA 4PHFA 3L6DA 2HSGA 4UAVA 3NQ41 4AKIA 3OJWA 2KX7A 2O23A 1SNYA 2OSVA 2OUKA 2ZQZA 5CDSA 4XR4A 4Q3DA 1WW8A 3UMRA 1ZH6A 3LD9A 4ZTZB 1T8RA 3TFOA 3D7LA 4CL3A 3V8RA 4QX6A 2PANA 3G8AA 1JSLA 2ZVQX 3ZOKA 3WMEA 5EKDA 2O2JA 1JAIA 5L95A 3BB1A 2HMTA 4FUQA 4M87A 1SBYA 1KMHA 2IDMA 3KPYA 3L92A 3OIVA 3PPWA 4YRJA 4KR9A 3S29A 1ZVJA 1XRMA 2J85A 3T7RA 2W9XA 4CT5A 3DDHA 3FI9A 3BWDD 1SXIA 1P4JA 5HF6A 2PD3A 3KRTA 4D45A 3KJHA 3C6ZA 1G5QA 1Z18A 5EXXA 3WG9A 2R48A 2FZ5A 2KE5A 3ZWOA 3K1ZA 4KQEA 1SUAA 4B31A 5HOEA 5KMGB 5LP6B 4LRTB 4WKGA 2IH4A 1U2EA 1Q7CA 5I9TA 3ZWQA 4EGQA 1EFKA 3RH0A 1GLVA 4YMLA 4KR2A 3MOSA 2NPFA 2HHHB 2VTBA 2B34A 1RR6A 4YAKA 1VRCA 1NWHA 1D6JA 1VE9A 2FZEA 3AK4A 3WMGA 2IYNA 3KKKA 2MT9A 1NE7A 4FINA 1JKIA 5ENVA 3NATA 4PZYA 5AJXA 4AW9A 1PG0A 5DYNA 1ZVQA 3PNQA 3AFNA 2NZ2A 4WOJA 4OV6B 4K40A 1TF7A 2HF7A 1R0BA 2PL3A 4OUDB 1C4WA 2XUKA 3SQLA 2YFQA 3B6JA 4WLOA 2ZJAA 2WPNA 1F12A 5JDCC 1AK9A 1PV2A 4MUFA 2G40A 1I13A 1CSEE 1JJIA 3IMGA 2AMJA 4LJSA 4G5QA 1A4XA 1X6VA 3IULA 5DASA 3S8MA 2B4TO 1P4GA 3ELYA 4GS5A 2VTBB 1Y5LA 1AK2A 4BVKA 3NDPA 4M0PA 3ZN2A 4IBOA 2J7PD 3GFPA 4FGSA 3D43A 3CEMA 4H1VA 1ENZA 4LHWA 2WSSD 4BQFA 2ATIA 4G1VA 1O0CA 4URHA 1R9NA 3OMWA 2AG0A 4JOSA 3QLVA 1ZYUA 1IULA 2BTQB 4GX2A 3VTFA 4BQOA 1T13A 2ZIXB 3GFRA 3NKFA 4FFBB 4I0WB 5F4ZA 3IAEA 1RQPA 4IXTA 4HLDA 1ZGBA 1KY5A 3GOQA 2I3GA 1LKZA 2BEWB 5CM8B 4G5GA 1DJQA 1PJAA 1DWOA 3JVDA 1GKYA 3DWEX 1YS7A 4B74A 4ETMA 1PFQA 5HBRA 3AQIA 4JLAA 4DJ5X 5B1IA 2E5LB 2VK2A 3EGIA 2FPGA 2IYTA 5CIQA 5GVSA 5HTOA 2UXDB 1RC0A 2XF2A 1FDVA 3K1YA 3OETA 1RRMA 4LNUB 4M98A 2DQYA 4XPIA 3BXOA 3LFTA 2P8SA 1QANA 4JLBA 3NX4A 4IHQA 5KVQA 4CI9A 3NVKI 4J6EA 1Q0RA 3FYCA 2WAMA 2VIIA 4GNKA 5BXYA 4Y2XA 4RD0A 4KDFA 5K1ZA 2Y67A 5HKOA 1FRQA 2O8EB 4B5KA 1BVYF 3HGQA 5C80A 5AVXA 1P8JA 3K0KA 2OBBA 3F9CA 3ZLBA 1GU7A 2J59A 3I52A 3LVFO 4MVJA 5E0KB 4Y1GA 2QSYA 3DOHA 1JX6A 4ZVQA 3ZW9A 3ZD7A 1SZCA 1YIOA 1NI5A 2GNAA 5TV2A 2XUOA 5EIHA 4KDRA 2A59A 4BFCA 4AY5A 4IS2A 2NM0A 3L7JA 4JI3B 5JEEA 2DPLA 2DBVO 4HH3C 4ENUA 4J03A 3TM4A 5KKNB 5I4BA 1C9YA 1VGVA 2W0MA 4WZBE 1GQSA 1TO2E 1X7WB 2ZJFA 3I2KA 4UDXX 1EJ2A 1Y6GA 4R1UA 2A4KA 1GR0A 1TRHA 2AW5A 2G72A 3D02A 2GAFA 4M3NA 3ESYA 2HRDA 3R0ZA 5JZ9A 3WMFA 1FSPA 1VPVA 5DULA 1NQAO 3EIXA 1YDEA 4LYDA 2VJCA 3ZY3A 4RULA 1HDRA 4WVFA 2UUOA 4UNPA 3G9XA 1E62A 3UUEA 4YALA 3BIXA 2GJAA 1RTTA 5CURA 1U02A 1ZH4A 3FMIA 4OFZA 2SKCA 4OQDA 2FX3A 3VZBA 3HYTA 3RLFA 2JRLA 2XQFA 1U6KA 1W4ZA 2B8JA 5AVQA 1TF5A 1XZQA 3RT9A 4COKA 3F6CA 4UBJA 1E2EA 2P0YA 3GWGA 3OCXA 1QM5A 1IHPA 3G2OA 1R8SA 3ZDZB 2GYVA 1VBKA 1LS6A 2PX3A 1F5SA 3GD7A 4PIPA 4QXMA 4IXMA 1FTGA 5AJVB 2QT9A 3G2PA 3T4UA 4BEJA 3KR0A 5F3WB 1KP3A 1PL0A 1Y37A 3IQIX 2J45A 4FE4A 4GG1A 4ZTBA 1CQXA 1E69A 1GQQA 1JUDA 3CJQA 3H9GA 4DV2B 4QBTA 3OI7A 2AC2A 2QQGA 4NEGA 3UJPA 4QFCA 5HCUA 1DCTA 5K3AA 1NRJB 2XRZA 1JTEA 3F0TA 4YJ2A 3IMKA 5L3QB 3D3QA 5JAZA 3K8YA 5JZVA 3FPSA 3FCXA 2AV6A 2J33A 1P1RA 1L5YA 4RIHA 2V4MA 4D1YA 3NAGA 2QLJA 3ANXA 2NO7A 3O7WA 4Q3CA 5JQGA 1LLFA 4MV3A 1N2EA 1YS9A 1IN7A 1ORRA 2Z30A 1N25A 3QVWA 4J76A 3COZA 2FHPA 4WN9A 2WAXA 5C18A 2OB1A 4YUZA 3T1VA 1A9QA 3QX8A 5AFSA 4ZQCB 3G8CA 4HBZA 3O21A 3VC3A 3V34A 2J30A 1IEXA 1O6ZA 3P9SA 1F2DA 3ZWVA 3ADKA 3QK7A 1FVOA 1DZIA 1NAHA 4YRZA 4ESVA 1E9FA 4RHEA 2E4WA 2UZ1B 2VDRB 4MV1A 3RVRA 5H4GA 2PE5A 1LK5A 1JDZA 4KQKA 1JILA 5KVCA 1ZU5A 1PEKE 4ZT5A 2HL6A 3SKXA 1SB8A 2Q5OA 4P84A 3LRPA 4HDNB 5FL3A 5DGHA 4G0OA 2QBYA 3DEHA 4G8JA 1B6GA 2H1SA 2JZNA 4DN6A 1JSCA 4EG6A 4HNTA 4NCAA 2C5FA 4RNCA 4E1VA 4P3KA 2JFYA 1JPUA 4TQUS 3Q8WA 5DGIA 3B1ZA 5EHGA 2KBEA 1GSIA 3LO8A 4TKVB 3MWDA 3RJTA 1KJ8A 2UKDA 4GEKA 4S3MA 1GGKA 1Z4NA 3ZLTA 4YIHA 2NQTA 4P92A 1EH5A 2WUDA 3N87A 3ER6A 2WT4A 5AVTA 1EFRD 3DXZA 3OEHA 4UEQA 4C0SA 1G21B 1JR2A 1RWMA 1YDGA 3DEFA 3TBHA 4YMGA 3RYCA 3FUTA 5FBRB 3CNHA 3SWWA 3A10A 4XVUA 3T1YB 2MJLA 1ODKA 3OESA 2WWIA 4JEIA 3ZGZA 3PF8A 2C2BA 5DEIA 1GT91 1KGSA 1T0BA 1WG8A 3FXAA 3Q3EA 2EGGA 5BWCA 4MS3A 4BRWA 1P31A 3HUDA 4QREA 3QUQA 1M2JA 5B1HA 2VQEB 2GBLC 3Q40A 1FU4A 2OHHA 3U31A 5HKKD 4WESA 1ISGA 2EDAA 3CZQA 3OU2A 5DH9A 2DJIA 2II6A 3AINA 4ETNA 5LDHA 4DL9A 3NDJA 3D31A 1R8QA 2RGNC 4DMLA 2HI0A 3FFAA 2VWGA 3EMVA 3OFNA 3NVDA 4UEJA 4X41A 2PT6A 3SC3A 3B1KA 1FMCA 1NTOA 1CRLA 5TEWA 1XQYA 2DUUA 3R6DA 5FWAA 1ZCJA 2B1RA 2QDKA 4MW7A 1A98A 1KQ3A 1ZD3A 4A0FA 4KXMA 2C7QA 2ZR9A 3IHKA 2W6JD 2I1QA 2NUTB 3GYGA 3RASA 3AHDA 2XUAA 3D0RA 4FLFA 3UT0A 1D6NA 4N82A 1OH8A 4QBGB 5JD6A 4NWIA 5H68A 5LBTA 4C0HA 1B8VA 2VBCA 4KQIA 4QD3A 4Z86A 2A78A 1X1TA 1C1DB 1OXBB 1OXSC 5IC5A 2GLXA 3K0HA 3C97A 3RHTA 3E2PA 1SRRA 3O74A 3WDLA 1GAEO 4DV3B 3B1XA 3KQTA 5BORA 2G70A 2NPOA 3W8RA 4R84A 3BRQA 1UP6A 4WFIA 4C6TA 2LE0A 1X1QA 3MQ2A 3QUCA 4HJXA 1RYBA 5DE3A 4B9EA 3BHIA 4NENA 5KTYA 5THQA 2OZKA 3KQPA 1QH1A 5CXQA 4NBNA 2P3LA 2Q21A 1ESDA 3NVAA 4QU9A 1TW2A 3E22A 1OJ7A 1KP9A 1MEEA 1U0BB 4KO4S 4RSGA 2JPDA 1S2DA 2C04A 1SBNE 3U4QB 2Z1MA 3IPRA 4W9NC 3SHVA 2X22A 1IY8A 2QLTA 4IEFB 5EHIA 3LCCA 4K6MA 3AJEA 1AZTA 1PZEA 4PV7A 5EA2A 1QP0A 4LC9A 3LK7A 5FPPA 2WU3A 3S4YA 4MWGA 4RPCA 4BEVA 4XVQA 4KFUA 3HU2A 1CLEA 1QGUA 2F9LA 5KWJA 4AICA 3UMSA 1U0NA 1QX4A 4M0EA 3BN3A 3FZQA 3FTCA 5HXAA 4YRCA 5IBQA 1RAAA 2A5LA 3WDKA 3CF2A 2HBRA 1NF2A 4P7JA 5MFZA 4WX2B 2Q2VA 3JQBC 5FD8A 4CU2A 1L0BA 3V8PA 3HEMA 2LVBA 3BSYA 3G13A 2BMJA 1HTWA 1WB6A 4EKNB 4FCWA 4KXWA 3F7TA 2OKCA 1PLJA 1HOTA 5IFKA 4C3ZA 5EXEA 4NPCA 4B17A 5JD4A 2X86A 3UT5A 3BXHA 3G9UA 4C89A 4EENA 5BW8A 2P27A 1WEKA 2CDNA 3F67A 4GYWA 3M9XA 1M1NB 3SM9A 1HDOA 5KTSA 1S3SA 4YVFA 3X2EA 2X77A 3DEKA 1N5IA 1GAXA 4JBXA 5BW6B 3SR0A 2XMDA 4BOYA 4B3MB 1PFVA 3TD9A 1DL5A 1BCRA 1JRLA 2AFIE 2H1FA 2FVXA 3H11A 4DQKA 1NBME 3F6RA 2CXHA 2PXXA 2W8ZA 5COAA 3G0IA 1FLDA 3SICE 1XAIA 2IRWA 1RLJA 3B5EA 2XA9A 1O5IA 3NU1A 1Z4KA 3HZOA 5H59A 2E55A 3VYVA 3H16A 1B74A 5IJAA 1DO8A 2C9MA 4FOSA 1OXMA 1YD7A 4IDGA 4C0LA 4JAVC 2ETVA 1CY7A 3JQ8A 1LBSA 1Z3CA 2PMWB 4TSKA 3U48A 2JGJA 3W5AA 2H4WA 5A7HA 3S2GA 1JDVA 2C2MA 3D64A 3VPGA 3NORA 5U1PA 1RPZA 3A7DA 1EA7A 4O4HA 5EEGA 3TZBA 1BWRA 4CLOB 1OX5A 2N3ZA 5B7NA 3H3JA 1B7GO 4GNRA 4B7CA 1EP1B 4TMYA 4KPGA 2OCBA 4HDQB 2H48A 4KQ2A 5DIZA 1AVTA 2AYYA 3B78A 4KG7A 4X64B 5JAUA 4IO0A 5E7IA 1RJDA 4RLHA 5D3KA 4UDYX 2F1JA 3B1YA 1PT5A 1HDIA 4ML3A 3SNHA 4GXNA 2EFJA 5FEUA 3ZK8A 2WKRA 3A28A 2CFTA 1D9XA 1T91A 2PRKA 4B3BA 3T3DA 2OMKA 4J0DA 1YNSA 2G9QA 5L6LB 4LF8B 3IQXA 5PNTA 1K7FB 2ZAMA 3RC2A 2IFTA 4DCGA 1DLJA 1PUXA 2JH3A 1VL1A 3ZE1B 3ZDFA 1I51A 2UYQA 2YVKA 4L4XA 1TTPB 3TPZA 1QHIA 4M8SA 1MC8A 4OQ4A 5KOYA 3TIXB 3H9UA 3S2IA 3T4PA 3FCUB 4MW2A 1ZXLA 1X80B 4O4HB 1PLKA 1G63A 1GZ6A 1RWKA 2N9UA 1DJNA 5ARBA 4MGZR 5IG2A 1DEAA 1DTSA 3LBYA 2BKAA 4FZ5A 3WGQA 2HIGA 4AFNA 3B82A 4GECA 4CKWA 4CNQA 2J3IA 2PX4A 2QYHA 1DHTA 4TTSA 5EXPA 2K87A 1WLYA 3QY9A 4EUSA 3HBAA 4QDTA 2E37A 1FJXA 3N2YA 4FFRA 2IZ1A 2AG6A 2ZI3A 2CL6X 2VDUE 1DELA 3I01M 3WKBA 3THSA 4DBLE 1AUOA 1BS2A 2L2QA 3ELBA 1GUZA 1O95C 3KWJA 1OSNA 2KB0A 2CMDA 4HN9A 4HWGA 3CWZA 4FYWA 2MTBA 3UFXA 4LHZA 1ZPDA 2QS9A 2XWBF 3FWKA 1K6EA 1BXGA 1YT5A 2QT1A 1KXJA 3K92A 3QYAA 5HDQA 3RRJA 3MFYA 4MYTA 2O52A 2WT9A 3JXEA 2CLEB 1Y9DA 2B78A 4JBYA 4ZVLA 3ZHZA 2GN9A 4PQFA 3V9AA 4OO3A 3E6AA 3LCRA 3UJ3X 1DC7A 4FB4A 5FDFA 2QP3A 3O8OB 4MKFA 3L49A 2HIAA 4Z1OA 5FV4A 1RZRA 4OX9Y 3HL0A 1L4NA 4HDAA 4HAIA 2O9JA 4KFCA 3GJZA 2B5OA 2GPAA 4WACA 1RWXA 1TM4E 3EH2A 2RHTA 3IEKA 3M5WA 4IIJF 4IFEA 1NHGA 4JH0A 5AQ1A 1E99A 4HNAB 1QE3A 4FOOA 1DXOA 3FPLA 1XB2A 4KL8S 4O1MA 4XQ0A 5C5CA 3V2IA 4M54A 1E64A 1U9ZA 1YKFA 2ZE8A 2Q6VA 2YUTA 1A95A 1YOVB 4AZTA 4BCCA 1YAJA 1DKMA 4HXEB 1MJHA 3H2IA 4AX8A 1NVXQ 2ZVDA 3AMVA 4U0JA 2V6JA 1CXZA 2HMWA 2GZMA 2I66A 3F4LA 4FMPA 4PFQA 4YJ2F 2NXWA 4KR0A 2BTEA 4TL6A 5B3JC 4ZAWA 1NR5A 3B7PA 5AM1A 4WZBB 4NG4A 1I3LA 3BRWD 1U3TA 3ND5A 5I47A 3RC8A 4GKKB 4IDCA 5E1DA 4TUYB 2DPXA 2WG2A 2Y76A 3DMNA 4Q3NA 4KXXA 3WAJA 3LW7A 2A9PA 5EJ4A 2CK3D 1SXPA 3LPAA 5BN1A 4LYAA 4DYHA 1JEJA 4LFCB 1U5AA 4I9FA 5F21A 2WSBA 4EHAA 1ST3A 3G2KA 1C9MA 1FQJA 1L1QA 3WLAA 4DG8A 1MB0A 1VB3A 4MB2A 3F5DA 4OAOA 4RVOA 1E9RA 4ONEA 2XVZA 4WJZA 2EAUA 3JAWA 1CDOA 3OOSA 4E5KA 1AO0A 2G9ZA 2QL6A 1RS0A 2XW6A 3MTAA 1L1EA 1M6VA 1SCUA 3GJYA 1B8NA 4NBUA 1GM5A 3AEXA 1GTVA 3B7GA 4D74A 2V3CC 2UYYA 5AR1A 4C5AA 4RXUA 5HF9A 2G1KA 5HKLA 4DZRA 2O3UA 4US0R 5AJZA 3VH4A 3S28A 4ATNA 2IYXA 2NZVG 3P2OA 4LY3A 2PUVA 1N3BA 1L3BA 3CMCO 4RJJA 3RVJA 5H8WA 2EEZA 2MR5A 3A58B 3STWA 1H2XA 3A1VA 1EQ2A 1Y6ZA 1AHNA 3U17A 2V0CA 3QPAA 4GGOA 5AI0A 3UW1A 1Z6GA 1I7QB 1Q1EA 3TSAA 1W5SA 3AEUA 1K6XA 1QYVA 2EFCB 1SHTX 1W35A 4WHMA 4WESB 2ZT7A 5ERGB 3F7NA 1W88A 1UQTA 3G59A 2REOA 2QB5A 4CKZA 3JQBA 3FTQA 5LXTA 4XDZA 1RWWA 4CYMA 1N2SA 3FVQA 1JWAB 1KYYA 2D1SA 3NONA 3QV1A 4KCGA 4LSZA 3WYCA 4XB1A 1HLGA 2VYND 3T06B 2MYUA 1D2RA 3GLHA 3DEYX 3C6MA 3FKJA 3IP8A 3REFA 3Q7PA 1W9MA 4KRYA 2XQVA 1LI7A 3DE7X 4LDNA 5EWJB 3USCS 4IJVA 2F3UA 3BULA 4JVOA 4N5IX 3DXFA 4TT3D 5CK4A 3TECE 3R7WA 4X8OA 1E9SA 5JAMA 1X8KA 3E9RA 5CYPA 1J0CA 2IQ5A 3P96A 1V16A 2B94A 1GFZA 2ZBRA 1U8XX 4I50F 1GQRA 2TECE 3JQGB 3U56A 4XB2A 2IXFA 4XLZA 3IELA 2QR2A 4J0CA 2WF5A 3QPBA 5JISA 3KC2A 1AV7A 2JZCA 4PZZA 2CWWA 1MX3A 2JIPA 1NMQA 4O4IA 2GEFA 1VJ0A 2OAGA 1GTMA 1UFKA 2AMFA 4MO2A 4Y6QA 5KYYB 3LTEA 2C4HA 4LMPA 4QG7A 4IF6A 5CVVA 5C35A 4D0GA 1WETA 4RX1A 1MJGM 1PKXA 3LI2A 3MAGA 1V1MA 3NM4A 3DDZX 4NMWA 1W94A 1U3FA 3U9SA 1T8UA 4ZEOA 4CDNA 2QJWA 1KOLA 3P19A 2JLCA 2C0CA 3AXTA 3JWHA 3U61B 3P9IA 1RJGA 4GP7A 3QVUA 2G0NA 1K4MA 1XALA 1JYEA 1V47A 2W6JA 3DKPA 3I5AA 5FOVA 5C4GB 3NUQA 3X1JA 3W1WA 4EPVA 4RL6A 5I7WA 1CR1A 1LLCA 3GLIB 4AS1A 4FEYA 3ZU6A 1Z08A 1SFRA 1TGVA 1JEQA 2QRZA 1JG7A 3SXPA 4GBJA 2O6HA 4X3OA 1V8ZA 2QQ0A 4R69A 3C4QA 3N8HA 4G4SP 2YR0A 5AKEA 3V6LA 1R0KA 1QR2A 2C4UA 2EQ5A 4U2BA 1KIFA 3LP8A 4QLBA 4A27A 2AEEA 5T4BA 4CHTA 4D6XA 5CK5A 1QTQA 1QNLA 5CA1A 3LUPA 3O3OB 3K9GA 3OLCX 4UHDA 2AG8A 3PGA1 4D2IA 2H92A 1N7HA 3GJSA 2EWVA 1CLUA 3QKRB 4XJTA 1GAQA 2AR9A 1KI9A 3WRYA 2FSVC 4DIOA 3P2EA 1KY3A 1L5MA 3QRWA 4UUMA 5TQ0B 1GZ3A 5CDHA 3ACBA 3M1IA 4IQFA 3GLIA 1MBZA 4TTVA 2NMVA 3T1TA 5J59A 4IFBA 5KNCA 1AUVA 4CLXA 2QGZA 1GIAA 4ROSA 4BGVA 5D00A 4YUXA 1RYNA 3BBPA 4CQMD 5A5FA 1Z62A 2GYWA 4EGJA 2R2AA 2FDRA 3FUWA 3IOBA 4WBNA 2PZGA 1YAHA 3CE9A 1OBVA 1XTQA 3TZEA 2ACVA 2X8WA 4OQQA 4FE7A 4S0ZA 2DFDA 2RCNA 2B30A 2VJDA 3OWHA 1EGAA 1VLZA 1RC1A 3QVTA 2EBFX 3FCEA 1YRWA 5LDDC 1Z34A 2C0QA 1UBRS 3KHUA 1TQ8A 3L5OA 4ALMA 4KBYA 4AULA 1YB7A 5B7PA 1J0XO 3ADDA 2CK3A 1PHRA 3DWGA 3STYA 4F6RB 1XPRA 3DT8A 2CB9A 5TVGA 1ZCAA 2XT9A 1VGRA 1DIOB 2DECA 4RTJA 3HBNA 3K70C 1S2LA 4ZVVA 3W5IA 1XA0A 3OECA 4BXOA 3WJAA 2CVHA 2V9ZA 1KU6A 3EXFB 2P6OA 2PLFA 1S1CA 2ID7A 2BBSA 1T9AA 2VDMB 4PHGA 4TM8A 1HDCA 4J0EA 1V7CA 1SC9A 4TLBA 1MRZA 5C32A 3CEPB 2A9KA 1I80A 3OAAA 3IXLA 1LW6E 2QRJA 4FJ1A 4Q4JA 4DFDA 3WRWA 2EVWX 2VZ0A 2C59A 3GY0A 4EMSA 1I2ZA 3DB1A 2PT7A 5EPEA 1II8B 3IDFA 1CW2B 1XUOA 2X58A 5JNWA 3NHZA 1KK0A 2H9YA 2EZ8A 2B3TA 3SHOA 4BMNA 5I7EA 3UG7A 1FTQA 2WD7A 2XAAA 1UXOA 3UY4A 1ZH8A 3JQFC 4OKNA 2HA0A 5JCJD 5BYAA 2DHRA 1P1JA 3C1AA 2QJRA 1FVFA 2ZR7A 4YV2A 4G4SO 3TD2A 1E3JA 4X65B 1BWSA 2AN5A 1NP6A 3WB1A 3WGJA 1FY2A 2QVYX 4LF7B 3ANSA 4K2AA 3RBAA 5DHFA 4PBTA 3CZMA 3KZOA 1HFWA 2JAHA 3P9ZA 2F62A 3E0XA 3UMMA 2N1BA 2O2EA 1OILA 5CNKA 2MSDB 3KSMA 5F78A 4LJYA 5CUQA 3FGNA 1UKCA 3GLQA 2NQ2C 1LK7A 3A8TA 1OWPA 4TMTA 4WT7A 1MABA 1E1CB 4ISBA 3RUHA 3V3TA 1P0IA 3TUJC 4ZMSA 3ASYA 4K2HA 2Y1DA 1GFIA 4CW7A 5IAKA 2E1RA 2HPHA 2Z2XA 1UZNA 2Q6LA 5K0SA 5U9CA 1USWA 3GHHA 3K8QA 2E7ZA 4NHEA 1P7YA 1UBSB 1YBHA 3DHNA 3HVKA 3LXUX 2ZGVA 4UTPA 3D6HA 4N4AA 4E94A 4JXXA 4M8IA 1S2MA 4X45A 5AVJA 1V7PC 5E1MA 2WYUA 2ZSEA 1GGHA 5GV8A 3UEOA 3JYHA 4PVCA 2VT3A 4XEUA 5DO9A 1RC8A 1SXGA 3A9SA 3VPHA 3MLBA 4BO9A 3SQOA 1HQKA 3FSGA 3NZEA 4KLCA 3PE3A 3REOA 3MT8A 2WILA 4EJSB 1Q2UA 3DA8A 3EAQA 4HNAA 4N6NA 3ER8A 2JBWA 1LCIA 1VCHA 4WFJA 3QTBA 5FL7A 1UPBA 2BFCB 1CUDA 2PAAA 4GXRA 4J7XA 4ZYWA 1XL1A 2DUJA 3E7PA 4KZPA 4EOGA 4ZGWA 4CLOA 3U7QA 1K0UA 4R40A 5TMDA 5EXSA 2ZSUA 1FYXA 3WS7A 3AO0B 4K9QA 5D6NA 4AJKA 3LLUA 3T95A 3HU1A 2FTKE 4PX5A 1RWVA 2UZAA 4B6SA 3Q10A 3FJOA 4DNQA 1QIDA 3N8DA 3I9MA 4R4JA 3DYVA 1F3LA 1E6WA 3D4BA 2H2AA 3OZSA 4QBFA 4QEDA 4G2NA 4KVGA 1GN9A 3F2IA 4AAYA 1K8RA 4FFNA 4MV0A 5IT5A 5J23A 5TEVA 4CT0A 4G85A 3UWPA 1GPDG 2HHJA 4BVLA 2FX5A 2PCLA 4MQEA 5C8ZA 3TQSA 5JAQA 4IJMA 1KMHB 4CLHA 4KTTE 3ZNNA 1HM5A 1U5CA 3JAWB 1OI7A 4MV5A 2H4FA 3SLGA 1UPAA 1BGWA 3B9RA 1AA6A 4R98A 4RMGA 4AN0A 1HZZC 2XCUA 3N5CA 1FSSA 4PO3X 3S6JA 1OAAA 4BMSA 2ZCVA 3R0JA 3OCUA 2I3BA 4JJ8A 3NANA 2KW5A 4EY7A 4P36A 1BMDA 2P6RA 1HI9A 1MEOA 5HK9A 3FYUA 4L74A 4Q3KA 4X5OA 4JI7B 4GOLD 4QQNA 4BBZA 4C7BA 2I2CA 4MPRA 2IODA 4KUHA 5FA5A 5JY6A 1T5HX 1EBBA 1OBCA 1Y9JA 3CZ5A 2E89A 3MJSA 4RV4A 5IMSA 3MEQA 3HDGA 3W9YA 2K2WA 4X20B 4EFNA 1CHNA 1XCPA 2VBGA 2HSJA 3G89A 4O2AF 2A3RA 3PD1A 1FFAA 2BDUA 2A7QA 5FA8A 2E4YA 2JLUA 1XLTA 3I8XA 3PLNA 3C16C 2XKKA 2QW0X 3DWFA 3Q0IA 5HZHA 5EP4A 1DWPA 1QYIA 4Q0MA 3RE1A 4AMUA 3I04A 3I2IA 2JIZD 1QORA 1ECGA 1XTZA 2CC2A 2UDPA 4M22A 4W5WA 2ADMA 3OLXA 1WM1A 4GP6A 2C5EA 1OTYA 2ECPA 3F9IA 2PZKA 3OPVA 2C58A 3MGKA 5TDHA 1VLQA 3LECA 1JR6A 1KDPA 3F3YA 4LWQA 3K0CC 2CNOA 1NT2A 1MV5A 4N5DA 3H2ZA 1M66A 4I14A 4V0SA 5YASA 4IIGA 3I9NA 1NBEA 4CDGA 1G7RA 4DB2A 1RXSA 2JFPA 2FWBA 3EFOA 3AY3A 2ZB8A 3FPJA 4X6YA 3B1WA 2GCEA 2YBEA 3I76A 3IJRA 3LY5A 3H5IA 3Q3GE 5EIBD 1D2NA 1YZ3A 3GCWA 4KI0A 3SX0A 1AS2A 3VH3A 4D9GA 1OZHA 1Z25A 3OT1B 1WSWA 1LPOA 4RW0A 4N39A 2IEZA 3W0LB 1UDWA 2E3JA 3MWLA 5G3ZA 5IJ9B 2XA1A 3A32A 3N2LA 2LWIA 3TQFA 3EUEA 3TGWA 1CUJA 3EG9B 3BG5A 4IX1A 4XYEA 3DW1X 3SJUA 1OMOA 2CVPA 3IR7A 1NVKA 4DJTA 3GT0A 4G41A 3IEMA 2G3YA 4W6ZA 4C21A 2IBMA 1WDWB 1UC8A 1A7UA 1KOFA 3QE0A 4PO1A 2P0AA 3HCAA 3AR2A 4NOJA 3AFGA 4D9NA 5AI8A 3QVXA 1DS6A 4DLBA 2IS6A 1JQBA 1QX3A 3NTOA 3O8NA 4HQOA 3RG8A 4QOSA 3UZUA 4L76A 2I1WA 4DF3A 4RD2A 5BPHA 1ZHFA 3GROA 3A1FA 3DR3A 2FZGA 5A71A 3SYLA 3R0QA 2JHAA 4NJOA 4OUKX 3N8GA 3KVVA 1PS0A 3OIUA 3TW8A 1T5IA 4D8YA 1SQGA 3TLXA 4B3HA 3LL4A 3GO4A 3TMKA 2PYIA 3TMYA 4XFDA 2H2FA 3VZSA 5DLPA 2DH5A 1YS1X 3NOOA 5ALNA 1LF0A 1UODA 2FN7A 3HXPA 4KDCA 5LR6A 1I1QB 3MG9A 2P11A 4L4RA 5A4KA 2EHJA 3AKZA 5HZGA 4WMLA 2ASEA 3AT1A 3H1PA 2MIIA 1W9HA 1PX2A 2Q7OE 3NWOA 3TEJA 2H8GA 2XA2A 1UAGA 5KX5F 2BFBB 1P77A 4Y9SA 3K32A 2G6BA 4BNMA 3M4XA 3PXDA 3FWPA 1NQXA 5JPIA 5KSWB 1P39A 3I4CA 5DMXA 3VJLA 2IZ7A 2QUAA 1Z7WA 2G63A 2P6MA 1A1VA 4H1HA 3TEMA 1J09A 4NFHA 3UKJA 3R6WA 1R4MA 1SHJA 5K4HA 2QBYB 1VI5A 3ANLA 1N9ZA 1UZUA 3BMCB 3PX2A 1KTVA 1R15A 1VJGA 3V42A 4U9HS 1P44A 5LQAA 4EPWA 1L7RA 3Q2OA 3EW7A 1R6VA 4PAWA 5F7JA 2ZVPX 4IIHA 4Q21A 1FSZA 4IS3A 3VX4A 4XR9A 3ZWDA 1LV7A 2FRVA 1QLWA 2EZTA 3GPLA 1IJBA 1YKSA 3NDRA 4ZVTA 4JOBA 3RVLA 2GEDA 1NW7A 5KNDD 1T5LA 1KORA 2IYOA 4F2GA 4R7TA 2A0WA 1MORA 4D57A 1EKXA 4QBHA 2P2LA 3VPDA 2HO5A 1TM7E 2WV9A 1E6MA 3V4ZA 3BQ9A 3PUIA 3M1AA 2VRWA 2ACWA 1PQWA 1JDUA 3NEAA 4BO7A 1GILA 2VJBA 1XZLA 2GF2A 1YVUA 2C3YA 2X4LA 5JSYA 3NYIA 4YWHA 3LE8A 3DUFB 4UAGA 4RKRA 2B0CA 4KYTA 4OYRA 5EJ6A 4K9OA 2X7XA 4CM8B 1F2TB 1D4ZA 2CL5A 3FBTA 3CG0A 2Z5FA 1FP2A 2NXNA 2OCKA 3EIOA 4L3VA 4LYFA 4Q24A 4QEKA 5DTQA 3PLAE 1J06A 1HK7A 2Y0CA 4HX9A 3U60B 3ZE9A 1FXUA 2GVNA 1J33A 3GH1A 4FYJA 4KAJA 4J3NA 2CVZA 2NP6A 4DLAA 3CLKA 1E6UA 3O2QB 4YV7A 2G5CA 3I12A 5EPUA 5AW3A 1CQWA 4YJ3F 2BMVA 3BL6A 3N2GA 3P4XA 3VU1A 2CXOA 4EHIA 5KWSA 5M5BA 1PJTA 4RQUA 2F1KA 1YRQA 3SZMA 1EUZA 4P34A 2JLZA 3NKVA 3ETGA 4TPKA 2FUEA 2H7VA 2I55A 1ISPA 3D5TA 1PW7A 2ZSKA 1HZZA 1BDHA 3HDJA 2P2GA 1PD1A 3PQ2A 4MAMA 3T0IA 1NM5C 1SQSA 2QSJA 4BNLA 2W22A 2C8VA 4QYIB 4RESA 4NZZA 5CU7A 3PQCA 5AK4A 1KIAA 4ZDIA 5E6SA 3B53X 1ZWLA 4U3JB 2OD9A 4BNTA 1SEVA 2FPLA 1B93A 3Q9UA 1QZXA 4FS3A 4PG8A 3I09A 5K6RA 4G8BA 2D2XA 5CFNA 2J31A 4GPIB 3KLBA 1X7XB 2VP9A 4B3JA 4CKBB 4O8ZA 3OPYI 3ND6A 4P3PA 1OYWA 3P9XA 3TD6A 4WI1A 1JE0A 1PGNA 1DRWA 2V7PA 2VPZA 1KPIA 2ID4A 2FPUA 4AKGA 4RY0A 5A7FA 4UTNA 4WNAB 4DCPA 4NCIA 1RJFA 2R68A 5DHUA 5I9SA 2HRBA 4GMGA 3LX8A 2P8JA 3MWFA 4PX3A 3KFXA 3DZIA 4GPD1 4K8RB 1TA0A 2QORA 3HWRA 4RH3A 4GWKA 4KR3A 5KNCD 1HT1E 5BSVA 1C3VA 1P2GA 2VHVA 4B6GA 1EPUA 4ZO4A 2QP9X 3FMPB 4JCCA 4ZO8A 1SK8A 2QLLA 4DMGA 3EVZA 4NPAA 1AXGA 2YJ3A 3AGQA 5AKJA 2AXNA 2FZCA 1TPZA 2Q1WA 3TTUA 4XWGA 3AB7A 1U4OA 4JFRA 4ZN6A 5K03A 1QU2A 5KHOC 5H7XA 4DCVA 3OU7A 3RAJA 4BE4A 5KTPA 2FR1A 4AECA 1N77A 2J5KA 1JJAA 1PZFA 5DDIP 1UC9A 2DHQA 2VCEA 2H08A 1P9OA 3RABA 3WLTA 2GEVA 2VWPA 2BEVB 5JNRA 2HRCA 4PPYA 2W58A 3OHMA 4HVLA 1O96A 1EVZA 3IPLA 3LBIA 4O33A 1OY1A 1G3RA 4EVIA 2J0UA 1NR7A 5CB4A 4N6OA 3R7SA 3L4EA 3A36A 1V0JA 3WK6A 4C6TB 1BCRB 3G82C 3H11B 2PIAA 4N5MA 1WNTA 1DDGA 3THXA 2PKXA 5IM4A 5AJHA 1MFZA 2OECA 2VC2B 1E4VA 3TGPA 2PR2A 3REQA 4BGDA 1QCZA 3RDPA 4B7ZA 3QLJA 4DR2B 4YASA 2WSYB 3ITEA