3GLRA

Crystal structure of human sirt3 with acetyl-lysine acecs2 peptide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
274
structure length
274
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent deacetylase sirtuin-3, mitochondrial
publication title Crystal Structures of Human SIRT3 Displaying Substrate-induced Conformational Changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
total genus 91
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3glrA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3glrA01
1PTJC 1UPAA 2EZUA 4RMGA 3U3DA 1HZZC 2HJHA 1PVDA 4BV2A 1POWA 4ZP1A 5K6TA 2OO5C 1OVMA 3LQ1A 4KXQA 1U31A 4JD5A 2PGNA 3CLSD 2H59A 3K35A 3RIGA 2WVHA 1T9AA 1N0HA 4UUAA 4Y6LA 1EFVA 1YC5A 4X3PA 1XLTC 1BFDA 2QQFA 1U28C 2VK1A 3FLMA 1QPBA 4K9NA 2JI8A 4GPEA 4C7BA 1S5PA 1SZDA 3JR3A 4UTXA 5BWLA 4MPRA 4FZ3A 4K9LA 4BN4A 5IMSA 3D81A 4QELA 5EJ8A 3CLRD 4C78A 5FYQA 1D4OA 3GLUA 4GM1A 2VBGA 2EZ8A 4BVGA 3F6EX 3EY9A 3PKJA 1YI0A 1YNOA 1ZPDA 4RMHA 2AG0A 2EZTA 5EJ5A 1ICIA 4L3OA 3JWPA 4BVFA 2Q5JA 4UU8A 4Y6QA 4D5GA 1Y9DA 1PNQA 3IAEA 4IF6A 4V1CA 2UZ1B 4K9MA 4L2IA 3EA4A 4IG9A 4V1CI 2H4HA 1S7GA 2OD2A 4I5IA 4GP9A 4UTRA 3CF4G 4F56A 2JLCA 3PKIA 2PGOA 2Q5OA 1EFPA 2BRUC 4HDAA 1UPCA 4IAOA 3HWWA 4JT9A 2H2GA 4BN5A 1U2DC 1V5GA 1T9BA 2A1TR 2Q5QA 2X7JA 1JSCA 4FEEA 4FVTA 4J16C 2VJYA 4BVHA 4QQ8A 1MCZA 5MFPA 3OE1A 4D5EA 4GM4A 4KPUA 5EJ7A 4MPPA 5EJ6A 4ZZIA 4GM0A 4J1TC 4K9OA 5K2OA 2B4YA 2WVGA 4HD8A 4X3OA 2VBIA 5MF6A 4K9KA 2AG1A 1M2GA 5FEMA 2C31A 5EJAA 1YBHA 1Q14A 2NXWA 3GLTA 2FR8C 4JUCA 2A1UA 3GLRA 4V1CB 1DJLA 1O97D 4RMIA 4UUBA 5BWNA 3GLSA 1T9DA 1YTLA 2UZ1A 3E9YA 3F6BX 5MGNA 2JI9A 5EJMA 4JT8A 1POXA 1M2HA 1OZHA 2EZ4A 1SZCA 3IAFA 4JUBA 1MA3A 2JI6A 2H4JA 2JIBA 1OZGA 5DEIA 4BVBA 4UU7A 4UTVA 4MZXA 2Q27A 4FEGA 5EJ4A 4KGDA 4JU9A 1U2GC 2PANA 5DGDA 2FSVC 4BVEA 5BWOA 3CLTD 4MPJA 1M2JA 2EZ9A 5D7NA 1NM5C 2Q29A 3U31A 1M2NA 4BV3A 4JUAA 1T9CA 2H2HA 1Q6ZA 1UPBA 4G1CA 2DJIA 5DGTA 4RMJA 2VBFA 4TWJA 2IHUA 2Q28A 2WVAA 3CLUD 1PNOA 4JU8A 2JLAA 2OD9A 5AHKA 2FRDC 3RIYA 2NYRA 1Z8NA 2W93A 4RJKA 1Q17A 2H2IA 4JUFA 2FN3A 4K9QA 1PT9A 3ZG6A 5K6RA 4BUZA 2V3WA 1YI1A 3FSJX 3FZNA 4O8ZA 4F4UA 3EYAA 4RJIA 5EJ9A 4JSRA 1E3TA 1PYDA 2Q5LA 1PI3A 2VK4A 4RJJA 4K9PA 5K3SA 1Q1AA 1OZFA 4COKA 3D4BA 1V5FA 3ZGOA 3D7KA 4Q9DA 2VK8A 3ZGVA 4UTZA 4Y6OA 4QPZA 4UTNA 2H2FA 1YHZA 2OORC 2IHVA 4JUDX 1M2KA 2H2DA 2OD7A 2FWNA 4MQ5A 1YC2A 4GG1A 1V5EA 3HWX1 1O96B 1PO7A 2IHTA 1J8FA 5MFZA 4TWIA 1YHYA 2QQGA 3PDHA 4R8MA 2H4FA 2JI7A
chains in the Genus database with same CATH superfamily
1BXRB 2AXEA 5DP1A 1U3UA 5FOSA 1DO2A 4BASA 5TGDA 1UCFA 2K4MA 2J5RA 2CBZA 2OWDA 5BYJA 3U4DA 1AB5A 3C5EA 3RHFA 4D80A 2OFXA 3UMJA 3GT7A 1HGXA 2ZB7A 1P7WA 5AM0A 5FORA 3O84A 4A5SA 2XMSA 1P1IA 1S1MA 2Q5IA 3L04A 2BY4A 4UDOA 2WIJA 3MF4A 5DM0A 2D1TA 1GCAA 1Z33A 2D5IA 3NKLA 3OZVA 4FILA 1EVQA 4QKQA 1HA3A 4EFLA 4GHWA 4L02A 3Q8LA 1M8JA 1R0XA 2GZDA 2QRVB 3EEQA 3QU7A 4TN1A 1SIUA 1GPUA 3SEFA 2YVLA 3TMAA 2EEPA 1MVOA 3JSAA 3KVNA 4RK5A 1NXPA 1V3VA 2D0IA 4H7FA 2NVUB 1E6LA 1RE0A 2D2VA 2FA9A 3FLAA 1B0PA 1C7EA 3O38A 3NHAA 2ZG6A 4S35A 1RTKA 1GCGA 1ORVA 1WP9A 2X6RA 3DTNA 5DYGA 5M29A 3TSZA 2ZATA 4B3TB 1M6EX 3U9LA 1HE5A 1W6RA 3UHFA 2POQX 4H27A 3V4FA 4TL7A 3A2LA 3CTPA 4BO1A 1KQOA 2PGLA 4NZ9A 4DT1A 5FBVB 3DM5A 3SSMA 3K31A 4RIIA 2H11A 1FLVA 4LGMA 5FBQB 2HLPA 4NR0A 2ZRQA 5SZJA 4KPFC 2WWYA 1OGIA 3Q12A 1FXWF 4ZANA 1UKZA 1QP4A 2A8YA 2HT1A 4M36A 5H81A 2YWGA 4MQFA 1GG8A 3IXQA 1ZD1A 5BOSB 1Y7TA 4G1BA 2IE8A 2B1GA 4J1TC 2NAPA 1LDGA 1UJBA 3NH9A 4FGUA 4JA0A 4B40A 1UANA 3HN6A 3V9PA 5ALPA 2VHQA 1V1JA 3RRBA 1PIWA 2NVUA 1S2IA 2RG7A 5EN4A 2ZCUA 4DGQA 1G7CA 2OEPA 4AB1A 3JR7A 1O94A 3WYNA 1XEXB 1YV9A 3L1VA 4LG1A 3HL4A 1R0WA 3BMOA 3ADBA 3DFKA 2BI8A 4GL2A 3F5SA 4KNWA 1O95A 5EZSA 2YIJA 2IVZA 4PHFA 3L6DA 2HSGA 4UAVA 3NQ41 4AKIA 3OJWA 2KX7A 2O23A 1SNYA 2OSVA 2OUKA 2ZQZA 5CDSA 4XR4A 4Q3DA 1WW8A 3UMRA 1ZH6A 3LD9A 4ZTZB 1T8RA 3TFOA 3D7LA 4CL3A 3V8RA 4QX6A 2PANA 3G8AA 1JSLA 2ZVQX 3ZOKA 3WMEA 5EKDA 2O2JA 1JAIA 5L95A 3BB1A 2HMTA 4FUQA 4M87A 1SBYA 1KMHA 2IDMA 3KPYA 3L92A 3OIVA 3PPWA 4YRJA 4KR9A 3S29A 1ZVJA 1XRMA 2J85A 3T7RA 2W9XA 4CT5A 3DDHA 3FI9A 3BWDD 1SXIA 1P4JA 5HF6A 2PD3A 3KRTA 4D45A 3KJHA 3C6ZA 1G5QA 1Z18A 5EXXA 3WG9A 2R48A 2FZ5A 2KE5A 3ZWOA 3K1ZA 4KQEA 1SUAA 4B31A 5HOEA 5KMGB 5LP6B 4LRTB 4WKGA 2IH4A 1U2EA 1Q7CA 5I9TA 3ZWQA 4EGQA 1EFKA 3RH0A 1GLVA 4YMLA 4KR2A 3MOSA 2NPFA 2HHHB 2VTBA 2B34A 1RR6A 4YAKA 1VRCA 1NWHA 1D6JA 1VE9A 2FZEA 3AK4A 3WMGA 2IYNA 3KKKA 2MT9A 1NE7A 4FINA 1JKIA 5ENVA 3NATA 4PZYA 5AJXA 4AW9A 1PG0A 5DYNA 1ZVQA 3PNQA 3AFNA 2NZ2A 4WOJA 4OV6B 4K40A 1TF7A 2HF7A 1R0BA 2PL3A 4OUDB 1C4WA 2XUKA 3SQLA 2YFQA 3B6JA 4WLOA 2ZJAA 2WPNA 1F12A 5JDCC 1AK9A 1PV2A 4MUFA 2G40A 1I13A 1CSEE 1JJIA 3IMGA 2AMJA 4LJSA 4G5QA 1A4XA 1X6VA 3IULA 5DASA 3S8MA 2B4TO 1P4GA 3ELYA 4GS5A 2VTBB 1Y5LA 1AK2A 4BVKA 3NDPA 4M0PA 3ZN2A 4IBOA 2J7PD 3GFPA 4FGSA 3D43A 3CEMA 4H1VA 1ENZA 4LHWA 2WSSD 4BQFA 2ATIA 4G1VA 1O0CA 4URHA 1R9NA 3OMWA 2AG0A 4JOSA 3QLVA 1ZYUA 1IULA 2BTQB 4GX2A 3VTFA 4BQOA 1T13A 2ZIXB 3GFRA 3NKFA 4FFBB 4I0WB 5F4ZA 3IAEA 1RQPA 4IXTA 4HLDA 1ZGBA 1KY5A 3GOQA 2I3GA 1LKZA 2BEWB 5CM8B 4G5GA 1DJQA 1PJAA 1DWOA 3JVDA 1GKYA 3DWEX 1YS7A 4B74A 4ETMA 1PFQA 5HBRA 3AQIA 4JLAA 4DJ5X 5B1IA 2E5LB 2VK2A 3EGIA 2FPGA 2IYTA 5CIQA 5GVSA 5HTOA 2UXDB 1RC0A 2XF2A 1FDVA 3K1YA 3OETA 1RRMA 4LNUB 4M98A 2DQYA 4XPIA 3BXOA 3LFTA 2P8SA 1QANA 4JLBA 3NX4A 4IHQA 5KVQA 4CI9A 3NVKI 4J6EA 1Q0RA 3FYCA 2WAMA 2VIIA 4GNKA 5BXYA 4Y2XA 4RD0A 4KDFA 5K1ZA 2Y67A 5HKOA 1FRQA 2O8EB 4B5KA 1BVYF 3HGQA 5C80A 5AVXA 1P8JA 3K0KA 2OBBA 3F9CA 3ZLBA 1GU7A 2J59A 3I52A 3LVFO 4MVJA 5E0KB 4Y1GA 2QSYA 3DOHA 1JX6A 4ZVQA 3ZW9A 3ZD7A 1SZCA 1YIOA 1NI5A 2GNAA 5TV2A 2XUOA 5EIHA 4KDRA 2A59A 4BFCA 4AY5A 4IS2A 2NM0A 3L7JA 4JI3B 5JEEA 2DPLA 2DBVO 4HH3C 4ENUA 4J03A 3TM4A 5KKNB 5I4BA 1C9YA 1VGVA 2W0MA 4WZBE 1GQSA 1TO2E 1X7WB 2ZJFA 3I2KA 4UDXX 1EJ2A 1Y6GA 4R1UA 2A4KA 1GR0A 1TRHA 2AW5A 2G72A 3D02A 2GAFA 4M3NA 3ESYA 2HRDA 3R0ZA 5JZ9A 3WMFA 1FSPA 1VPVA 5DULA 1NQAO 3EIXA 1YDEA 4LYDA 2VJCA 3ZY3A 4RULA 1HDRA 4WVFA 2UUOA 4UNPA 3G9XA 1E62A 3UUEA 4YALA 3BIXA 2GJAA 1RTTA 5CURA 1U02A 1ZH4A 3FMIA 4OFZA 2SKCA 4OQDA 2FX3A 3VZBA 3HYTA 3RLFA 2JRLA 2XQFA 1U6KA 1W4ZA 2B8JA 5AVQA 1TF5A 1XZQA 3RT9A 4COKA 3F6CA 4UBJA 1E2EA 2P0YA 3GWGA 3OCXA 1QM5A 1IHPA 3G2OA 1R8SA 3ZDZB 2GYVA 1VBKA 1LS6A 2PX3A 1F5SA 3GD7A 4PIPA 4QXMA 4IXMA 1FTGA 5AJVB 2QT9A 3G2PA 3T4UA 4BEJA 3KR0A 5F3WB 1KP3A 1PL0A 1Y37A 3IQIX 2J45A 4FE4A 4GG1A 4ZTBA 1CQXA 1E69A 1GQQA 1JUDA 3CJQA 3H9GA 4DV2B 4QBTA 3OI7A 2AC2A 2QQGA 4NEGA 3UJPA 4QFCA 5HCUA 1DCTA 5K3AA 1NRJB 2XRZA 1JTEA 3F0TA 4YJ2A 3IMKA 5L3QB 3D3QA 5JAZA 3K8YA 5JZVA 3FPSA 3FCXA 2AV6A 2J33A 1P1RA 1L5YA 4RIHA 2V4MA 4D1YA 3NAGA 2QLJA 3ANXA 2NO7A 3O7WA 4Q3CA 5JQGA 1LLFA 4MV3A 1N2EA 1YS9A 1IN7A 1ORRA 2Z30A 1N25A 3QVWA 4J76A 3COZA 2FHPA 4WN9A 2WAXA 5C18A 2OB1A 4YUZA 3T1VA 1A9QA 3QX8A 5AFSA 4ZQCB 3G8CA 4HBZA 3O21A 3VC3A 3V34A 2J30A 1IEXA 1O6ZA 3P9SA 1F2DA 3ZWVA 3ADKA 3QK7A 1FVOA 1DZIA 1NAHA 4YRZA 4ESVA 1E9FA 4RHEA 2E4WA 2UZ1B 2VDRB 4MV1A 3RVRA 5H4GA 2PE5A 1LK5A 1JDZA 4KQKA 1JILA 5KVCA 1ZU5A 1PEKE 4ZT5A 2HL6A 3SKXA 1SB8A 2Q5OA 4P84A 3LRPA 4HDNB 5FL3A 5DGHA 4G0OA 2QBYA 3DEHA 4G8JA 1B6GA 2H1SA 2JZNA 4DN6A 1JSCA 4EG6A 4HNTA 4NCAA 2C5FA 4RNCA 4E1VA 4P3KA 2JFYA 1JPUA 4TQUS 3Q8WA 5DGIA 3B1ZA 5EHGA 2KBEA 1GSIA 3LO8A 4TKVB 3MWDA 3RJTA 1KJ8A 2UKDA 4GEKA 4S3MA 1GGKA 1Z4NA 3ZLTA 4YIHA 2NQTA 4P92A 1EH5A 2WUDA 3N87A 3ER6A 2WT4A 5AVTA 1EFRD 3DXZA 3OEHA 4UEQA 4C0SA 1G21B 1JR2A 1RWMA 1YDGA 3DEFA 3TBHA 4YMGA 3RYCA 3FUTA 5FBRB 3CNHA 3SWWA 3A10A 4XVUA 3T1YB 2MJLA 1ODKA 3OESA 2WWIA 4JEIA 3ZGZA 3PF8A 2C2BA 5DEIA 1GT91 1KGSA 1T0BA 1WG8A 3FXAA 3Q3EA 2EGGA 5BWCA 4MS3A 4BRWA 1P31A 3HUDA 4QREA 3QUQA 1M2JA 5B1HA 2VQEB 2GBLC 3Q40A 1FU4A 2OHHA 3U31A 5HKKD 4WESA 1ISGA 2EDAA 3CZQA 3OU2A 5DH9A 2DJIA 2II6A 3AINA 4ETNA 5LDHA 4DL9A 3NDJA 3D31A 1R8QA 2RGNC 4DMLA 2HI0A 3FFAA 2VWGA 3EMVA 3OFNA 3NVDA 4UEJA 4X41A 2PT6A 3SC3A 3B1KA 1FMCA 1NTOA 1CRLA 5TEWA 1XQYA 2DUUA 3R6DA 5FWAA 1ZCJA 2B1RA 2QDKA 4MW7A 1A98A 1KQ3A 1ZD3A 4A0FA 4KXMA 2C7QA 2ZR9A 3IHKA 2W6JD 2I1QA 2NUTB 3GYGA 3RASA 3AHDA 2XUAA 3D0RA 4FLFA 3UT0A 1D6NA 4N82A 1OH8A 4QBGB 5JD6A 4NWIA 5H68A 5LBTA 4C0HA 1B8VA 2VBCA 4KQIA 4QD3A 4Z86A 2A78A 1X1TA 1C1DB 1OXBB 1OXSC 5IC5A 2GLXA 3K0HA 3C97A 3RHTA 3E2PA 1SRRA 3O74A 3WDLA 1GAEO 4DV3B 3B1XA 3KQTA 5BORA 2G70A 2NPOA 3W8RA 4R84A 3BRQA 1UP6A 4WFIA 4C6TA 2LE0A 1X1QA 3MQ2A 3QUCA 4HJXA 1RYBA 5DE3A 4B9EA 3BHIA 4NENA 5KTYA 5THQA 2OZKA 3KQPA 1QH1A 5CXQA 4NBNA 2P3LA 2Q21A 1ESDA 3NVAA 4QU9A 1TW2A 3E22A 1OJ7A 1KP9A 1MEEA 1U0BB 4KO4S 4RSGA 2JPDA 1S2DA 2C04A 1SBNE 3U4QB 2Z1MA 3IPRA 4W9NC 3SHVA 2X22A 1IY8A 2QLTA 4IEFB 5EHIA 3LCCA 4K6MA 3AJEA 1AZTA 1PZEA 4PV7A 5EA2A 1QP0A 4LC9A 3LK7A 5FPPA 2WU3A 3S4YA 4MWGA 4RPCA 4BEVA 4XVQA 4KFUA 3HU2A 1CLEA 1QGUA 2F9LA 5KWJA 4AICA 3UMSA 1U0NA 1QX4A 4M0EA 3BN3A 3FZQA 3FTCA 5HXAA 4YRCA 5IBQA 1RAAA 2A5LA 3WDKA 3CF2A 2HBRA 1NF2A 4P7JA 5MFZA 4WX2B 2Q2VA 3JQBC 5FD8A 4CU2A 1L0BA 3V8PA 3HEMA 2LVBA 3BSYA 3G13A 2BMJA 1HTWA 1WB6A 4EKNB 4FCWA 4KXWA 3F7TA 2OKCA 1PLJA 1HOTA 5IFKA 4C3ZA 5EXEA 4NPCA 4B17A 5JD4A 2X86A 3UT5A 3BXHA 3G9UA 4C89A 4EENA 5BW8A 2P27A 1WEKA 2CDNA 3F67A 4GYWA 3M9XA 1M1NB 3SM9A 1HDOA 5KTSA 1S3SA 4YVFA 3X2EA 2X77A 3DEKA 1N5IA 1GAXA 4JBXA 5BW6B 3SR0A 2XMDA 4BOYA 4B3MB 1PFVA 3TD9A 1DL5A 1BCRA 1JRLA 2AFIE 2H1FA 2FVXA 3H11A 4DQKA 1NBME 3F6RA 2CXHA 2PXXA 2W8ZA 5COAA 3G0IA 1FLDA 3SICE 1XAIA 2IRWA 1RLJA 3B5EA 2XA9A 1O5IA 3NU1A 1Z4KA 3HZOA 5H59A 2E55A 3VYVA 3H16A 1B74A 5IJAA 1DO8A 2C9MA 4FOSA 1OXMA 1YD7A 4IDGA 4C0LA 4JAVC 2ETVA 1CY7A 3JQ8A 1LBSA 1Z3CA 2PMWB 4TSKA 3U48A 2JGJA 3W5AA 2H4WA 5A7HA 3S2GA 1JDVA 2C2MA 3D64A 3VPGA 3NORA 5U1PA 1RPZA 3A7DA 1EA7A 4O4HA 5EEGA 3TZBA 1BWRA 4CLOB 1OX5A 2N3ZA 5B7NA 3H3JA 1B7GO 4GNRA 4B7CA 1EP1B 4TMYA 4KPGA 2OCBA 4HDQB 2H48A 4KQ2A 5DIZA 1AVTA 2AYYA 3B78A 4KG7A 4X64B 5JAUA 4IO0A 5E7IA 1RJDA 4RLHA 5D3KA 4UDYX 2F1JA 3B1YA 1PT5A 1HDIA 4ML3A 3SNHA 4GXNA 2EFJA 5FEUA 3ZK8A 2WKRA 3A28A 2CFTA 1D9XA 1T91A 2PRKA 4B3BA 3T3DA 2OMKA 4J0DA 1YNSA 2G9QA 5L6LB 4LF8B 3IQXA 5PNTA 1K7FB 2ZAMA 3RC2A 2IFTA 4DCGA 1DLJA 1PUXA 2JH3A 1VL1A 3ZE1B 3ZDFA 1I51A 2UYQA 2YVKA 4L4XA 1TTPB 3TPZA 1QHIA 4M8SA 1MC8A 4OQ4A 5KOYA 3TIXB 3H9UA 3S2IA 3T4PA 3FCUB 4MW2A 1ZXLA 1X80B 4O4HB 1PLKA 1G63A 1GZ6A 1RWKA 2N9UA 1DJNA 5ARBA 4MGZR 5IG2A 1DEAA 1DTSA 3LBYA 2BKAA 4FZ5A 3WGQA 2HIGA 4AFNA 3B82A 4GECA 4CKWA 4CNQA 2J3IA 2PX4A 2QYHA 1DHTA 4TTSA 5EXPA 2K87A 1WLYA 3QY9A 4EUSA 3HBAA 4QDTA 2E37A 1FJXA 3N2YA 4FFRA 2IZ1A 2AG6A 2ZI3A 2CL6X 2VDUE 1DELA 3I01M 3WKBA 3THSA 4DBLE 1AUOA 1BS2A 2L2QA 3ELBA 1GUZA 1O95C 3KWJA 1OSNA 2KB0A 2CMDA 4HN9A 4HWGA 3CWZA 4FYWA 2MTBA 3UFXA 4LHZA 1ZPDA 2QS9A 2XWBF 3FWKA 1K6EA 1BXGA 1YT5A 2QT1A 1KXJA 3K92A 3QYAA 5HDQA 3RRJA 3MFYA 4MYTA 2O52A 2WT9A 3JXEA 2CLEB 1Y9DA 2B78A 4JBYA 4ZVLA 3ZHZA 2GN9A 4PQFA 3V9AA 4OO3A 3E6AA 3LCRA 3UJ3X 1DC7A 4FB4A 5FDFA 2QP3A 3O8OB 4MKFA 3L49A 2HIAA 4Z1OA 5FV4A 1RZRA 4OX9Y 4HDAA 1L4NA 3HL0A 4HAIA 2O9JA 4KFCA 3GJZA 2B5OA 2GPAA 4WACA 1RWXA 1TM4E 3EH2A 2RHTA 3IEKA 3M5WA 4IIJF 4IFEA 1NHGA 4JH0A 5AQ1A 1E99A 4HNAB 1QE3A 4FOOA 1DXOA 3FPLA 1XB2A 4KL8S 4O1MA 4XQ0A 5C5CA 3V2IA 4M54A 1E64A 1U9ZA 1YKFA 2ZE8A 2Q6VA 2YUTA 1A95A 1YOVB 4AZTA 4BCCA 1YAJA 1DKMA 4HXEB 1MJHA 3H2IA 4AX8A 1NVXQ 2ZVDA 3AMVA 4U0JA 2V6JA 1CXZA 2HMWA 2GZMA 2I66A 3F4LA 4FMPA 4PFQA 4YJ2F 2NXWA 4KR0A 2BTEA 4TL6A 5B3JC 4ZAWA 1NR5A 3B7PA 5AM1A 4WZBB 4NG4A 1I3LA 3BRWD 1U3TA 3ND5A 5I47A 3RC8A 4GKKB 4IDCA 5E1DA 4TUYB 2DPXA 2WG2A 2Y76A 3DMNA 4Q3NA 4KXXA 3WAJA 3LW7A 2A9PA 5EJ4A 2CK3D 1SXPA 3LPAA 5BN1A 4LYAA 4DYHA 1JEJA 4LFCB 1U5AA 4I9FA 5F21A 2WSBA 4EHAA 1ST3A 3G2KA 1C9MA 1FQJA 1L1QA 3WLAA 4DG8A 1MB0A 1VB3A 4MB2A 3F5DA 4OAOA 4RVOA 1E9RA 4ONEA 2XVZA 4WJZA 2EAUA 3JAWA 1CDOA 3OOSA 4E5KA 1AO0A 2G9ZA 2QL6A 1RS0A 2XW6A 3MTAA 1L1EA 1M6VA 1SCUA 3GJYA 1B8NA 4NBUA 1GM5A 3AEXA 1GTVA 3B7GA 4D74A 2V3CC 2UYYA 5AR1A 4C5AA 4RXUA 5HF9A 2G1KA 5HKLA 4DZRA 2O3UA 4US0R 5AJZA 3VH4A 3S28A 4ATNA 2IYXA 2NZVG 3P2OA 4LY3A 2PUVA 1N3BA 1L3BA 3CMCO 4RJJA 3RVJA 5H8WA 2EEZA 2MR5A 3A58B 3STWA 1H2XA 3A1VA 1EQ2A 1Y6ZA 1AHNA 3U17A 2V0CA 3QPAA 4GGOA 5AI0A 3UW1A 1Z6GA 1I7QB 1Q1EA 3TSAA 1W5SA 3AEUA 1K6XA 1QYVA 2EFCB 1SHTX 1W35A 4WHMA 4WESB 2ZT7A 5ERGB 3F7NA 1W88A 1UQTA 3G59A 2REOA 2QB5A 4CKZA 3JQBA 3FTQA 5LXTA 4XDZA 1RWWA 4CYMA 1N2SA 3FVQA 1JWAB 1KYYA 2D1SA 3NONA 3QV1A 4KCGA 4LSZA 3WYCA 4XB1A 1HLGA 2VYND 3T06B 2MYUA 1D2RA 3GLHA 3DEYX 3C6MA 3FKJA 3IP8A 3REFA 3Q7PA 1W9MA 4KRYA 2XQVA 1LI7A 3DE7X 4LDNA 5EWJB 3USCS 4IJVA 2F3UA 3BULA 4JVOA 4N5IX 3DXFA 4TT3D 5CK4A 3TECE 3R7WA 4X8OA 1E9SA 5JAMA 1X8KA 3E9RA 5CYPA 1J0CA 2IQ5A 3P96A 1V16A 2B94A 1GFZA 2ZBRA 1U8XX 4I50F 1GQRA 2TECE 3JQGB 3U56A 4XB2A 2IXFA 4XLZA 3IELA 2QR2A 4J0CA 2WF5A 3QPBA 5JISA 3KC2A 1AV7A 2JZCA 4PZZA 2CWWA 1MX3A 2JIPA 1NMQA 4O4IA 4Y6QA 1VJ0A 2GEFA 1GTMA 1UFKA 2AMFA 2OAGA 4MO2A 5KYYB 3LTEA 2C4HA 4LMPA 4QG7A 4IF6A 5CVVA 5C35A 4D0GA 1WETA 4RX1A 1MJGM 1PKXA 3LI2A 3MAGA 1V1MA 3NM4A 3DDZX 4NMWA 1W94A 1U3FA 3U9SA 1T8UA 4ZEOA 4CDNA 2QJWA 1KOLA 3P19A 2JLCA 2C0CA 3AXTA 3JWHA 3U61B 3P9IA 1RJGA 4GP7A 3QVUA 2G0NA 1K4MA 1XALA 1JYEA 1V47A 2W6JA 3DKPA 3I5AA 5FOVA 5C4GB 3NUQA 3X1JA 3W1WA 4EPVA 4RL6A 5I7WA 1CR1A 1LLCA 3GLIB 4AS1A 4FEYA 3ZU6A 1Z08A 1SFRA 1TGVA 1JEQA 2QRZA 1JG7A 3SXPA 4GBJA 2O6HA 4X3OA 1V8ZA 2QQ0A 4R69A 3C4QA 3N8HA 4G4SP 2YR0A 5AKEA 3V6LA 1R0KA 1QR2A 2C4UA 2EQ5A 4U2BA 1KIFA 3LP8A 4QLBA 4A27A 2AEEA 5T4BA 4CHTA 4D6XA 5CK5A 1QTQA 1QNLA 5CA1A 3LUPA 3O3OB 3K9GA 3OLCX 4UHDA 2AG8A 3PGA1 4D2IA 2H92A 1N7HA 3GJSA 2EWVA 1CLUA 3QKRB 4XJTA 1GAQA 2AR9A 1KI9A 3WRYA 2FSVC 4DIOA 3P2EA 1KY3A 1L5MA 3QRWA 4UUMA 5TQ0B 1GZ3A 5CDHA 3ACBA 3M1IA 4IQFA 3GLIA 1MBZA 4TTVA 2NMVA 3T1TA 5J59A 4IFBA 5KNCA 1AUVA 4CLXA 2QGZA 1GIAA 4ROSA 4BGVA 5D00A 4YUXA 1RYNA 3BBPA 4CQMD 5A5FA 1Z62A 2GYWA 4EGJA 2R2AA 2FDRA 3FUWA 3IOBA 4WBNA 2PZGA 1YAHA 3CE9A 1OBVA 1XTQA 3TZEA 2ACVA 2X8WA 4OQQA 4FE7A 4S0ZA 2DFDA 2RCNA 2B30A 2VJDA 3OWHA 1EGAA 1VLZA 1RC1A 3QVTA 2EBFX 3FCEA 1YRWA 5LDDC 1Z34A 2C0QA 1UBRS 3KHUA 1TQ8A 3L5OA 4ALMA 4KBYA 4AULA 1YB7A 5B7PA 1J0XO 3ADDA 2CK3A 1PHRA 3DWGA 3STYA 4F6RB 1XPRA 3DT8A 2CB9A 5TVGA 1ZCAA 2XT9A 1VGRA 1DIOB 2DECA 4RTJA 3HBNA 3K70C 1S2LA 4ZVVA 3W5IA 1XA0A 3OECA 4BXOA 3WJAA 2CVHA 2V9ZA 1KU6A 3EXFB 2P6OA 2PLFA 1S1CA 2ID7A 2BBSA 1T9AA 2VDMB 4PHGA 4TM8A 1HDCA 4J0EA 1V7CA 1SC9A 4TLBA 1MRZA 5C32A 3CEPB 2A9KA 1I80A 3OAAA 3IXLA 1LW6E 2QRJA 4FJ1A 4Q4JA 4DFDA 3WRWA 2EVWX 2VZ0A 2C59A 3GY0A 4EMSA 1I2ZA 3DB1A 2PT7A 5EPEA 1II8B 3IDFA 1CW2B 1XUOA 2X58A 5JNWA 3NHZA 1KK0A 2H9YA 2EZ8A 2B3TA 3SHOA 4BMNA 5I7EA 3UG7A 1FTQA 2WD7A 2XAAA 1UXOA 3UY4A 1ZH8A 3JQFC 4OKNA 2HA0A 5JCJD 5BYAA 2DHRA 1P1JA 3C1AA 2QJRA 1FVFA 2ZR7A 4YV2A 4G4SO 3TD2A 1E3JA 4X65B 1BWSA 2AN5A 1NP6A 3WB1A 3WGJA 1FY2A 2QVYX 4LF7B 3ANSA 4K2AA 3RBAA 5DHFA 4PBTA 3CZMA 3KZOA 1HFWA 2JAHA 3P9ZA 2F62A 3E0XA 3UMMA 2N1BA 2O2EA 1OILA 5CNKA 2MSDB 3KSMA 5F78A 4LJYA 5CUQA 3FGNA 1UKCA 3GLQA 2NQ2C 1LK7A 3A8TA 1OWPA 4TMTA 4WT7A 1MABA 1E1CB 4ISBA 3RUHA 3V3TA 1P0IA 3TUJC 4ZMSA 3ASYA 4K2HA 2Y1DA 1GFIA 4CW7A 5IAKA 2E1RA 2HPHA 2Z2XA 1UZNA 2Q6LA 5K0SA 5U9CA 1USWA 3GHHA 3K8QA 2E7ZA 4NHEA 1P7YA 1UBSB 1YBHA 3DHNA 3HVKA 3LXUX 2ZGVA 4UTPA 3D6HA 4N4AA 4E94A 4JXXA 4M8IA 1S2MA 4X45A 5AVJA 1V7PC 5E1MA 2WYUA 2ZSEA 1GGHA 5GV8A 3UEOA 3JYHA 4PVCA 2VT3A 4XEUA 5DO9A 1RC8A 1SXGA 3A9SA 3VPHA 3MLBA 4BO9A 3SQOA 1HQKA 3FSGA 3NZEA 4KLCA 3PE3A 3REOA 3MT8A 2WILA 4EJSB 1Q2UA 3DA8A 3EAQA 4HNAA 4N6NA 3ER8A 2JBWA 1LCIA 1VCHA 4WFJA 3QTBA 5FL7A 1UPBA 2BFCB 1CUDA 2PAAA 4GXRA 4J7XA 4ZYWA 1XL1A 2DUJA 3E7PA 4KZPA 4EOGA 4ZGWA 4CLOA 3U7QA 1K0UA 4R40A 5TMDA 5EXSA 2ZSUA 1FYXA 3WS7A 3AO0B 4K9QA 5D6NA 4AJKA 3LLUA 3T95A 3HU1A 2FTKE 4PX5A 1RWVA 2UZAA 4B6SA 3Q10A 3FJOA 4DNQA 1QIDA 3N8DA 3I9MA 4R4JA 3DYVA 1F3LA 1E6WA 3D4BA 2H2AA 3OZSA 4QBFA 4QEDA 4G2NA 4KVGA 1GN9A 3F2IA 4AAYA 1K8RA 4FFNA 4MV0A 5IT5A 5J23A 5TEVA 4CT0A 4G85A 3UWPA 1GPDG 2HHJA 4BVLA 2FX5A 2PCLA 4MQEA 5C8ZA 3TQSA 5JAQA 4IJMA 1KMHB 4CLHA 4KTTE 3ZNNA 1HM5A 1U5CA 3JAWB 1OI7A 4MV5A 2H4FA 3SLGA 1UPAA 1BGWA 3B9RA 1AA6A 4R98A 4RMGA 4AN0A 1HZZC 2XCUA 3N5CA 1FSSA 4PO3X 3S6JA 1OAAA 4BMSA 2ZCVA 3R0JA 3OCUA 2I3BA 4JJ8A 3NANA 2KW5A 4EY7A 4P36A 1BMDA 2P6RA 1HI9A 1MEOA 5HK9A 3FYUA 4L74A 4Q3KA 4X5OA 4JI7B 4GOLD 4QQNA 4C7BA 4BBZA 2I2CA 4MPRA 2IODA 4KUHA 5FA5A 5JY6A 1T5HX 1EBBA 1OBCA 1Y9JA 3CZ5A 2E89A 3MJSA 4RV4A 5IMSA 3MEQA 3HDGA 3W9YA 2K2WA 4X20B 4EFNA 1CHNA 1XCPA 2VBGA 2HSJA 3G89A 4O2AF 2A3RA 3PD1A 1FFAA 2BDUA 2A7QA 5FA8A 2E4YA 2JLUA 1XLTA 3I8XA 3PLNA 3C16C 2XKKA 2QW0X 3DWFA 3Q0IA 5HZHA 5EP4A 1DWPA 1QYIA 4Q0MA 3RE1A 4AMUA 3I04A 3I2IA 2JIZD 1QORA 1ECGA 1XTZA 2CC2A 2UDPA 4M22A 4W5WA 2ADMA 3OLXA 1WM1A 4GP6A 2C5EA 1OTYA 2ECPA 3F9IA 2PZKA 3OPVA 2C58A 3MGKA 5TDHA 1VLQA 3LECA 1JR6A 1KDPA 3F3YA 4LWQA 3K0CC 2CNOA 1NT2A 1MV5A 4N5DA 3H2ZA 1M66A 4I14A 4V0SA 5YASA 4IIGA 3I9NA 1NBEA 4CDGA 1G7RA 4DB2A 1RXSA 2JFPA 2FWBA 3EFOA 3AY3A 2ZB8A 3FPJA 4X6YA 3B1WA 2GCEA 2YBEA 3I76A 3IJRA 3LY5A 3H5IA 3Q3GE 5EIBD 1D2NA 1YZ3A 3GCWA 4KI0A 3SX0A 1AS2A 3VH3A 4D9GA 1OZHA 1Z25A 3OT1B 1WSWA 1LPOA 4RW0A 4N39A 2IEZA 3W0LB 1UDWA 2E3JA 3MWLA 5G3ZA 5IJ9B 2XA1A 3A32A 3N2LA 2LWIA 3TQFA 3EUEA 3TGWA 1CUJA 3EG9B 3BG5A 4IX1A 4XYEA 3DW1X 3SJUA 1OMOA 2CVPA 3IR7A 1NVKA 4DJTA 3GT0A 4G41A 3IEMA 2G3YA 4W6ZA 4C21A 2IBMA 1WDWB 1UC8A 1A7UA 1KOFA 3QE0A 4PO1A 2P0AA 3HCAA 3AR2A 4NOJA 3AFGA 4D9NA 5AI8A 3QVXA 1DS6A 4DLBA 2IS6A 1JQBA 1QX3A 3NTOA 3O8NA 4HQOA 3RG8A 4QOSA 3UZUA 4L76A 2I1WA 4DF3A 4RD2A 5BPHA 1ZHFA 3GROA 3A1FA 3DR3A 2FZGA 5A71A 3SYLA 3R0QA 2JHAA 4NJOA 4OUKX 3N8GA 3KVVA 1PS0A 3OIUA 3TW8A 1T5IA 4D8YA 1SQGA 3TLXA 4B3HA 3LL4A 3GO4A 3TMKA 2PYIA 3TMYA 4XFDA 2H2FA 3VZSA 5DLPA 2DH5A 1YS1X 3NOOA 5ALNA 1LF0A 1UODA 2FN7A 3HXPA 4KDCA 5LR6A 1I1QB 3MG9A 2P11A 4L4RA 5A4KA 2EHJA 3AKZA 5HZGA 4WMLA 2ASEA 3AT1A 3H1PA 2MIIA 1W9HA 1PX2A 2Q7OE 3NWOA 3TEJA 2H8GA 2XA2A 1UAGA 5KX5F 2BFBB 1P77A 4Y9SA 3K32A 2G6BA 4BNMA 3M4XA 3PXDA 3FWPA 1NQXA 5JPIA 5KSWB 1P39A 3I4CA 5DMXA 3VJLA 2IZ7A 2QUAA 1Z7WA 2G63A 2P6MA 1A1VA 4H1HA 3TEMA 1J09A 4NFHA 3UKJA 3R6WA 1R4MA 1SHJA 5K4HA 2QBYB 1VI5A 3ANLA 1N9ZA 1UZUA 3BMCB 3PX2A 1KTVA 1R15A 1VJGA 3V42A 4U9HS 1P44A 5LQAA 4EPWA 1L7RA 3Q2OA 3EW7A 1R6VA 4PAWA 5F7JA 2ZVPX 4IIHA 4Q21A 1FSZA 4IS3A 3VX4A 4XR9A 3ZWDA 1LV7A 2FRVA 1QLWA 2EZTA 3GPLA 1IJBA 1YKSA 3NDRA 4ZVTA 4JOBA 3RVLA 2GEDA 1NW7A 5KNDD 1T5LA 1KORA 2IYOA 4F2GA 4R7TA 2A0WA 1MORA 4D57A 1EKXA 4QBHA 2P2LA 3VPDA 2HO5A 1TM7E 2WV9A 1E6MA 3V4ZA 3BQ9A 3PUIA 3M1AA 2VRWA 2ACWA 1PQWA 1JDUA 3NEAA 4BO7A 1GILA 2VJBA 1XZLA 2GF2A 1YVUA 2C3YA 2X4LA 5JSYA 3NYIA 4YWHA 3LE8A 3DUFB 4UAGA 4RKRA 2B0CA 4KYTA 4OYRA 5EJ6A 4K9OA 2X7XA 4CM8B 1F2TB 1D4ZA 2CL5A 3FBTA 3CG0A 2Z5FA 1FP2A 2NXNA 2OCKA 3EIOA 4L3VA 4LYFA 4Q24A 4QEKA 5DTQA 3PLAE 1J06A 1HK7A 2Y0CA 4HX9A 3U60B 3ZE9A 1FXUA 2GVNA 1J33A 3GH1A 4FYJA 4KAJA 4J3NA 2CVZA 2NP6A 4DLAA 3CLKA 1E6UA 3O2QB 4YV7A 2G5CA 3I12A 5EPUA 5AW3A 1CQWA 4YJ3F 2BMVA 3BL6A 3N2GA 3P4XA 3VU1A 2CXOA 4EHIA 5KWSA 5M5BA 1PJTA 4RQUA 2F1KA 1YRQA 3SZMA 1EUZA 4P34A 2JLZA 3NKVA 3ETGA 4TPKA 2FUEA 2H7VA 2I55A 1ISPA 3D5TA 1PW7A 2ZSKA 1HZZA 1BDHA 3HDJA 2P2GA 1PD1A 3PQ2A 4MAMA 3T0IA 1NM5C 1SQSA 2QSJA 4BNLA 2W22A 2C8VA 4QYIB 4RESA 4NZZA 5CU7A 3PQCA 5AK4A 1KIAA 4ZDIA 5E6SA 3B53X 1ZWLA 4U3JB 2OD9A 4BNTA 1SEVA 2FPLA 1B93A 3Q9UA 1QZXA 4FS3A 4PG8A 3I09A 5K6RA 4G8BA 2D2XA 5CFNA 2J31A 4GPIB 3KLBA 1X7XB 2VP9A 4B3JA 4CKBB 4O8ZA 3OPYI 3ND6A 4P3PA 1OYWA 3P9XA 3TD6A 4WI1A 1JE0A 1PGNA 1DRWA 2V7PA 2VPZA 1KPIA 2ID4A 2FPUA 4AKGA 4RY0A 5A7FA 4UTNA 4WNAB 4DCPA 4NCIA 1RJFA 2R68A 5DHUA 5I9SA 2HRBA 4GMGA 3LX8A 2P8JA 3MWFA 4PX3A 3KFXA 3DZIA 4GPD1 4K8RB 1TA0A 2QORA 3HWRA 4RH3A 4GWKA 4KR3A 5KNCD 1HT1E 5BSVA 1C3VA 1P2GA 2VHVA 4B6GA 1EPUA 4ZO4A 2QP9X 3FMPB 4JCCA 4ZO8A 1SK8A 2QLLA 4DMGA 3EVZA 4NPAA 1AXGA 2YJ3A 3AGQA 5AKJA 2AXNA 2FZCA 1TPZA 2Q1WA 3TTUA 4XWGA 3AB7A 1U4OA 4JFRA 4ZN6A 5K03A 1QU2A 5KHOC 5H7XA 4DCVA 3OU7A 3RAJA 4BE4A 5KTPA 2FR1A 4AECA 1N77A 2J5KA 1JJAA 1PZFA 5DDIP 1UC9A 2DHQA 2VCEA 2H08A 1P9OA 3RABA 3WLTA 2GEVA 2VWPA 2BEVB 5JNRA 2HRCA 4PPYA 2W58A 3OHMA 4HVLA 1O96A 1EVZA 3IPLA 3LBIA 4O33A 1OY1A 1G3RA 4EVIA 2J0UA 1NR7A 5CB4A 4N6OA 3R7SA 3L4EA 3A36A 1V0JA 3WK6A 4C6TB 1BCRB 3G82C 3H11B 2PIAA 4N5MA 1WNTA 1DDGA 3THXA 2PKXA 5IM4A 5AJHA 1MFZA 2OECA 2VC2B 1E4VA 3TGPA 2PR2A 3REQA 4BGDA 1QCZA 3RDPA 4B7ZA 3QLJA 4DR2B 4YASA 2WSYB 3ITEA 4IIEA 4MLCA 2GN0A 1TUGA 2FH5B 3CF6R 3RM3A 4B3XA 3KFLA 1A77A 1L4LA 2DBRA 3LWNA 3D4LA 4FDTA 1QC5B 1XZIA 3EQ7A 4L07A 4BRSA 1ZN2A 4HDKA 5IVKA 4JJ6A 4G5SA 2Q50A 1TKAA 5DV9A 1LI5A 4Z3DA 3IT3A 5KVSA 3I05A 4HQ0A 1E2LA 1T9GR 1EM8A 1O2DA 2WJZB 3SF8A 3F4KA 2AOVA 1M2OB 3BCHA 3JZDA 3G68A 3LQYA 3DZFA 5J5AA 3ZVMA 1M2GA 4UM7A 3SP1A 2C7OA 4ZFNA 4ZYXA 3C6YA 4V0MA 3Q3IA 2BZSA 1XQVA 5KSYA 3NBXX 3E81A 2WUFA 3M6VA 1X8LA 1OFUX 3SDBA 5IYZB 5DN9A 3KEOA 1K5DA 5FNZA 2H1HA 2PD6A 2JLQA 4QASA 4KRXA 4D42A 1F1BA 1HNXB 2Y0EA 4ZOAA 1JA0A 2CXUA 5ILGA 5JSZA 2ZYHA 3CKYA 5KNDA 2QJFA 1E9AA 1EXMA 1P2SA 3JALA 1RKVA 2JJQA 1SOAA 2D06A 2SICE 3CEJA 3KKZA 3GRYA 2H6EA 3C85A 1FZTA 4BWGA 1IY2A 2C5HA 2VSXA 3KQLA 1EM8B 4DARA 1TYAE 1U9CA 2IHUA 2RHDA 5CDUA 3DE3X 2P79A 4X95A 4BQEA 4YREA 3D8SA 4NBLA 1P2VA 4CQLA 1KEPA 1PQ4A 1NF9A 1OA0A 3PHIA 4KLNA 3EF0A 4HEA6 1HORA 1NZJA 3FYSA 2F4NA 1VHLA 4ZRMA 4LE1A 3OT1A 3G9ZA 1FDWA 4AJIA 4CKWB 2ZJ8A 5EQJB 2ABWA 2R1ZA 4JJZA 3QNUA 1J8VA 4X85A 3VR6A 1CC1S 5KQGA 4Q3BA 3DOJA 1IVSA 4PO8A 4KDEA 4EYQA 2WU8A 4MQ6A 4PR0A 1ILEA 1LD3A 2QK4A 2Z5VA 1Z38A 3PWKA 4UZFA 3UATA 2IF2A 2V98A 2ZZMA 4U63A 3R40A 4FQ5A 4LOHA 4O02B 4C3UA 1PV1A 4G9GA 2XB2A 1LTQA 1B1CA 5EERA 5B6IA 4Y2RA 3U1TA 3HV0A 4CQLB 2OBYA 2BP7A 2ZJ1A 4W6QA 1PVDA 2CZGA 4PS0A 5ECGC 4G5XA 4C4OA 5ISMA 3GLFB 1X39A 4JVSB 1IG0A 1E3QA 2DUMA 1PCXA 2X9LA 4HDMB 2R8PA 2YQ4A 3LYHA 5IVDA 4EGFA 3O4GA 4PW0A 1U6JA 1AKUA 5JMPA 1M2WA 3LOQA 2R2GA 1TAQA 1HX7A 3DV2A 3A6KA 1XDWA 1LVHA 4MSUA 1WPXA 4UCXA 3O8BA 5ILOA 4UHFA 4G0YA 3ZOZA 2C88A 3TJMA 1F2UA 1YDFA 1U7HA 4JXJA 1JZSA 1PP4A 5LXTF 1YOVA 5FTJA 2ZBDA 3A06A 4REOA 5JSFA 3HXLA 2P4QA 1I5RA 1N5LA 4JNCA 3ECSA 3VPSA 3IOCA 1O0SA 3ZWXA 2AUMA 3OPYB 4HNVA 1U98A 1WSDA 1IRXA 2NZWA 2G0TA 4MKZA 1P7VA 5C3MA 4EJ2A 3IPXA 1RQLA 2XTNA 1QFXA 2VDQB 4Z4CA 3QPWA 2ZT8A 3BTOA 2XWQA 1QGZA 2XTJA 3A9RA 3IEXA 4RGVA 4UVEA 3E23A 4I4CA 1Z0JA 1TCCA 2V59A 3MMSA 1DLIA 3GGDA 1D03A 3KVOA 3U80A 1H3NA 5ALUA 1Z29A 4QPCA 4Z3KA 1X94A 5G2OA 2OKGA 1ECJA 3LHFA 1D09A 2C2WA 4P8RA 4ASUA 1SC4A 3QXSA 4C0JA 4E46A 4I55F 3DLCA 3IEVA 2C2OA 4RKFA 1B16A 3R7NA 4QG3A 5D1HA 4DPMA 1NQ5A 1Q77A 2P7IA 3JWIA 4MJ3A 3RBVA 4F11A 1E5LA 4WBNF 3NMUF 3AR6A 4JI6B 3A9UA 1GZVA 1M2HA 3A4LA 4C6RA 3LCUA 3EZGA 1W44A 2QTBA 3W5HA 5DNUA 4TYMA 2FZVA 3QOWA 5HGXA 1QS0B 2Z8YA 3GEMA 1HURA 4F45A 1X2BA 1X13A 1PEDA 3HNRA 3OUTA 5JTUA 1IXYA 2FEKA 2I4IA 2RHLA 2FWPA 1J2TA 4FI3C 3PE4A 3SD7A 1BGVA 2ZE7A 3U0VA 1UJ5A 3VR3A 2AVDA 2ZIFA 4G26A 4BFZA 4GPZA 5BW5A 1E1RA 2PHZA 1ICEA 2CMGA 1COWD 1M2FA 2XPCA 4DSAA 2IH5A 4ANFA 1RPNA 4KQWA 4TWJA 1UMDA 4KIJA 5ADHA 2Q0QA 1K5GA 4JU8A 3QKWA 2CYBA 2YTZA 5ALGA 3IDQA 3PVZA 4L51A 1QPZA 4AX4A 4MRMB 3AL3A 5G1NA 5H4HA 2AGVA 2X8AA 5DI3B 1JFSA 3FH0A 4N1AA 4FOLA 4QXRA 4JZYA 4TLAA 3PNMA 4HXFB 2GERA 4KVAA 1OZFA 3RWOA 4DMHA 1NY5A 5IDQA 2OHFA 4ALLA 1EBFA 2WR8A 3E2MA 5BSWA 1KGDA 4WZZA 1C3JA 2XXJA 5TPZD 3WV5A 4YRGA 3UV3A 8GPBA 1J5EB 1D1SA 5DHQA 1KZ6A 1MV8A 3DT9A 4ND8A 3C3JA 1YB6A 3OHPA 2G8NA 2Q9CA 4NCNA 8LDHA 5JAPA 3E70C 1CEQA 3QTTA 1SUCA 1X1AA 2DTXA 2IKSA 2TSYB 3AEKB 3A6DA 3MCZA 4J7CA 2XQKA 4I5GA 1JVNA 1JHMA 1JT2A 1OKKA 3CNOA 3F3MA 4U3JA 5KYYA 1Z16A 2RBKA 4KMOA 2QM8A 1OVMA 4M55A 2PGNA 1HYGA 4PZCA 2BKVA 3LPCA 3BMNA 2YN4A 2KLHA 4R2MA 1ZVVA 4ZVSA 3KQSA 1LC0A 2O5CA 1KI6A 1O77A 2IITA 3B9PA 1ONSA 4IM7A 1TTHA 4GPEA 2WABA 4ADSG 5JNUA 3CA8A 4IJQA 5JJLA 2AJ8A 3HUUA 3QPVA 1XG5A 3H4TA 2IU0A 3DWIA 4ZQEA 5AWFC 2FWIA 4BV8A 5CIYA 1BFKA 3CVOA 3OZCA 4QELA 1Q16A 2ZQYA 1ZOLA 2CLCX 2YX1A 2BF4A 4F5ZA 3A0UA 1AA9A 2ZAIA 3C0KA 3MJEA 1QGDA 1TCBA 2P5TB 1EUQA 2HK9A 3MCUA 1H6CA 5J2UA 3AEKA 4LVNA 4R2IA 8ABPA 2YN2A 3OM9A 1W2WB 3OTIA 4D56A 3GFBA 2R5NA 1R9MA 3SF0A 5M04A 3ISVA 2I6SA 4TT8A 1XVVA 4UREA 5C1IA 5BV2P 4YAUA 1X19A 4F56A 2PO5A 3IT1A 1CFZA 3VYSB 2YJ6A 5IJZA 2PNFA 3PIDA 1FDUA 3ZHUA 3I83A 3T3MB 3DV9A 4CMHA 1NDHA 1O6GA 1EUDB 3IE1A 4GM4A 3BGSA 1Z7BA 1UJCA 3BMXA 1Q0QA 1V8DA 3CRQA 4MPPA 5T6BA 3RYTC 2BGLA 5CYFA 2XUZA 3DT6A 2HA3A 3ELUA 3MUFA 4TXNA 1MOPA 2ONZA 1FFEA 5KJCA 1N7IA 1DPFA 3A1CA 4F72A 4FGLA 1YULA 3K2BA 4MINA 2O14A 1O97D 2B21A 4FPXA 4MUAA 1K86A 4COOA 2IDJA 1E3MA 2C2XA 5D86A 4BEWA 3RRZA 2P9YA 5AI9A 3NGMA 5EKXA 4FZJA 5EZYF 4HVCA 3GUCA 2XD9A 2HJRA 4UBNA 1GTL1 1OHHD 1MPXA 1Z4OA 5FFMA 4AF8A 4PZPA 4C4SA 4S1NA 3MK31 1ONBA 1Z6TA 1QC5A 4L78A 1MT0A 2FMFA 3O8QB 5K0EA 2I8LA 3M6XA 1Q0LA 3TNDA 2IXTA 3BBLA 3HXTA 3PX3A 4XUCA 2BGGA 2C9BA 3RS9A 3WBFA 1Q6ZA 1KFEB 1ZD4A 3MINA 5DGTA 1E2GA 5AOVA 2A30A 4BEBA 3AR8A 4MKGA 5DXJA 4C4AA 1JA9A 1RFGE 1XE3A 3BH6A 1IQ0A 3FNEA 1CK4A 2VLBA 5DFAA 5EI5A 1R4ZA 2CFCA 1NX6A 4EF6A 2W93A 1ORTA 3GNSA 1DCKA 3PFNA 2H2IA 1P1CA 2X19A 2FQQA 1JF8A 5D01A 5DN6A 4AYWA 5A6SA 4PVDA 5TF0A 4BKRA 5JDIC 1N2IA 2DKOA 3H9JA 3VR5H 2O3TA 3RD5A 4MR9A 4EZIA 3GNQA 3FMOB 1P1BA 1JU3A 1QKJA 4P32A 1VCNA 1A5AB 4KP7A 5LOVF 2Q6IA 3HRIA 5BN3A 3ORRA 4Q5IA 5BR8B 2XQGA 5BUZA 3UV6A 4L6IA 1XTBA 1JDNA 3KWLA 2PT5A 2HMYB 2VSYA 3ZIAA 3JQRA 5GVRA 2QN9A 1K6JA 4ND1A 1EE1A 1W59A 4Z4QA 4QXOA 2O57A 1EXDA 3QQ5A 3OA0A 3DVAB 2I2BA 4XUDA 4EHLA 1GNQA 2A88A 3C3WA 3ETNA 1OXKB 2H7CA 1T4BA 3EOZA 1RYFA 1OC4A 1YF3A 1CRPA 2MINB 3NJ8A 1B76A 3A0RB 4QYTA 3RVDA 5AM2A 5K3OA 4OJMX 1OYVA 1L5RA 2GXUA 4MR9B 3O5AA 1EFVA 1RKXA 4LRUA 3EYWA 1WO8A 3LBFA 4NZYA 3JWGA 1PW5A 4RKEA 2Q3MA 1MNAA 2ZRPA 4QLOA 1XXHE 4FIZA 1JDBC 1MAAA 1DG3A 3FDJA 4F3RA 3H0EA 4LXYA 5E0OA 2ZRBA 3MMXA 2LTAA 4U7TB 2R6AA 1O87A 2JKZA 2YQ5A 3BE6A 1ESEA 3WHIA 3AF0A 6CHYA 4Y6GB 3K6SA 5HM6A 4BGEA 2YDXA 3U6KA 4G0WA 2E9SA 1MC1A 1V25A 2ZRDA 2RHCA 1LBHA 1KBOA 2WWRA 3G2QA 2W43A 4IWNA 1PUIA 3OC6A 2W2LD 4UU1A 5I7VA 1H8HA 2AOUA 3HCOA 4Q19A 3ESBA 4YJKA 3A1DA 2IV2X 3WRYC 4AZSA 3OQBA 1DT3A 2GO7A 1ZIXA 2C84A 5AVOA 3ZWNA 5MHTA 2CJWA 3AM1A 5ESRA 1CS0A 3WGOA 5B3LA 4AY3A 2R8YA 5DX1A 3Q15C 2JIQA 3WLLA 5JBIA 3T1HB 3ADPA 2B3DA 5JTTA 4TZTA 3W2HA 4K3UA 5HWSA 4L7QA 5CM9C 4BECA 1K2VN 3LX4A 2QD2A 3TZHA 3KSZO 3E58A 5E8JA 5LP6F 2WWTA 3G5MA 3FPCA 1DC5A 2WA1A 2PUFA 2QJOA 4MA5A 1FNCA 2BKUA 5GMOA 4E5PA 3FY4A 2UVQA 4ZI3A 1E58A 1W5FA 3H1GA 5BWBA 2BN4A 1NBWB 1ODIA 4CR6A 3A11A 3V1MA 3C3XA 5B37A 5J47A 1CUFA 3NO4A 1D2CA 1V48A 1PK8A 2ZLBA 3SZGA 4W1SA 2EQBA 1NXXA 2PKRA 1JSXA 3BGVA 5LP6A 4UEWA 1NQTA 1FUEA 4U7GA 4W8HA 4D8XA 2VDLB 1JL3A 2KLBA 2Y0DA 3BD6A 4BQIA 2QIPA 4R2JA 2J9XB 4FKBA 2ANBA 4QDXA 3SLRA 1E2IA 3B38A 2WDZA 3Q2IA 4HGQA 5JIBA 1RXWA 2AFIA 1SRQA 3FCOA 4QAQA 3CPHA 2FEOA 1XMXA 4YUYA 4NBSA 4QYSA 2I3AA 4WA7A 1U2DA 2IW1A 4ARAA 2WVAA 1G9SA 3DE6X 4W63A 3WR5A 1GARA 3JQ6A 3D1VA 4KK3A 4TRJA 3FWHA 4BIMA 3FUVA 1W29A 4BX0A 5C0OE 5KOJA 3QZUA 4QGAA 4BWFB 3MGGA 2VDPB 4RIGA 2VDKB 1NIJA 4UNNA 3CSSA 4JKYA 5EY5B 1P2BA 1UXHA 3C15C 1HE1C 2G1AA 2COKA 4WPGA 3UGQA 3VO9A 3NBFA 5HIMA 3PT5A 4XFJA 3K2QA 4M1SA 2VH2A 3WTBA 2LV8A 3V8NA 5KX5A 1FRVA 3BMQA 1X1EA 5FFFA 5HQ3A 2NV0A 2PUCA 1QF9A 2MU1A 3KQWA 1XTRA 1NY6A 4P6VF 3QX9A 1ACMA 1KY4A 2JJ1A 1AB6A 1ISHA 2Z57A 2I6FA 2WFAA 2GQ0A 3EG5A 5CA1F 1VKHA 2O0MA 3U4GA 1JIVA 4Y6SA 1QFSA 3WIVA 4G01B 1YR1A 4F5WA 4WGFA 5JXJA 5K6TA 5DIFA 4KQHA 2QTGA 1IPHA 1IZ7A 3W1VA 3CZAA 2YHIB 4JLSA 4NYJQ 3W5JA 1U7DA 3UWKA 2WP8J 4Q6WA 3JQEA 2FEAA 3QVOA 5DI3A 3WGNA 3RYHA 1KVQA 2QD1A 5T3YA 4F2DA 1SZDA 1DG9A 4HX2A 1J20A 4A8HA 1DPGA 2FPGB 1ZK0A 3MUEA 1DP4A 4AP9A 4BKUA 3CUUA 2WWGA 4DIKA 2Z8YM 1ZNXA 3ILVA 1GHTA 3LXXA 5IH7A 4YMWA 4AJJA 3UA3A 3ZKWA 1MNQA 1E92A 1WSBA 3A25A 3C6KA 3DOUA 3JWJA 1VLHA 5F1YA 2QEQA 4ZC8A 3BK2A 3GGJA 1KJWA 1G8FA 4XI9A 1MTZA 3BL8A 5TF4A 3ZCVA 2I4MA 1G66A 4WAUA 3LLVA 3U4AA 4B3IA 5CPBA 4EHHA 5AYVA 2CHEA 1D6MA 4RMNA 2JA2A 2WV7A 2ZBQA 3IE2A 4OKSA 4EBFA 3ANTA 2LGJA 3UJ9A 1L4YA 4MW0A 1QIKA 4FFVA 2A0FA 2OBLA 4ZV9A 2RCYA 2PWZA 2ZUEA 3EJ6A 3CH5A 3F5FA 4H59A 4R9VA 1Y8ZA 1JXOA 3FSEA 1MRNA 4FT2A 1LC3A 1RJ9B 3FOAA 1C0LA 1SCAA 1V16B 1G20E 1B3RA 4B48A 1PL6A 4A0HA 1D2AA 1DRVA 3KB8A 3KOUA 3RKRA 1HE3A 5E9AA 1W36C 1RAGA 3GAAA 3GZJA 3CR3C 3IAXA 2FN9A 2JASA 1EHIA 2WP0A 4LKOA 4D96A 3CUKA 1VKJA 4EK9A 1XDZA 1CQIB 2HT6A 2OHJA 4LHXA 4NU8X 5CX1B 3ZWCA 3OKPA 2BBOA 1G8MA 4EJSC 1YCHA 1PL8A 3BWMA 3C4VA 2LBPA 2P2NA 3EEIA 2HZ7A 1QCDA 2WA2A 4YUVA 4EFMA 2VJMB 2YZGA 5AM3A 2IX3A 1L9XA 5FOTA 1S01A 2GPNA 3KPJA 4I5FA 3NHRA 3SVTA 3SXJA 1RZRD 4M9QA 1AS0A 4CG2A 1QH8B 3BE5A 1IN8A 3AIKA 1P7PA 4L4ZA 1SUBA 1GUBA 4AQDA 1QFJA 1GPKA 3DSRA 4I99A 1V8PA 2QZ4A 3RJZA 3CVVA 4N5LA 1KZYC 4JQOA 1KVRA 4E6EA 5JSUA 1L5OA 3GEBA 4F85A 3EZ2A 1DOHA 2CJXA 2DGDA 1BU5A 3GGGA 4REQA 4E88A 3NOXA 2JATA 2J3MA 4B71A 2H29A 1PGJA 3VTAA 5AQEA 1EMDA 1YR6A 1D2HA 3FZNA 3IBSA 1GNVA 3M9WA 3E3OA 2AR7A 1T3SA 3QXCA 1FP1D 3K1JA 4B1FA 1TW3A 1ZJYA 3MBIA 4HGYA 4DC0A 1SVSA 3DL0A 1LTHR 3ND7A 4GVXA 4TVBA 3BMCA 4YMIA 3A6EA 2ZYSA 3ZY6A 1E0DA 1K8ZB 1R1DA 2PZLA 3G02A 4HGNA 2V65A 1IUNA 3CF4A 4ERNA 1EHYA 3OG9A 4Y2QA 3L40A 3FCYA 3MBOA 2IHTA 2XYHA 3TQIA 5DWVA 1KF0A 1U9IA 2ILTA 3GGSA 3OU6A 4TN5A 1NA5A 5KU7A 1PN3A 1XCGB 3N59A 3RIHA 1DC8A 3U49A 2ZDGA 3WB0A 5AVUA 3OEYA 3MTEA 1P7CA 1I6KA 2P9BA 4BQRA 5B64A 1KXZA 2DQZA 2W0SA 3JW8A 4IZIA 2CV0A 4U4AA 5TQVA 5DX8A 4I3GA 2FPKA 3AHIA 1BE8A 5CLIA 2HMSA 4XLLA 2JD2A 1CZRA 421PA 2E6KA 1PVOA 3T9DA 2E4VA 1KVSA 3I8OA 5CDFA 7ABPA 1ZRHA 4E32A 2KM1A 4AYXA 3GEEA 2HBYA 4IDNA 3EDMA 2R97A 2L42A 2JLBA 4X7PA 3EY9A 1ZGAA 3EXEA 3NEPX 3ZPXA 5JFTA 4I7EA 3HB5X 3MN1A 1WKVA 1UM9B 2DT5A 2EC5A 1O03A 5AXCA 4N48A 4JLJA 4XJXA 2Y1FA 5I9NA 3RBZA 4LRYA 3DL2A 4ZQBA 3HDHA 4ZYUA 3UUGA 3A4IA 4IDQA 2WD9A 3UH1A 4UUNA 4LXXA 3A3OA 3DPIA 3OJEA 1Q0SA 3OTHA 3PE6A 4C7JA 1BDBA 4EA7A 3BXZA 2QZ9A 1CQJA 1JIXA 3JVIA 5BW4A 2VHWA 1JLHA 1R4MB 5L3ZA 4BTLA 1KH3A 3U7RA 2A1TR 4NEQA 4WDRA 3TW4A 4LA4A 2HWKA 1FP4B 5F64A 1EQAA 1KJIA 2VTEA 4FR2A 3EASA 5CGZA 3K5HA 1ZN8A 1JAHA 1N7JA 3PDIA 3BXEA 5FNVB 4R8RA 1G8PA 4A73A 1AQIA 5FBHA 3O8LA 2EKPA 4QQRA 1BC5A 2H7YA 4J9UE 5FBZA 5BSGA 2VLIA 4G5HA 1XJ0A 3UA4A 1BWQA 4PPFA 4UCWA 5FJJA 1ISJA 3WGLA 4EPYA 4LBWA 2ZSAA 3H19A 4JLDA 3TNLA 4B6PA 2DLCX 1SKYB 1CZKA 5I8ZA 2ZSHA 3JY6A 2G1UA 1Q3HA 2ZWOA 3PTLA 1B0UA 2OHGA 3WYDA 4JC8A 1TM1E 5HX7A 1CUAA 2R4UA 2TS1A 4NU0A 3RPEA 1DOAA 1ULZA 1ZOPA 3PCXA 3R5FA 5IANA 5FPTA 1M83A 3DOOA 2OCYC 3EODA 3NLLA 1MU0A 4J90A 5HE9A 1TJ3A 3VQTA 4Z49A 2R7MA 5KNBH 1PSDA 4IVQA 1RIFA 2HU5A 4FYYA 3CZ9A 4HWTA 4LDJA 2VT2A 2EIXA 1NYLA 2C4KA 4RYDA 3TJZA 1KETA 2CLMB 1F2TA 2AN1A 5EP3A 1GTG1 5IEJA 4CTJA 1MPTA 2W4QA 3PRHA 2YVQA 1ZHHA 4PSAA 3VKHA 1PEAA 1EM6A 1H8EA 3N76A 1NJ6A 1P3DA 4E5MA 1F17A 1A71A 2FU5C 2VJNA 1U5BB 2AH5A 4MVJF 1O9HA 4C04A 3LBAA 4CCAA 1H65A 5FLKA 2GUGA 3KAKA 2ZETA 3LDFA 1RXVA 3DKIA 1SGWA 4PFSA 4AWAA 3AIOA 3H75A 2V6GA 2QI9C 3TBFA 2FFHA 3GDGA 3N2ZB 4Y2GA 3A9WA 3MAJA 1E2FA 1I01A 2OV4A 4ZV7A 1JTFA 1XDBA 4DDUA 4MUGA 1HDXA 3WGMA 1RYHA 3EC2A 3O8DA 4YCMA 4UOQA 2V7QD 1BA3A 1WQ4A 3IVXA 5JWRA 4Y2JA 3H6KA 1EZZA 3IP6A 2XE7A 4DAEA 2YZKA 2A84A 1U04A 4UDNA 1CV2A 1FK8A 2JKVA 2Q1XA 1V39A 3JQAD 3KR1A 3Q2KA 4RPIA 2C4MA 2GDZA 2VF5X 1Y3CE 1SQ6A 4RU1A 5AO9A 4E3WA 2QMOA 5K7SA 1UBKS 1FNNA 2J6BA 3LQQA 5ADVA 4M0KA 1NASA 2C82A 5KOJB 3IC5A 5WRFA 5BNWA 5F2KA 2RB4A 2JFVA 1KPGA 4U7JA 4X3PA 4EJ6A 2F8LA 2GTIA 3HABA 1RHRA 1WVGA 3GEDA 3IDOA 4INPA 3W3AH 3WL5A 2FX2A 2V7BA 5IF9A 2R66A 4YBRA 1JHVA 2YWDA 4E5VA 3DOIA 1KI2A 2QXTA 1EVIA 2JH9A 2PXAA 3A1SA 4ZCLA 3VPXA 5KYXA 1CJCA 1IZZA 4UOEA 1EE9A 1QMPA 1DQSA 2YHSA 4U9IS 1GEGA 4KTVE 5JZMA 3H05A 4PGAA 2PJDA 2B7CA 3HJAA 1T8PA 3O3NB 2AZ4A 3TLYA 1L5NA 1PSZA 2PMFA 5IXYA 4HUTA 2PGJA 3EPRA 3LC0A 4V1CA 2QN6A 3GCZA 4XDHA 5AP9A 1Y8RB 3QPDA 4HZIA 3HLYA 3EPKA 4OHOA 4RO0A 3N8IA 3WXBA 5BSFA 3E22B 3CEHA 2K2QB 2V3VA 4MWZA 1KAEA 5IDXA 4QTYA 3CT4A 1ZLYA 1THMA 3T3IA 2WMDA 2A1TS 2P69A 2QN2A 3LQ2A 4MRRA 3WWOA 1G98A 4AZWA 4QGHA 3VNSA 1U7WA 5EEHA 2R8XA 1E5TA 4GU5A 3FHLA 5C31A 1Z0FA 3ROGA 5HQJA 3TOXA 4LJLA 3KZNA 4P4LA 4U5QA 5K3FA 4I4TA 3TRHA 1F38A 3URMA 4D92A 1Q14A 5EGNA 2PSSA 4KSBA 3R3HA 1RZVA 3ZC3A 4C9BA 4XPZA 4BX9A 1CP3A 5ALEA 1YR7A 1Z6QA 5PGMA 2WF9A 5AOAA 3Q7EA 5H9WA 2F1RA 3I5MA 5EZYA 1FBTA 2EKQA 2V6IA 2NU8A 1G38A 1N2ZA 3KE9A 2P4SA 1BO6A 2I6GA 1YJAA 3H5VA 1KI4A 4CBVA 2Q27A 4FEGA 4C5BA 4U6QA 5F77A 2I34A 2GR9A 2ZKLA 4UFNA 2FZ4A 1UADA 1ZA2A 3P9RA 4J3FA 4OAPA 4S1PA 3NVMB 4JVNA 4IRXA 3VZRA 1DMSA 1CNMA 2QU8A 3HKCB 2IUFA 1FF9A 2VN8A 3CRW1 3N7UA 3R8XA 5IX8A 2QXUA 3SR3A 3SX4A 5CR9A 1HBJA 2NPIA 4UTOA 3VKUA 2QPAA 2CJFA 3QJ5A 2KPOA 5K3FB 3ENQA 4PYKA 1Q7BA 4EYOA 3F7MA 2IU4A 1U2GA 3VR4A 3KQYA 4L5YA 2G5PA 1CEXA 1XI2A 2FW0A 2ORVA 5FX2A 2PX5A 1LV8A 3EIWA 3GDFA 4ER6A 5KNCH 1JW9B 1KI3A 1PI3A 3F1KA 3I8SA 4ES6A 4C4PA 3TF5A 4D3SA 1E96A 1CNFA 5KOIA 1I6MA 3D6FA 4H3SA 1BS1A 2EWMA 4JGBA 4OFWA 4UVGA 4BFWA 1H8ED 4EI7A 5A62A 5DWDA 1FCJA 3RKUA 4URXR 3HXQA 5CFPA 1GTSA 1W4CA 3MT9A 3NWBA 5G4KB 1YR2A 3VSEA 3GQBB 2OTCA 2F59A 1USUA 3AP1A 2YRFA 1BX1A 1XTIA 4ALIA 2RJOA 5DGCA 3KYCA 1PAUA 4IOMA 5HFAA 4C4TA 4LF4B 3ICVA 3WL7A 3QOYA 4ZKEA 1MGPA 2X3FA 2P9QA 3D3WA 3MRVA 5FO1A 2GF0A 1FC0A 1XD8A 3HBLA 1LPAB 3GLVA 2CXXA 3H8VA 1NXVA 4L5BA 4LXQA 1HWYA 2C1EA 1Y5NA 2JVKA 4CIBA 1QU3A 4RADA 4QNRA 1U0LA 4OP1A 1PFUA 2Z2KA 3E8XA 1RWNA 2QMZA 3QENA 4YDRA 1RAEA 1BCSA 1ESZA 3HDVA 3H6HA 2ZE5A 4E09A 4F3YA 1SXQA 3OOJA 2VVTA 1SXJB 1CUVA 2IX9A 5H1YA 4F4IA 5CA0A 1QHHB 1Y89A 4TKMA 3FCAA 2D5CA 2HSEA 3I4LA 3RAGA 3EIEA 5ETJA 5I7SA 3LRTA 1NDQA 2QUJA 1C9EA 1ZM4A 3MELA 1UKYA 3D3WB 1YRAA 3LT4A 4IDDA 4TVOA 5K8CA 1UF9A 3AOEC 1ODFA 4GX0A 4H18A 5ALXA 5TJ9A 1PGPA 1U0OC 3A6JA 3AF2A 3JQ9A 4RZSA 2A5YB 3ZD8A 3KZ1E 5CJJA 3PQ5A 1BWPA 4BMZA 5KYWB 1XXHA 4OMDA 1N92A 4XTCS 1U2DC 3WDMA 5BN5A 2AWNA 4LRQA 1IWBB 2AJTA 4MB0A 4P4NA 1P6UA 1GRRA 1L4FA 4QUEA 4Q1VA 2OXTA 2PD4A 5CG2A 2CUTA 1TUIA 2XDAA 4YJ3A 2PPVA 1OWNA 1SXJA 2ZRJA 3W9UA 4LE2A 2PBLA 1EWKA 4LZOA 1W581 3QPUA 2J5QA 1E3EA 2PUTA 3MA0A 3WFJA 2H4ZA 2QTTA 3ED1A 3FWNA 4TV9A 4EIWA 2VTKA 4Q9JA 1VCIA 2JIMA 3ON5A 4R0VA 5L8VA 4NKRA 4HADA 2H8KA 1JHRA 2O1XA 5ED0A 2MDTA 4MA0A 3QUBA 3MPUA 4I9GA 2Q1UA 1XWFA 4Y7DA 4A8JC 3R3XA 2H51A 3DE1X 3LF1A 2NO1A 3BIJA 4TX1A 4EA6A 2W8BA 4GI7A 4IGKA 1Z6YA 1A5SB 5BQPA 1CQZA 4BNDA 1VMEA 4JP8A 5CT9A 3Q5DA 3DNPA 2MHCA 1RLMA 1F6BA 2NV6A 3CLTD 3PWZA 2J6HA 3Q7QA 2DPGA 3KVRA 3B3QA 3GMIA 3OLVA 1DUVG 1LXCA 4I55A 4XJSA 4R54A 1U4SA 2CCGA 2DFLA 4DTIA 4YUWA 4CUJA 4R1LA 6LDHA 3AESB 4G1CA 4RZ3A 4ZJZA 5BPFA 1WBBA 1KTIA 2O1SA 4TL9A 2CLSA 1IWOA 2DULA 4OXNA 3RIYA 1PWEA 3BIFA 3T1OA 1RKBA 1ML4A 3LUGA 3KV3O 1JEEA 1J0BA 1WUIS 4HQRA 5K4AA 3H7AA 2D4HA 3ZZNA 4CLDA 5HS6A 1M34A 3H9QA 1OXXK 4ZQGA 1JG6A 3LTNC 4N9WA 5KB3A 5LYJF 1E4EB 4KIFA 3EXHA 5TB5A 3ZUPA 2Z08A 4DHWA 5GIOE 1ZONA 4O4LA 3OLWA 4GOND 2KYRA 1I3KA 2Q4DA 1UDXA 1GGMA 2WM3A 4ZT6A 2Z98A 1UPFA 1XN1A 2FMXA 5EE1A 5LP6C 3UMCA 1KS2A 4OB7A 5FQOA 4JP5A 4D46A 3CIOA 4H7JA 1NI4B 4A26A 2WMOB 2FOIA 2J48A 1GDTA 2NVOA 2O0LA 3DL4A 2X9GA 3OTWA 4NX2A 1BX3A 4NK4A 4WV3A 4AG5A 4JYAB 1E2BA 2B4RO 4MUIA 3FVVA 3I9V1 3FOZA 1V9LA 3KBBA 4D9BA 2OO5C 5CVTA 1Z4MA 1D4AA 2WVHA 2QR3A 3JRXA 3T3PB 3M6WA 5AHWA 3W2IA 1O9GA 5GV7A 1IHUA 4BB0A 4AI6A 3AW9A 3VDQA 5DOVA 3S2SA 3QHAA 5J2UF 1G8GA 2BLNA 2XNSA 5I9MA 3CKKA 3TN7A 4WNAA 3DM9B 1UOOA 1EUDA 4IDOA 1Z26A 3VO1A 4JMPA 4RK4A 2CF6A 3BYZA 1C41A 1LZLA 3F6EX 3T5PA 2I91A 1BMFA 2OVBA 1RBMA 1YNOA 2ZWMA 1CUYA 2BUCA 3FYUC 2VJPA 1ULSA 3K15A 4UU8A 2QPLA 2WTAA 2JFGA 3MCAA 1PKEA 3KIPA 2Q5FA 2QNBA 5CLFA 1XZ8A 2IP2A 5ICEA 3MOIA 4FD2A 5CNIA 1ZMBA 2ZJYA 1EGQA 2I2WA 3CYFA 3F7OA 3IALA 3ILSA 3Q1LA 4GOOD 4M1QA 4NSNA 4MWCA 1SVOA 2EJUA 3BICA 3CCCA 4AJ9A 2JGAA 4WNYA 2V5VA 5ALIA 3S2YA 1V5GA 4C14A 5DHPA 3A70A 4IJUA 4HAUA 2LDBA 2BLLA 4MZDA 4Z53A 3CO0S 3RLIA 2B69A 2ST1A 1MVLA 3SQNA 3VVBA 2IGBA 1W96A 5FLXA 2E21A 2VNHA 5FAKA 2JAUA 3FTEA 1FL9A 1Z45A 4YFVA 1TVKB 1PG2A 3E7WA 4YT2A 5EJEA 4YXFA 2NT3A 2X5XA 3GUYA 2IDKA 5FH9A 2C07A 3FPEA 4RL4A 5FJIA 3GYBA 1U0EA 4OREX 2PZAA 4G0XA 2WM8A 4AZ0A 6Q21A 3THXB 1ZOSA 5IC4A 3HVRA 3EEBA 3NTLA 1KYZA 1XLUA 4EZBA 2DFTA 4QO7A 4ESOA 1TMKA 4BQQA 2G36A 1OAKA 3H99A 4JI4B 4UU7A 3ESCA 5HF5A 2LCQA 4MHSA 4E22A 4ZEXA 3ZY5A 1SAYA 2ZYAA 2XGOA 2I3ZA 1QFMA 4IFIA 4LJ7A 4NY1A 2V7TA 1EAMA 2ZANA 3KL4A 4DA0A 2NO9A 521PA 3N0WA 1BA2A 1RZUA 2FG7C 2VP0A 1CJSA 1P8AA 2YNMC 2I4NA 3H8WA 2E2WA 4D3ZA 4HRXA 1RRGA 4A8TA 3K6KA 2EG9A 2ZRCA 4FFOA 2ZBVA 3L0ZA 3OMXA 4PYIA 1MP0A 1QO9A 1FYVA 3I23A 5A4IS 3UW3A 5H70A 4TT3A 4DWVA 3LZCA 1NVAA 5CRIA 5BVGA 3HWSA 2JGEA 2O5VA 4TS9A 721PA 3LSTA 4N8DA 1BU8A 2JC3A 4FSDA 3V4OA 1YR9A 3HY4A 3QOXA 4R9SA 2XKJE 4CTKA 4PXAA 4JI2B 1Z6PA 2GAAA 1C2YA 2FUNB 1M54A 1OXVA 1KMIY 3P94A 5E4YA 1BQ3A 3OLQA 2BVNA 5SYAA 3WV4A 3PUWA 1TKRA 2EKDA 2BISA 2QVLA 4FYMA 4TWAA 4QA9A 2HSZA 3KLNA 5A3VA 3AEYA 3T3NA 3HG7A 1LPMA 3JQ9C 2YHBA 2CCKA 2VNJA 1VIAA 2BUBA 5H0IA 5HCIA 4DJEC 2AR0A 3DHYA 1VYVA 4N0PA 2VJQA 1TGYA 4RHFA 3ISTA 2JCSA 4FYXA 1MIOB 2AF3C 4BUCA 1G5PA 4QHYA 2HA4A 4TZ6A 3HBFA 1CR2A 2YCLA 3A05A 3Q8KA 4B83A 1IN4A 4CG0A 1UXIA 3LSYA 4EF5A 2ZYWX 1CFJA 2YWFA 1T3ZA 4KHPB 3LDAA 2A86A 1JKFA 3TVYA 1Z5ZA 1E7YA 1FXWA 3C6QA 3SMVA 2V1XA 4MS4B 5AW4A 3BTSA 3EGDB 5EMLA 5EJ8A 3PFKA 1P73A 3A9VA 4UKDA 3RSGA 1PEYA 2UUPA 2V4UA 4GM1A 2Q0SA 4NYIQ 3K9NA 2XWJI 2EL9A 4K1XA 1FXSA 2ILVA 4F93B 1DOZA 3FHCB 4BFSA 3T9FA 4JIGA 3D4OA 3KZVA 2BAGA 2ZU6A 3EGVA 4G24A 1X1DA 3AR5A 3UJDA 5LQRA 2OPBA 1IHYA 1T0IA 4L50A 4UCQA 1OXTA 3GU3A 5AK3A 3GP8A 2CUKA 3A31A 2ZW9A 1XNQB 3DG9A 2OD2A 3A04A 3ZU3A 3FFXA 3FM9A 1QDUA 1P19A 1GYPA 1IL0A 3FR8A 2DQ4A 5AHOA 4W7IA 3LUDA 5CP8A 3DULA 3QE4A 3TLZA 2XKAA 4LHYA 4ITVA 4R6WA 4X63A 1FRFS 1R18A 2DMRA 3LZDA 3G1WA 4C7VA 1OGJA 2YV3A 4EJSA 1MCZA 3WLOA 2DY0A 1QTIA 3LOUA 3MJ4A 3FFWA 1XCBA 4IDFA 2QKYA 4C7MA 5ALKA 2YFYA 4ER7A 2H5LA 1V43A 5B7GA 3NYQA 7MHTA 1HH4A 2R65A 1YTUA 4K9KA 2DF8A 4BZWA 4H9GA 1WQ3A 4EHNA 1A9OA 1GJRA 2ZRAA 3OOHA 3TAXA 3CR8A 3C8DA 4QIHA 4YT5A 2P90A 3PQDA 3PYLA 4IMIB 1KQGA 4DQVA 3PNLA 3G2LA 1WMEA 3JD2A 3OX3A 2G88A 4LPSA 2WQ6A 4MGKR 1R4NA 5BMVB 1XQWA 1PR5A 2BGJA 3CTMA 3L7DA 5TQ2B 3R20A 5IM5A 5A2QA 2JFXA 3EB9A 3NIWA 2EFHB 4M9SA 1Q21A 2QD3A 5E3HA 4BVEA 9ABPA 2R6FA 5JI3E 5JSHA 3PJFA 4XYMA 3JD0A 3WVNA 2WNIA 5LA6F 1DBVO 1OIVA 1OI4A 1RNLA 2WICA 5TE9A 5LJIA 4EMBA 2XZLA 1Y4UA 1MB3A 4EKIA 2WRZA 1SD5A 1SY7A 4K6CA 3GUVA 3OY7A 2DJ5A 1DQRA 4OUDA 3GR6A 3GEGA 4UU0A 4PNHA 3CWCA 5C5EA 1NW4A 4N12A 2YV1A 1OU4A 2GHQA 2NUBA 2QSZA 3AUFA 3KP1A 4P4SB 1LWOA 1IHOA 1D1QA 2JGMA 4IGEA 4BYGA 1V1RA 4P2BA 2UZ3A 5DNWA 5C7IO 1ZP6A 3AFMA 4RJTA 3OEWA 4P38A 5FWNA 4BGUA 2GWHA 2OV3A 2XZTA 3N9IA 4KO3S 3HRKA 1HY3A 2IHBA 2Q4TA 4IF4A 3SC6A 3W6UA 2RHRA 2J4DA 2PGAA 3IB3A 2RKWA 3QFCA 4UEKA 4WLUA 1TYEB 5IWCA 2FSSA 5J4HA 3ICQB 1JBQA 2XMQA 1JR3D 2ES4A 5E4JA 3Q5GA 4QODA 1YASA 3V4PB 2ZZKA 1WZCA 3VR2D 2JFFA 1T6BY 3QELB 3IKVA 4WFKA 3WJ1A 1YMUA 1TU3A 1M6VB 1SCUB 1BVRA 1Z5OA 4MR8B 2QLMA 2PLNA 5IM4F 3I1FA 1A9YA 1SA0A 4BP3A 2AKYA 2BJWA 3L0DA 4E13A 1NZFA 4M1TA 4BO6A 1NLUA 3I39X 1KEKA 1KJYA 3PBKA 1UK6A 3FGZA 1SMKA 2PS9A 3RRYA 3BQNB 3TSOA 1HNWB 1M5UA 2QUIA 4D26A 5ECDA 1FYEA 1JTVA 4PY2A 2NTNA 2O06A 1IC6A 1ZGZA 5U4XA 3HKBA 2WJ4A 4HAYA 2OCDA 5BUQA 1XF1A 5AOBA 4DDWA 4Y0NA 4ZZ3A 1SBZA 2EP8A 2ZBFA 4E1BA 2DWOA 1CY8A 4P4TA 3FYHA 1TD1A 4D99A 2EIHA 4V0OA 1TAUA 1YZLA 2W90A 2BV3A 2OCPA 4LJAA 4OP2A 2C54A 3JZAA 3RYIB 1TD9A 2VNIA 3R2JA 4R2HA 2QUHA 3SYMA 2HXSA 3TQHA 5GOZA 1NSFA 3LX5A 3PA8A 2FVYA 4ZDKA 1OJLA 1FDTA 2YIMA 1YU9A 1IJEA 1X7GA 1CBUA 2M98A 4R16A 5ED4A 1QQAA 3JYNA 1PFWA 2YYYA 1AQUA 5DM4A 4KR7A 1MHPA 2EBWA 5DOZA 4FCVA 2QMHA 3DVSX 5E6RB 1LS1A 2B4YA 2GAJA 3R7AA 1K27A 2ORWA 3LVRE 3OLZA 5GOTA 5J2UB 4CIWA 2OXEA 4OHZA 3WWDA 1PJLA 4O4IB 2VH5R 4MWEA 4P98A 2WNHA 2OYSA 1OIXA 1JLSA 1TVEA 4M9RA 4J1SA 4ZYYA 5K6AA 1JBEA 2JA1A 1VJTA 3FVTA 2L0XA 4MCJA 3NPAA 3M81A 4I50B 4BGIA 4GKJB 1C8LA 3GH3A 4TLLB 3GGOA 3PDUA 5REQA 4GSKA 2H4JA 1E2DA 3L4JA 3OM1A 3I9LA 4RF4A 1VYHA 2PKWA 3ENVA 4B43A 4BCDA 2O8CA 4GQIA 4HLUC 3SNKA 1UJNA 4CIAA 3DMRA 4HPXB 2QW1A 5FR2A 1P0MA 2G8LA 1UPXA 3D0QA 4GMHA 3PL1A 1INLA 4LZWA 3WA6A 1EX1A 3G8BA 2XIJA 3WKEA 1U11A 2BGKA 1U2RA 2HWYA 1XZKA 4GLFA 3WSVA 1SQ5A 3R3SA 4JJKA 2WKSA 4NC9A 4Q1EA 3TX6A 3S2FA 1C30A 2VDWA 2O3QA 3WAKA 3O75A 4POAA 4D4HA 5AKGA 1FYDA 1Y4SA 2HCFA 1Q84A 2XX3A 4I50A 2AX4A 3ZGLA 4DW8A 3JSXA 5IUKC 1GLGA 1G8JA 5GJCA 1EJBA 4G1EB 1IQUA 5REQB 1Q19A 3R23A 3YASA 1HDGO 4MLZA 3RFFA 4K0RA 5G0UA 3PP8A 1NI3A 4FBMA 3TTTA 3H04A 3D6NB 1ZI8A 2QAJA 4Q9DA 2KMLA 4EPTA 3CPEA 1CY0A 2WPDA 4XZ3A 3TLCA 2IY9A 4B3FX 4DB4A 4LK2A 5GGXA 1K2WA 5I45A 4ID9A 4RDXA 4XIJA 3DE0X 1EJ6A 3VR3D 2RJNA 4B5LA 2ZULA 4NZPA 1H5UA 1N8SA 1DG1G 1O5OA 4Y2HA 4QUBA 3RGWS 1AUXA 2HQRA 4XRRA 4XVHA 3ZDXB 4B3SB 4LBYA 4IQ4A 4JYCA 3MJHA 4HUJA 5DTEA 2IUYA 3FPGA 3UPUA 5J2TF 1NAIA 4FJ2A 4GI5A 3DLPX 3UOWA 1JQKA 2YZ7A 4KQ6A 2VP6A 3DVRX 4LW8A 4BVAA 2L18A