3HEAA

The l29p/l124i mutation of pseudomonas fluorescens esterase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
271
structure length
271
Chain Sequence
STFVAKDGTQIYFKDWGSGKPVLFSHGWPLDADMWEYQMEYLSSRGYRTIAFDRRGFGRSDQPWTGNDYDTFADDIAQLIEHLDLKEVTLVGFSMGGGDVARYIARHGSARVAGLVLLGAVTPIFGQKPDYPQGVPLDVFARFKTELLKDRAQFISDFNAPFYGINKGQVVSQGVQTQTLQIALLASLKATVDCVTAFAETDFRPDMAKIDVPTLVIHGDGDQIVPFETTGKVAAELIKGAELKVYKDAPHGFAVTHAQQLNEDLLAFLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arylesterase
publication title Switching catalysis from hydrolysis to perhydrolysis in Pseudomonas fluorescens esterase.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 104
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3heaA00
3DKKA 4OB7A 3DD5A 4OU5A 4B84A 1QE3A 5AI0A 5AOCA 3WKBA 4BTVA 1WB4A 1BE0A 2UZ0A 4EBBA 3MGAA 5LZ5A 5ALMA 3HYSA 2QT9A 5JATA 1U65A 5HF5A 7YASA 4TVKA 1QGED 4H7IA 4OB6A 2QUAA 5EHQA 2JGEA 2Q0XA 2Y6UA 3R40A 1UT6A 3STXA 1UKCA 1K8QA 3JYHA 1E5TA 1HLGA 1Q83A 1BCSA 3R3YA 2OCGA 1AQLA 3BXPA 1VKHA 4C4YA 3H1BA 3D3NA 3STVA 4S0XA 3FWHA 1H2YA 3L1JA 1CLEA 4HTAA 1Z68A 3GZJA 2HA3A 5ALZA 3DYIA 1THTA 5FXMA 3QYJA 3WKEA 1R50A 4BATA 4FBMA 5AKIA 1AGYA 3W04A 4J7AA 4Q82A 1GQRA 3I1YA 5CRIA 1JU3A 2BJHA 3ANSA 2Z8ZA 1IZ8A 2PSFA 4J3JA 3G9TA 3VVLA 5HK9A 1MN6A 4E14A 5JYCA 1VZ3A 3FVTA 1LPMA 5FOQA 1JMYA 4DTCA 2QXUA 4QDTA 3DYVA 3QMMA 4PSDA 2WFLB 2V96A 3IUQA 1I6WA 3C5VA 1ETHA 5T4HA 5ISMA 4M0FA 3M3DA 3HJUA 3K9BA 5JIBA 5CT9A 1NX9A 2BAGA 4LYEA 4UHFA 4XWGA 5ALNA 1TRHA 3H2HA 2WHPA 3DJYA 2OQIA 3VDXA 1THGA 1IUPA 2WLSA 1R9NA 4IHAA 3QPCA 2O2HA 5IVIA 5CURA 3WL5A 4FLFA 1WHSA 1ZI9A 4FFVA 4JEIA 5I7UA 2VJCA 5FLKA 5AKZA 3HZOA 4QNNA 1DU4A 4INZA 3STUA 1R88A 1VA4A 1HL7A 1A88A 1QIIA 4C01A 5ALOA 1SCQA 4GHWA 4OD0A 4WDQA 2VSQA 3IULA 1AMNA 5AKYA 4YK7A 5CT6A 4X7BA 2G4LA 2C7BA 1L7AA 3WA7A 2GZSA 3I2HA 4LYDA 3A2LA 4W1QA 1LGYA 4Y7DA 2RIPA 5DNVA 4B85A 2XMZA 3WL8A 2WUGA 2PSDA 1ORWA 3KXPA 4BP8A 1WCYA 4Y2YA 2AJCA 2Z8XA 1X2EA 4L72A 3G0BA 3WWOA 4GWLA 4B9AA 1CUZA 3OTQA 1WHTA 1CEXA 2XDWA 5ESRA 2CB9A 3V1NA 1FFCA 2I3ZA 5DJ5A 4BBZA 1EVQA 4C6HA 4ARAA 2JGIA 3ZV7A 1W6RA 4HAIA 2VAVA 4DGQA 3R0VA 1MX5A 4G9EA 1S8OA 4X6UA 1YB7A 3AINA 1XZJA 3DLTA 4BZWA 4WDRA 5BWBA 1YAHA 4DMFA 2B9VA 1J2EA 3BDVA 1PJAA 3FSGD 3W9UA 2VAXA 2HU5A 2WG2A 3R3XA 4I3FA 1H23A 4RGYA 4WJLA 3ESCA 1QIDA 4KE9A 1OILA 1TKRA 5D7BA 1VZ2A 1LZLA 2RGUA 3KSRA 4G4JA 1RYYA 1JJIA 3V48A 2Y2UA 1LPSA 5SYMA 4ROTA 1YASA 2HRRA 4OCZA 4W9RA 1CUXA 5AIBA 5I8PA 1IUOA 5C7YA 2HU8A 1XZFA 2FJ0A 2WFLA 2HA6A 1CUGA 2WIFA 5LZ9A 4Q3OA 3VISA 1A8UA 4CFSA 4KYVA 1CUYA 3IUJA 1EB9A 4EUSA 5LIPA 2XUHA 3CXUA 3AIOA 3A2NA 1XZHA 5AHXA 4BDSA 3ICVA 2WJ6A 2C4HA 2H7XA 4ZWNA 5A2GA 2H1IA 2GYVA 3DDUA 4UHEA 5AM2A 1JI3A 1LZKA 2CBGA 2EDCA 3WZLA 2BCEA 4F0JA 1H2WA 5FRDA 3FYUA 3RKSA 5C8VA 4B0PA 1BEZA 5ALRA 1ZD2P 1UK6A 4UHDA 2RHTA 2BFNA 1CUEA 3SK0A 4B80A 5BOVA 5AKKA 1B6GA 4G1FA 1ZD5A 2GBIA 1YAJA 2DHEA 4DIUA 1YA4A 3AZPA 4PQEA 5JALA 2XQFA 4UBJA 2HM7A 4KAAA 3D2AA 4H0CA 4AQDA 1U2EA 4MQMA 2WHPB 3FOBA 1XLWA 3KD2A 4HRYA 4J0IA 4QA9A 4CG2A 3H1AA 4C4XA 5F4ZA 4G8BA 2GYWA 2J4CA 5ALTA 4Y2XA 4QLOA 3ICWA 1KU6A 2O2IA 1L7QA 2WIGA 2ROQA 4J0KA 4W63A 2VJDA 3V1MA 2CUTA 3OPMA 3C45A 1YSCA 5JZ9A 3Q0TA 1TCCA 2YYSA 5E4TA 2XUJA 3CN9A 4BYMA 1B41A 5BV7A 4FWBA 3STWA 3W06A 5EI5A 2VTVA 4GI1A 1EA5A 4JYMA 3JWEA 1W4LA 1YA8A 1AZWA 2AJLI 4NZZA 1XLUA 5KBYA 5HFNA 1G66A 3Q8WA 5DNWA 5KWJA 4AN1A 2WTNA 4QWMA 2VATA 3BIWA 1G5FA 3ZLTA 2WTMA 4Q3LA 3VJKA 4Y2TA 2XUPA 1ODSA 5AOAA 4BDTA 5K3BA 3LCRA 5D6OA 5K5EA 3IDAA 5AO9A 3U0VA 3D4LA 3ESBA 3I2IA 4EY8A 4YASA 1XQXA 1TK3A 1O6FA 1YS2X 3D2BA 4FLMA 5AKHA 3E1GA 1K4YA 5JD6A 4Y9SA 1PFQA 4X85A 4AZ3A 4HVTA 1VXOA 1BRTA 5AIAA 1ZJ4A 4X71A 3DS8A 2WG0A 5ALQA 2PBLA 4AX4A 5EGNA 3S8YA 4H7JA 3LLCA 3STTA 4TPKA 2RI6A 2JEYA 2BKLA 3DKRA 1A7UA 4K6HA 2DQZA 3I1IA 1TCBA 4PO3X 5ALEA 4FNGA 3HI4A 2C0QA 4H7FA 3PUHA 1AC5A 1LPPA 3WK4A 2FUKA 2V97A 1ZOIA 4X95A 3BF7A 4GDMA 2XQGA 2XUDA 3F97A 3QPDA 2HA4A 4ZGBA 5HF9A 1F0PA 3TJMA 1UK7A 3C8HA 2ZYIA 2WKWA 3IB3A 3G0GA 2XUOA 2XMBA 3IIIA 5A7FA 1K6EA 4UHHA 4CG3A 3B12A 5EHZA 2ZJ6A 3C43A 1XRRA 4RE5A 3WK8A 4AZ0A 2Z3ZA 1QOZA 1QZ3A 2GZRA 5ALDA 2WU4A 1UFOA 4JYPA 4Q34A 1UOOA 1WB5A 3H19A 2ACKA 3D2CA 4H35A 3WKDA 4KRYA 5DNUA 5JZBA 2IITA 5CW2A 1WPRA 3O4GA 4HS9A 1XRMA 5LP1A 1CUFA 1XZMA 1XZCA 3H2IA 3WWPA 5HQ3A 1FSSA 4RPCA 4J0GA 2QJWA 1WB6A 4NVRA 1UK9A 3OM8A 2ZYSA 1W76A 2AXEA 4MYDA 3X3HA 1QO9A 4E46A 1C7IA 1DQZA 3HXKA 1HKHA 2XQJA 2B4KA 3WIOA 2WG1A 4N5HX 3DL4A 1FJ2A 3AFIA 1XZEA 2I03A 1XFDA 4PF1A 5AI5A 1XZGA 2HL6A 5ALGA 2ECFA 1DX6A 3FLEA 4C4ZA 4Y2VA 1R4ZA 5ALHA 5FDFA 4UBLA 3WYNA 3IVMA 4F60A 4BAGA 3UUEA 3C8DA 1M33A 1SOMA 4ZXFA 1JJBA 2OGSA 1G4HA 4KR0A 2VJAA 2ES4A 1RWQA 4OU4A 5EIEA 4UFPA 1CUWA 1MU0A 3H18A 1BU8A 3GUUA 3GELA 3FVRA 2B20A 3TGLA 4JUIA 3C6YA 5CXXA 4EB0A 2JGFA 5CH8A 1O6GA 4ITVA 4V2IA 3IA2A 1NU6A 3A6ZA 1SFRA 3B5EA 1EK1A 2AJDA 4UBOA 1XZKA 3AILA 4WY5A 2OCIA 3I2FA 2G5PA 2HADA 3C87A 3O9VA 3IUNA 4ZREA 4CG1A 3PFBA 1UXOA 4X93A 4FOLA 2H7CA 1CUAA 2OAGA 2OPHA 5DYWA 2QOEA 1P0QA 1U8EA 4K2AA 4QE3A 2QMQA 4MJ3A 4J0CA 1JU4A 4DYHA 4ARBA 1CRLA 4I4CA 4B82A 4UUQA 1K5PA 1WOMA 5ALSA 4CIBA 2I78A 2JEZA 1Q0ZA 3FBWA 2YASA 5IH7A 2QM0A 1VLQA 1F6WA 2D0DA 3H2KA 2HA5A 1GKLA 3G0IA 3ZI7A 1BEEA 2ZJ7A 3BWXA 1BS9A 3R3WA 1XRLA 4J0HA 2XMRA 4U2EA 4WFJA 4AN0A 1FFBA 3S2ZA 5FPPA 1CUUA 2PKYX 5K3DA 4W1PA 1QIGA 1J06A 1UZAA 2HHAA 5LKAA 1N8SA 5ALXA 4Z49A 2WFZA 1DT3A 5AOBA 4UBKA 3O9MA 5EIHA 4OSEA 2JGKA 3R3VA 3I28A 3ESAA 1D07A 3IBTA 2ZSIA 1UWCA 1EVEA 1IMJA 2O7VA 2OGZA 1DINA 3F8SA 5H3HA 3I2GA 1CUDA 1FFAA 1TCAA 2ZSHA 4PNZA 1ZIYA 1MX9A 2BGNA 4AO7A 1MAHA 2JGMA 3G0DA 3O4HA 3HACA 4M0MA 3G7NA 3AUKA 1XKTA 1JT2A 1ACLA 4YPVA 3W2TA 3PF8A 1P0MA 5IKXA 3T52A 3QPAA 1OXMA 2XMSA 1Y37A 4EY6A 3MUOA 2XT0A 5JAOA 4H7EA 1IZ7A 2JIDA 5AM0A 3G02A 4X6XA 2AJBA 2WUFA 3C6ZA 5AKJA 5LYYA 3HABA 2BUBA 4KRXA 3K6KA 4WFIA 2G5TA 5LLSA 4MQLA 2WJ3A 4UHBA 3HLKA 1MJ5A 3M82A 5CH5A 4QDZA 4BCCA 1SCIA 4B7ZA 4E11A 1MPXA 3K2IA 3WIBA 5HK8A 4AMZA 1XQVA 2XUQA 5ALWA 1ZGCA 4G8CA 2WILA 2XUFA 4Q1VA 4GBGA 4NS4A 5K3AA 3C5WP 5HFAA 5IVDA 5E4JA 5JANA 4AO6A 4DSZA 4AXBA 5C81A 2XLCA 3SX4A 3H04A 4FFWA 2HFKA 3RARA 2XUIA 2V98A 1MTZA 1XZBA 1KEZA 4H7HA 3SC2A 1XZLA 4MWTA 1N1MA 1QTIA 3FCXA 4FHZA 3LIPA 1AUOA 4U2BA 2OLEA 3WK7A 2W22A 4ZV7A 2PX6A 1CUIA 2C0PA 2WUDA 1QIKA 1USWA 3DNMA 4HXGA 3QZUA 4J0JA 4CCYA 3IUMA 3G0CA 2AJ8A 4J0DA 4MYSA 5LZ7A 3WLAA 1CV2A 2EDAA 4BC1A 1P0IA 1GXSA 3STYA 5HKAA 4B0OA 3ZLVA 3KDAA 1SC9A 4PW0A 4BC0A 3HC7A 4DNQA 5AKLA 1LPNA 3HRHA 2DHCA 3TRDA 1VJ5A 2JGJA 2WHRA 3GBSA 1ZIXA 2VT7A 4MEBA 4GW3A 4Q05A 1CVLA 2JGLA 2H7YA 5EHXA 3WWEA 3I6ZA 4MEAA 2PSEA 5C8XA 5AK3A 1ZICA 5CT4A 4KE6A 5YASA 2XE4A 4YX9A 2XB6A 2ZYRA 2XMCA 3N2ZB 1KU0A 3I6YA 2BUCA 3DOHA 5K3CA 2WSLA 1VA5A 4LXIA 4X92A 1OCEA 3HSSA 2P8SA 4X00A 1G42A 2WM2A 4DNOA 2PUHA 5FV4A 5JAUA 3AIMA 3E0XA 4I19A 1BN7A 1YB6A 1QIEA 1AX9A 3BL8A 3WL7A 2Y1KA 4NMWA 3BF8A 2GBFA 2ZYHA 5I9IA 4Y2JA 2CKMA 2VJBA 4U2FA 2OG1A 3WWDA 5C8ZA 4CIAA 1NU8A 4G4GA 3BIXA 1DTEA 1RP1A 3RK4A 4Q3KA 2PVSA 1QTRA 4G4IA 3QITA 4P93A 3LIIA 1ORVA 1BROA 4KEAA 4H77A 3IURA 4BB0A 1EDDA 4D9JA 4UHCA 4MWSA 4BCBA 3F67A 1EHYA 1H2XA 4OPMA 1EB8A 2FJPA 2X76A 1H2ZA 4KACA 4ZRDA 2VF2A 2IX9A 1MO2A 3FYUB 1YS1X 4W1RA 1EX9A 2QZPA 3G9XA 4QDOA 2LIPA 4KAJA 4WY8A 1N5RA 1CUCA 4Y2PA 5E4YA 5AICA 3C6XA 1XROA 3FYTA 5JZSA 4DMHA 1E8MA 3FSGA 3O4IA 2CEKA 2J3QA 4U2DA 5T4FA 5CXUA 4K5QA 1C7JA 4DNFA 3AJAA 4FDMA 5CT8A 4LIPD 3UMJA 1PV1A 1EINA 3OC0A 1CPYA 2O7RA 1UKBA 2HA0A 3QM1A 3I6MA 2PL5A 4AMYA 2PU5A 1EXWA 2QJRA 5AI9A 2DCMA 1BN6A 3MUNA 1EDBA 3B3QA 1LPAB 5ALJA 4B83A 4RNCA 2PUJA 4M0EA 4ZI5A 5T4BA 4QZVA 1QONA 5DYYA 1EDEA 2XUAA 2JF0A 1EI9A 2CZQA 3CCCA 1N5MA 2ACEA 4X6YA 1ISPA 4AO8A 2VA9A 1XZIA 1MT3A 3H17A 5BWCA 3D0KA 4FBLA 4UBNA 5IVKA 3QVMA 1F0NA 4P08A 2HA2A 4G5XA 4Y2RA 4U2GA 5A71A 3WK6A 4IO0A 1L7RA 5ALIA 1CUVA 2DHDA 5HF6A 1GPKA 4EY5A 2VT6A 4A16A 3DOIA 2B61A 4PSUA 1ZI6A 4K6GA 3C6BA 5E2IA 5AM5A 1E3QA 5D3ZA 4OUKX 2RONA 3NWOA 4UBIA 3L1HA 3PI6A 4QWWA 4L0CA 4RE6A 5CBKA 3PF9A 4X3CA 3PDCA 2OQVA 1CQZA 3FLAA 4B81A 3V9AA 1QIMA 3WL6A 5CT5A 3WYDA 4QLAA 1HQDA 5HZGA 4H7KA 4BCDA 4BZZA 2QUBA 1QFMA 4E15A 3ZWQA 1E8DA 5LKRA 2XQIA 1A8SA 3R41A 3AZQA 3OOSA 3A70A 1JFRA 2OCLA 3WQHA 1HPLA 3I2JA 4L3WA 2FX5A 1XRPA 4GLBA 1JJFA 3QMWA 3W05A 3MVEA 4G8DA 3VXKA 3ZPXA 3KOOA 3H2GA 3PE6A 1QO7A 1QIJA 1LLFA 3M83A 1IUNA 3NGMA 4BE9A 3U1TA 4BRSA 1Q84A 4MXDA 1CFJA 3EQ7A 4BAUA 5AKEA 1DWPA 2DR0A 2ONCA 2OCKA 3EQ9A 5LZ2A 3V1KA 5ALUA 2W6CX 2QXTA 2XLBA 2YH2A 1W52X 4W1SA 5A62A 3WA6A 1XQWA 4Y2UA 2ZJFA 4UPDA 1FFDA 2Z3WA 2PPLA 4A23A 1TIBA 4OYYA 1LPOA 3I2KA 1T4MA 4N8SA 4BE4A 5EHNA 3G8YA 4WCVA 3V1LA 5EFZA 3RM3A 5HKBA 2WJ4A 2DFPA 4LHEA 2XUKA 3N0TA 3T4UA 3ED1A 4UBMA 5A7GA 5DTIA 5ALFA 3TEJA 1MAAA 5JD4A 5J3JA 2R11A 4ZV9A 1QFSA 3KWJA 1DX4A 1JMKC 2J3DA 1GQSA 1SCKA 5JARA 4XJVA 3GROA 3FYUC 4HZGA 1Q0RA 2BUAA 4U2CA 1R1DA 4EY7A 3W9BA 2XQKA 4BAZA 4X97A 1LBSA 1FFEA 3OG9A 3AZOA 2WQZA 4DLNA 4B9EA 6YASA 4XX1A 4LKOA 2RHWA 3LS2A 3WK9A 2CMFA 3QH4A 2C58A 5T4EA 4N5IX 5LZ8A 3E4DA 1T2NA 1XLVA 5AK4A 4X94A 1TAHA 4XVCA 5DLPA 5FPQA 4IH1A 1MNQA 1QJ4A 1LBTA 4H7DA 5LZ4A 1XZDA 1XRQA 4AB1A 4QDXA 3RLIA 2HDWA 4P9NA 4B6GA 2RAUA 5ALKA 2HRQA 4DSAA 1QIHA 5ALVA 1P0PA 4F5ZA 3FNBA 3WI7A 4DNPA 4IH9A 5AH0A 5JADA 1GPLA 2GYUA 2X5XA 1GKKA 2R8BA 1QLWA 4OB8A 3CCBA 3EBLA 1XQYA 5FUMA 3VKFA 2Y2VA 2XI4A 3P2MA 5AM4A 2G63A 3D7RA 2WIKA 2HU7A 1CQWA 5AK6A 3WK5A 2EEPA 4Y2SA 1ZI8A 3FCYA 4PV7A 4WFKA 4A5SA 5DWDA 4G9GA 5AJHA 1EK2A 3WJ1A 2C5GA 3BJRA 3HEAA 2OGTA 1DWQA 1TQHA 1ZGBA 4CCYB 3ZLUA 4BP9A 4X91A 3F98A 4BTLA 5HQ3B 1GGVA 4C88A 4FTWA 1MNAA 3DQZA 2D5LA 1VE6A 5HCUA 1UOQA 2PSHA 1ACJA 2WFMA 4LXGA 2XMGA 1K63A 1J07A 5CH3A 1E89A 3H2JA 5A6VA 4EHBA 2V9ZA 3C70A 5FP0A 4HRXA 4Y2QA 4GECA 4EY4A 1UK8A 3G9UA 3EF3A 4HXEB 2WHQA 4IH4A 1ODCA 4KAFA 5AI4A 2E3JA 5SYNA 3PFCA 1EH5A 3PUIA 1ZJ5A 2J4FA 4FMPA 4N8EA 5FKJA 4K6KA 5JAHA 5JAPA 2QTBA 4BVKA 5K3EA 1W1IA 1CUHA 1DWOA 2YXPX 3WJ2A 2GBGA 2QS9A 1X2BA 4LXHA 1J1IA 4P92A 3WKCA 3G9ZA 1DT5A 5D3KA 2WU3A 2QVBA 5K3FB 4BVLA 1R9MA 1GPNA 2BGRA 3DL7A 3PICA 2ZVDA 1E66A 1IVYA 5AM1A 3WZMA 1UOPA 4JNCA 5ALPA 3VJMA 5JD5A 1E8NA 3KWFA 3FLBA 1YR2A 3M81A 3JW8A 5AP9A 5ALLA 3LP5A 4H18A 3EIOA 1ZD3A 1C4XA 4PSCA 3BE8A 1Y7IA 3NUZA 1U4NA 1AKNA 1ZD4A 1QIFA 3DCNA 5DTJA 1XZAA 4DMCA 3VJLA 3GFFA 4FKBA 5DYTA 4ETWA 2CJPA 4HXFB 3H0CA 1CUBA 3GA7A 1WM1A 4DM7A 1X70A 2PU7A 1XKLA 2Y6VA 2QR5A 1DQYA 2VEOA 1UKAA 3YASA 4JH0A 2DQYA 4KE8A 1A8QA 2H9YA 5KWIA 5AI6A 2I3DA 4O08A 5HF8A 3NOXA 2QRUA 3BDIA 3OURA 5AK5A 2PM8A 3A2MA 1BCRA 3F96A 3O4JA 3O95A 2VQ6A 3UUFA 1HDEA 3D59A 1CIJA 2DSNA 1GT6A 2HFJA 4GEGA 2WIDA 2X8BA 3VVMA 4QDUA 1HBJA 1H22A 3FAKA 5AM3A 5K3FA 2PSJA 5KREA 3SWWA 4J03A 1F8UA 4EZIA 4FLEA 4L9AA 3ESDA 4TGLA 1Y7HA 1R3DA 1XRNA 3E3AA 4OYLA 2Z5GA 4DMKA 3F9CA 4UFNA 4EA6A 1CR6A 2IIVA 4UFOA 5IVHA 5AKGA 1LNSA 4C87A 1W75A 2WIJA 4KJXA 3R3UA 4BVJA 3D5EA 5CMLA 3CN7A 5EIAA 4FNMA 1VXRA 4IQ4A 4BRZA 2O2GA 1AURA 3ANTA 4C89A 2QKYA 1MX1A 4CI9A 2HA7A 5AI8A 1VOTA 3L1IA 3ILSA 2XMQA 4QEKA 3QMVA 5CTAA 2GBCA 3EQ8A 2XUGA 4XIIA 3WMRA 2OXEA 5JASA 2ORYA 1YCDA 2JBWA 3AIKA 3BJMA 3O0DA 4F21A 5A7HA 1CUSA 2XMDA 3WWCA 3DEAA 1ODTC 3WKAA 1LPBB 2WUEA 3R3ZA 5ALYA 1CUJA 1GZ7A 2HIHA 2OAEA 4N8DA 4X90A 5AKXA 1VE7A 1WPXA 2NW6A 1JKMA 4CCWA 4GXNA 3QBJA 2K2QB 2C5FA 4KE7A
chains in the Genus database with same CATH superfamily
5BSVA 1MIOA 1AMOA 3O9ZA 5G4KB 3PJRA 1Q5PA 1GU7A 2QTCA 3T1HB 1RYMA 4LY9A 4FX5A 1LY1A 4OBBA 4B84A 4CHGA 4OLJA 5GVSA 4DY6A 4U5QA 3WKBA 3S1AA 3ORSA 1WB4A 2R8XA 1BE0A 2XECA 1ZM9A 5AW0A 1NYLA 2UZ0A 1OXUA 4NEHB 3ZHZA 4EBBA 3BMXA 3B2QA 2ZTVA 4RESA 2NYUA 1JF8A 2HXGA 2AWOA 4FZ3A 3DUWA 3GPLA 3WO1A 2VUIB 1GAXA 4RS4A 1PGPA 5PNTA 4GS5A 1Z8DA 5JATA 5HF5A 2DMRA 3BKWA 4TVKA 4XFDA 1FJXA 4RMIA 2LCQA 3VMMA 4ZDKA 3ANXA 3ZY6A 4DF3A 3HXTA 5EHQA 1PQYA 1PEAA 2DH6A 3CE9A 3HUUA 3L7DA 1E2MA 1MJFA 4LV8B 2C1ZA 3WNVA 2CMGA 4HZUB 4URZR 3V1YA 3V7FA 4B6FA 5BN3A 3AX6A 1UKCA 3UJ6A 1ZM2A 5CPBA 1NMQA 5CLIA 1E5TA 5KIAA 2OLJA 1Q83A 4ZD6A 4HVAA 4PGGA 3R3YA 3T0IA 1C8LA 3G2PA 4OGFA 3OC6A 4CM8B 3C7TA 5F7ZA 4NP6A 3U3DA 1AQLA 3I3OA 1SBHA 5L8VA 1V5EA 3ZHRA 1RFGE 2FJUA 3VSAA 1N9KA 1MABB 2RC6A 4DXHA 1UMBB 3D3NA 3NDJA 1PT5A 4MH0R 3QNUA 3HI6A 4S2UA 3ZOKA 5HE9A 4DSUA 3DH0A 2HCBA 3FWHA 2OD7A 1Y7LA 1GTZA 5HJ2A 4E4TA 1PVDA 4JLKA 3V6MA 5BMOA 2HLHA 1Z4KA 4D0GA 4IV5A 3N2GB 3KXIA 4MHOA 3GZJA 4KRFA 3OT5A 3IUPA 2C92A 1U3CA 3PQCA 1USGA 3ITEA 4WACA 2OD2A 3MSXA 5JNSA 5JNLA 1NNI1 3M4YA 2ORIA 3DGEC 3X1MA 4B74A 1JZSA 2E18A 4FW8A 5JSFA 1N7IA 2OZVA 5DULA 3F73A 1R4MB 1TLFA 3MZ0A 3G49A 4ZT6A 2HD4A 4MR9B 3AEKA 3BH6A 3K4HA 3L0OA 4HNRA 4MV8A 2FPUA 4JX8A 5AKIA 2LGJA 2QU7A 3BCUA 2O8VA 4Z0TA 4DV2B 2XGSA 4GE0A 2PHZA 2I2BA 2X5JO 3H9GA 3OAAD 4GUDA 4ZYYA 4U7DA 4XGQA 3IH5A 2JIZA 2G76A 2AFIE 1N0WA 4AVYA 2V59A 4JEUA 1GGMA 1PDVA 1OIWA 2P9JA 1C5KA 4Q4DA 4CL2A 5CBPA 1QB8A 1W8DA 5IG2A 4JR2A 5JSKA 5P8WA 4HO1X 2OMEA 2VXOA 4JLSA 5TEWA 3UXEA 1EVJA 3O1IC 1M66A 1PKXA 4B6RA 1EBUA 2WABA 4E14A 4COKA 1VZ3A 1I5RA 2CFIA 1SUFA 3OE4A 4FYXA 1SPBS 1WSWA 2E9SA 1T0HB 5IN5A 4DTCA 3LYHA 2BEVA 1A77A 1RAAA 5DCLA 3UJCA 2D54A 4FDVA 1SN7A 3CKLA 2I8CA 2G09A 3CZCA 4PFQA 1DG1G 1SVKA 3MMXA 1ILWA 4LBZA 4MTCA 3DMRA 3DYVA 3LQ1A 1DEKA 1NATA 4HPWA 1XNGA 4Q3DA 2FKNA 4QUDA 4MGHA 4EKIA 2JLSA 3B3FA 3N2KA 1PO7A 1T5HX 1XCPA 3N0WA 3O82A 3P9SA 3QF7A 4Q18A 5DN6D 1QG6A 3TSWA 4KHPB 4LRTB 2ZT8A 2R25B 3V8NA 1I8TA 1IJFA 4YCMA 3H9BA 3C3BA 3D6MA 5BV2P 2P9HA 1REQB 1PTJC 1KH3A 3VGPA 3N7UA 3ZV5A 2VSNA 1ZNWA 2IHJA 2NYVA 2VDLB 5FL3A 5T4HA 4M0FA 5CNKA 4CMKA 4CR6A 3HJUA 1BE6A 4PQFA 3U31A 1V2GA 3V4FA 2YJ5A 1P0FA 1E64A 4CLXA 4UXIA 4K1LA 5F1PA 3G2NA 4H3HB 5CT9A 1GRCA 2BAGA 4NYIR 4GX1A 5AHOA 4XWGA 4GMGA 1DC7A 1V7QA 4J94A 5H9VA 4IIGA 3FROA 1GUAA 3QVVA 4HHEA 3N0RA 3L4BC 3PNBA 1TUBB 1NYQA 3DPIA 3FMVA 4L15A 4YJDA 2OHVA 3KNZA 3W2IA 3DDZX 4RIGA 4YRTA 1R9NA 1YHZA 3QPCA 4ZOLB 2B98A 3K73O 4XGNA 3G5TA 4K9NA 4HVCA 3A9CA 3JQPA 2HF8A 2GDJA 3PQFA 5JVDB 3ELYA 4FLFA 2WMYA 1O3YA 2FPWA 3W2EA 3NT2A 1NR5A 4FFVA 5DP1A 1QYVA 3IP3A 1MQ9A 1KVQA 3LCUA 3RWMB 4RULA 1L4UA 2N1BA 1FP4A 1U5BB 4RM3A 1L6RA 1U7WA 1NG9A 4E5PA 1GV1A 2IYXA 1U0SY 1GU1A 5IFKA 2FMHA 3AXTA 3SOPA 1KFCB 1Z45A 3GRFA 1YQGA 4XE5A 1DC8A 2CUKA 5E6RB 5ELLA 3VHQA 1MMFB 2TRSB 1QG0A 2ZI5A 1O08A 3AERB 4C01A 3B1ZA 3OPYA 1N1EA 1TEHA 2A0YA 1FSPA 3JASB 4GI2A 3GR6A 2JK1A 2F1IA 4PEVA 4KO1S 4QPCA 1EFCA 3ESXA 4Z53A 4OD0A 4QUGA 5JPDA 4DM4A 3NU1A 4QARA 1X1AA 2BP7A 2SCUB 2WWXA 4Q1BA 1RI4A 4CV1A 2GXSA 4OLBA 1N2CB 1WDMA 5AKYA 3M5PA 2YWGA 1RHRA 1ZH2A 5ED4A 1ENPA 1NFQA 2C7BA 1FYXA 4OHKA 4DLXA 1B43A 1G20B 5ARDA 2VIIA 3CUKA 3MT8A 4L7VA 2QVLA 3BGOS 4M1KA 5KJFA 3A2LA 4U8HA 3COJA 1FBTA 3H42B 4TLAA 4W1QA 3VC7A 4D45A 4OJMX 2BWJA 1CNEA 1M1XB 1G7RA 3TSOA 3W8NA 4Y7DA 5A9SA 2RIPA 1DOZA 4FHFA 4HUTA 3E5NA 4KFTA 5JYBA 1PZGA 2R7KA 4V38A 3KQYA 4WKBA 4Q6WA 4LYFA 3WL8A 1V0JA 1I1QB 4DT1A 3V97A 2BE7A 2BFBA 4L0QA 4AZVA 4GC5A 4UTVA 2R1TA 3HCNA 4PZUA 3AYZB 4RPLA 3QG5A 4AJHA 1K6IA 1YB1A 2HBYA 3R23A 5T8KC 4V0LA 3F9RA 1JR3D 4YV1A 2Z4TA 4ZYUA 1IZZA 2JFXA 1A4UA 4EQZA 3CTMA 4L7QA 4J7UA 2RGNC 1FRVA 2B8EA 4D02A 5CLFA 4BUCA 2FVXA 4MDFA 1CF9A 3E9EA 3OTQA 3D1LA 5DE3A 4AKGA 1SAYA 1JQLB 4L6IA 1ITZA 3VH1A 1WCIA 3M6UA 1JX6A 2XDWA 4IL5A 5F2OA 4RVDA 4FYIA 4CV0A 3FIJA 1HORA 4NV0A 2H4YA 5ESRA 2QA5A 3NBQA 1R8XA 5AOVA 3WQQA 2IOQA 2C95A 2ODWA 3KOMA 3PQ5A 4LZWA 4NMXB 3ABZA 4DIDA 4TXJA 4ZQIA 2M6SA 1EJ6A 2I3ZA 3ICOA 1I4EB 1NXPA 2HWXA 5LMCA 5F52A 4DV6B 4XB6B 4EBFA 2YHIB 4P38A 3TJZA 2R3SA 4C6RA 2HYIC 4ARAA 5JS8A 4KSCA 1G6OA 4QQNA 4NYJR 3PDHA 5GONF 1KEWA 1BE1A 2DUMA 4MIKA 1ZM4A 4I2NA 3QELB 4DEVA 4TMKA 3LAWA 1MX5A 3QKWA 3KB1A 1MD9A 1NBME 3CLUC 1MEOA 1T0IA 5DBHX 1E2JA 4X6UA 1KQPA 1QG2A 2IF0A 5KKNB 1XZJA 1T1GA 3DLTA 2DBZA 1JLKA 4KSBA 5JAMA 4JSTA 1J9EA 2NSDA 3OTHA 1PUIA 1N5KA 2PZMA 2WWRA 3L8EA 4KP7A 3GFOA 3PEEA 1HETA 3I4CA 4PHGA 5CM2Z 4FT4A 1PJAA 2IYEA 2OILA 4IDFA 3TNLA 1E1DA 3E1KA 3AEQB 2VPTA 1PF7E 4ZIRA 3OKAA 1VLMA 3B36A 3L6EA 4BB6A 4M1YA 2HU5A 3CZ9A 1LUAA 1E3WA 5B6PA 3BHIA 2RHDA 1NQOA 3ENZA 4ZVPA 4C2AA 1H23A 4J0QA 1ONPA 5TGTA 4WJLA 1Z4NA 1UXIA 2PEZA 4TWIA 1Z83A 2YVLA 5C5EA 3H5AA 3QFRA 3VZSA 1BFDA 1ODJA 2CBZA 2D0IA 2CEAA 1QVZA 3WY9A 3AUYA 5I47A 1OILA 3LECA 1A9OA 1SA0A 2RKBA 2X22A 4WXMA 5D7BA 5LWQA 2C83A 3JXEA 4PFJA 4QOJA 3KSRA 2I6UA 4JENA 4G4JA 5H7XA 1DJNA 2E5WA 2GCEA 4HEQA 2XUZA 3EDYA 2O8FB 2ZRKA 4XUGB 4M8IA 3I6BA 1OXKB 3OCJA 1J2UA 5HJEA 3ELWA 4JBHA 4UQLA 4C06A 3OAAA 4YJ3F 1LPSA 2W43A 1FLDA 2EKDA 1RWWA 5CB4B 3JVUA 3T1QA 3KKOA 4Q4CA 1RKVA 1Y1TA 1Z13A 3VOAA 4B4KA 5AIBA 2RJ3A 3ZZUA 4KXXA 1IUOA 3WAGA 1YRWA 1BVUA 3V8PA 5DLYA 3LT0A 2H11A 2LZ0A 3ZH9B 3O93A 3AR7A 1CUGA 3PHHA 2ZUVA 5DNEA 2WJPA 3UN1A 2CC2A 5LZ9A 5M5BA 1C0PA 2BSQA 3ADOA 1PV2A 3IAAA 4N4AA 1NZJA 3AUFA 3C5EA 4KYVA 4Q9HA 3WS7A 1CUYA 4LYHA 5EMLA 4FCTA 2UZIR 2GLTA 3TQTA 4NFSA 1E5DA 3TQSA 3ROQA 4OHYA 3DKPA 4TL6A 1CQIA 2QZ4A 4CIWA 1AA6A 4WHMA 1QB7A 2AF3C 3KPYA 3GT0A 3SQDA 4E31A 4KHZA 2BBWA 1CC1S 4B45A 2F8MA 4DRXB 4P33A 1JXOA 4G5HA 4BGDA 5AHXA 5KO2A 5C35A 4UHJA 2C4HA 3K0CA 3RHTA 3D8NA 2GCOB 1E3SA 1RXSA 1UM8A 2GJ8A 1CF2O 3E8XA 3HGTA 4PZCA 4A0GA 3LLSA 3G89A 1GPDG 4F9FA 1RDFA 3N75A 4UHEA 4E5VA 4FFMA 3U26A 2R1TB 1DBIA 2B83A 4KR2A 4KN6A 1W2WB 5JAIA 1ZJZA 3OWOA 4DBLE 3KC2A 3G8CA 2YUTA 3DP9A 3TNDA 4GSLA 4RWEA 2AFHB 221PA 1LZKA 1WZUA 4LMPA 1TA9A 1YOBA 2CBGA 1BO6A 2ZJOA 3HJHA 4TKVA 5JO0A 1KK0A 3H84A 5FRDA 3FYUA 1NR7A 3OPNA 1U7HA 5J2UA 1ECLA 3NTLA 3RKSA 4YJGB 5FWYA 4QBTA 5C8VA 3JYLA 3NP7A 1C7FA 4B0PA 1BEZA 2G88A 2QM7A 3I8OA 4CTMA 2OV4A 2WHYA 3GLSA 5ALRA 1AU9A 4AS3A 4WKNA 2JRCA 2VPXA 1UK6A 2PT5A 1SQSA 1Z6TA 3D5TA 3A3NA 4Q12A 2UYHA 2BFNA 3N53A 1KI6A 3SZLA 2IYOA 4MIEA 4PRYA 3UM9A 2W90A 3BL5A 1MHPA 5AKKA 4Y1FA 1U7ZA 2OHHA 2OKCA 2XRFA 3PCRB 5JXWA 1N0VC 1TF7A 4G24A 3NOOA 4N9WA 3SEQA 3AVUA 5CYFA 1ZJWA 2VZ8A 1WMDA 4Z4CA 3QSGA 4IDQA 4ENVA 5A3VA 1VFNA 1QLJA 2GEDA 3PXCX 4MWOA 3ZZTA 1UC5B 2I6TA 1WW8A 2X86A 5AVQA 1Y1QA 3HBLA 5L3QA 5JMTA 1OBVA 2YNMA 1HUQA 4UHKA 1T2VA 1AHIA 3DLAA 3ONFA 4RF2A 3NHAA 1W0KD 4J76A 2QRLA 4LWQA 3V6LA 2WP0A 3JALB 4JUBA 2PNFA 3TUJC 2WHPB 3FOBA 4EA9A 2N1MA 5FWXA 4F5YA 2J31A 4J0IA 2P4HX 4EZBA 4QA9A 3T4XA 5LNK6 3DOUA 3IBSA 3MQ2A 1E3WB 2C1XA 4AUMA 5GINE 3FPKA 4YIKA 1MABA 3GHHA 1BMQA 1D8AA 1FY2A 3KR2A 1GZUA 3DEHA 3IEIA 2GCGA 2JKYA 2OAQ1 3QUTA 4IDBA 3QLUA 2X0JA 2Y71A 5EZ6B 4BPRA 1E9RA 2ID4A 3THOA 4BN0A 3RSSA 4N76A 2AHRA 4Z1MD 2WIGA 1Y6JA 1JXAA 5AVWA 1KSJA 3MT9A 5JAQA 1IHOA 1AIPA 5CFQA 4N6OA 3P9QA 4BX9A 4DJFC 1RLJA 4XASA 4KG7A 4WV3A 6REQA 3U7FB 2IH4A 1G41A 4MUKA 1ZH0A 1VL0A 2H1VA 5CA0B 1R5JA 2OV3A 1WEHA 1YHYA 4ECAA 4D0RA 1LC0A 5ETJA 1T9HA 2V74B 5I7HA 1WXEA 2L42A 2F7SA 2G6BA 3LD9A 4G0QA 1VTKA 4MUGA 2REQB 4RKEA 5CDFE 1IBMB 1V9LA 1OXTA 1YSCA 5IAJA 2B4AA 4UPEA 4RTPA 5FB3A 1XTIA 4IJ5A 4LF5B 2VI5A 4C5AA 1GVNB 3Q0TA 4XIFA 4XB2A 1VYHA 2YYSA 2BM0A 2XH8A 2B37A 1YJBA 3QVJA 2XUJA 2NMVA 2JHAA 1IPEA 2IZ5A 4AD8A 4AZ0B 4BQRA 4FWBA 3STWA 2ZUWA 4PZ0A 2DPHA 1AY0A 2GESA 1ZL0A 1J1UA 1O77A 5CPFA 3TLJA 4D9HA 1IQRA 1W0KA 3JVEA 1HTBA 2OFPA 4JYMA 4PYOA 3S0JA 4DR1B 2QVYX 2B4YA 4CIVA 3KHTA 1W4LA 4M1OA 1AZWA 2ORVA 2FYTA 2G36A 3C3CA 1W0JD 4RU1A 5ULLA 4XD2A 4RHTA 4OVKA 4CT0A 1GFZA 4OQXA 1DBWA 1J97A 3VO8A 1G0OA 3FPEA 4OP1A 6Q21A 2WAYA 3L7CA 2I2XB 3GZNB 3ZD8A 1EUDB 5KBYA 3D81A 1FRQA 3OTGA 1SOAA 2Q1SA 5FQOA 4ESOA 6CHYA 3EWNA 3CNQS 3WLQA 3ZDDA 5EWJA 1PZFA 4X65B 3I9KA 1HEYA 2FPIA 3GJ3A 1UC8A 1D6NA 4A6PA 2FWPA 2A0UA 3NC0C 3ASUA 5DNWA 3K70D 1LK5A 5AVVA 3UXYA 4DLPA 3W8FA 3AT1A 2MR5A 4A8HA 1THMA 2Z98A 2VATA 2G1JA 3BIWA 4W9NC 1DAOA 1WU8A 4QOSA 4WNYA 3X1WA 3KCQA 2WTMA 3PHCA 2ZYUX 3L7NA 3H1GA 3VJKA 5HTOA 2IY8A 1SU6A 2O7NA 5CAEB 1HDYA 4NZOA 2XUPA 4EJ6A 5G0TA 3IDQA 4IXMA 4TSFA 5K3BA 1TPZA 1KJNA 3I0MA 3LCRA 4BDTA 3BFJA 3IP5A 3UAGA 1RQLA 2QRGA 4CF6A 1XTRA 4DR6B 3K1TA 4C7XA 2I33A 3UK7A 3L7IA 3U0VA 4A0QA 1JYEA 3DVLA 2BL4A 2FR8A 1NJ5A 1PZNA 1TK9A 1XQXA 3OEHA 1O6FA 2C31A 1QTNA 1MB2A 5CEJA 5IHXA 4PPYA 1CJSA 4G6ZA 1H3EA 4CLOB 3TQIA 1V5FA 2COKA 3GEDA 3I5YA 2GN6A 2GZHA 4Y0AA 1M0EA 3LX4A 2ATIA 5G1PA 1K4YA 2Q49A 2CJWA 1ZISA 4YO8A 1EMDA 3OFSA 3QNWA 4Y9SA 5CK4A 3EVAA 5F64A 4B3DA 4DHEA 2JLYA 4DABA 2YJ3A 1C9EA 1E63A 4F5DA 5KTNA 4HVTA 4F3TA 2CNKA 1E58A 2CF6A 1CB0A 1KF0A 2BH9A 3A7DA 3IIEA 3QU2A 4S2EA 1OX4B 1MFZA 5AIAA 4X71A 1NL3A 1PP4A 3PC8C 1ML3A 3PVSA 3OU6A 4KH0A 4WLNA 1KVTA 4D4IA 3O2SB 1P0CA 2XW6A 2WPDA 2Z6UA 1CHDA 2P27A 5F2EA 3WBBA 5EGNA 1S2LA 1DRWA 4H7JA 3LLCA 3RSLA 3CSUA 1BW9B 5BWOA 4RJKA 4TPKA 3A28A 1I3KA 4RD3A 4TQAA 4DSTA 4WXEA 5CDUA 4NF2A 4XXHA 1OLUA 4AJ1A 1UF9A 2D1QA 4ZVVA 1JR3E 1RPAA 2BKLA 1WSDA 1VBNA 2GD2A 2EWMA 3ONDA 3RFXA 3A9WA 1ZRMA 5LJLA 4MQBA 5ALEA 3HGQA 4RD1A 1NONA 1NN1A 1CRPA 4JDPA 4BEWA 1UDRA 1V37A 1VMIA 1NTRA 2C0QA 3CO5A 3PHLA 3Q12A 1Z5WA 4Z0PA 1PGJA 3TRIA 1AC5A 1LPPA 3K96A 2P4UA 1AZLA 2FUKA 2C5AA 2EATA 3AKCA 3RVDA 1ZOIA 4OHFA 3WK4A 3D6HA 3TYXA 4O0LA 4XYGA 5J1TB 1YVUA 5BN4B 4GDMA 1TEXA 1YMUA 2XQGA 4RY2A 4K0KB 2XUDA 2ZBVA 4OXXA 2XYQA 3DTVA 2X7HA 2YXLA 2HA4A 4ZGBA 1C30A 1SXHA 3NUGA 1GG9A 4CV2A 1W29A 4A2WA 3PNOA 4ZO9A 3C3PA 1QDEA 4EEKA 1EDZA 2IPXA 3TJMA 1UK7A 3K35A 4C07A 2ZYIA 1GUZA 4AWAA 3IB3A 2NX2A 2JZCA 2I8LA 1L4FA 3G0GA 4M38A 2X9QA 3FIUA 1J1ZA 1MRSA 1SOWA 4CKEB 4N41A 1WXQA 3H7AA 2XMBA 4URVR 4IV0A 3O8LA 3GLGE 1K6EA 3VU3A 4MPPA 2IUTA 3WIVA 4CG3A 4ZI7B 4KR7A 1HDCA 2FEXA 3GRVA 4J0FA 2GNAA 5K3SA 2GX6A 2ZJ6A 1P2BA 5A9SB 2NP6A 1V4VA 4HB2A 3WP0A 3WK8A 4QUEA 4AZ0A 2QM3A 5TMPA 4NFYA 1U7TA 3LPCA 1DUIA 1QOZA 3WJ7A 2O9JA 4IEFB 2KMLA 2O8NA 1YB2A 2GZRA 5ALDA 2PUTA 2WU4A 5ICEA 4Z1OA 3W7AA 3VU1A 3HLTA 1N6IA 4UZSA 3ZJTA 3Q87B 2IYUA 2XTJA 3JSXA 1BCRB 2RHRA 3JQ6A 3TKYA 3H19A 4H35A 3KUUA 1CRZA 2AN1A 2FEPA 1KI1A 3FMIA 4RX1A 5AJWA 5DNUA 1NAIA 2X1MA 4QYWA 5CW2A 2Q1UA 3HB1A 1NBAA 2B82A 1QJCA 4HQKA 1E9VA 1XT6A 4KN5A 1XXLA 4O4HF 4L50A 3LNCA 4M99A 4MSUA 1JIJA 4Y6LA 4EHLA 1A4IA 1CUFA 1UKYA 3FTCA 2ZE8A 3AFGA 3HA3A 1M73E 1XZMA 2FPIB 1XZCA 4NCKA 1MV5A 1E5LA 2IF2A 5CW1A 3WYBA 2JI6A 1P9NA 3LUAA 2LW7A 4TTJA 5CP8A 2WTEA 4LRXA 1U2TA 3HM2A 5JG7A 5HKOA 5HQ3A 1J09A 2P9YA 2QRJA 3W7VA 4YCCA 1G9XA 1WB6A 2UUPA 4NVRA 5IAOA 1WNFA 1TMKA 2AC4A 1KMHA 121PA 4OBEA 3H13A 4QNMA 2OZLA 3OM8A 1RC0A 2ZYSA 4X7MA 4RZ2A 8ABPA 1NXTA 2ZWIA 1AA9A 1I51A 2XZDA 4QL3A 2VYVD 3H4TA 5IJAA 5CFNA 3G2QA 2ZJ5A 4YRBA 5IJ9A 5BUSA 2WNHA 1DQZA 3DXXA 3RRMA 3GJQA 3HXKA 4CW7A 3HP4A 4WVFA 3UK0A 4A9AA 2B5WA 2GARA 4ALNA 1VIYA 2NZYA 1WS6A 3FA2A 4KDCA 3KAPA 3P71T 2FZ5A 2X0RA 5H3CA 4EO9A 2YWEA 1NKVA 2PBZA 1XZEA 4IHJF 3C1OA 1XFDA 5A6SA 5D8DA 1Q1EA 1RU3A 1VI2A 3HNOA 5I7FA 3FNFA 2E89A 1UQUA 2V65A 1E2FA 2QGZA 4MV4A 5K0SA 3RNOA 3WTBA 2LIVA 1UH5A 1VLLA 1HM5A 3JV7A 3T1VA 1ADBA 1F9AA 3F5QA 3K2EA 4IG4A 4M9UA 4LJRA 3PJDA 1T5TA 4OIFA 4RDIA 4LGVA 1JR4A 2WWGA 3IQGX 1R4ZA 3BRWA 3E5MA 5EEGA 1CIVA 2HWKA 2Y9MB 2P8JA 1U28C 3WYNA 4QJ4A 3NETA 3FZYA 1D4ZA 4I46A 1RMYA 3F5SA 1QO0A 4CCAA 4Z99A 2IYFA 4BAGA 1P2FA 2RHBA 3FKQA 4RY9A 3P4UA 5GM1A 1GUBA 2OZKA 5A4FS 2DR2A 3DBLA 2OGSA 4DMUB 2WC1A 3GRUA 3DPSA 3D3JA 4KR0A 5D5QA 1NVKA 4IIBA 2FLVA 4WMLA 2ES4A 3W4KA 3UJHA 5EIEA 3TG2A 1I94B 1ZHOA 4UFPA 3GEPA 1KS2A 2I65A 3LFUA 4HD8A 3H18A 1BU8A 1H2EA 3L5KA 2GETA 3OECA 1N75A 2IH5A 2VYVA 4WCFA 3E27A 3R74A 4BMVA 3FVRA 1POWA 4PZ9A 2X4LA 1IJKA 1I10A 2C20A 2BF4A 2BZSA 4QOGA 4RK5A 2UKDA 2C04A 5DZSA 2EARA 3C6YA 4F86A 1BXZA 2QAGA 3UPUA 4BZPA 4BVAA 5A4AA 3ZK9A 2G6TA 3FCCA 4ZMRA 4EB0A 3B1YA 3CMMA 1DRKA 1K8RA 5EYPA 2DWPA 4D6XA 1O6GA 3VZBA 3K7EA 3Q7QA 4M89A 1ZRHA 4ITVA 4V2IA 5B2ZA 4YHHB 1YBFA 2QTMA 2ZDHA 3A31A 2EJUA 2I99A 1JWBB 4BMZA 4P36A 4K05A 1XMVA 3B5EA 3BHMA 4J16C 4UBOA 1DBRA 1KAGA 1DAFA 2V7PA 2CYBA 3IT0A 3Q88A 2JAPA 4PAOA 3DXYA 3LQ4A 3PXXA 2ZI9A 4LDPA 1S2OA 4DYVA 2JFWA 3VKUA 3HU5A 1Z0FA 3ZX5A 2XNDD 1T2CA 3ZVRA 3MXOA 4BKOA 2G5PA 4H6WA 4H6XA 2HADA 3ZVLA 3KPVA 3C87A 3IT3A 4L2IB 3NYWA 2JFOA 4LVUA 3MXTA 3HJGA 2VKTA 4GGMX 4IDOA 5ARCA 3ZHTA 1GEEA 2PMKA 3D7KA 4WN9A 4ZARA 2Q3EA 2VHEA 4ZI3A 5JCOA 5C4IA 2AGVA 3ZU6A 4RK0A 4X41A 1K7EB 3IKTA 3DZHA 3LCMA 4IICA 5T41A 3ZWXA 3JARA 4DDWA 5BNZA 3PA8A 5BRNA 3AUAA 3B9BA 4IIUA 4MPDA 1IBSA 4OUDB 1U8EA 1WWKA 1JHAA 4K2AA 1DKNA 4R2LA 4R16A 3KLNA 4JWKA 4ROSA 5CLQA 4ZJYA 1TT7A 2FW9A 4IUCS 3GBPA 4IHJB 4DYHA 4OI0A 4FHCA 4GWGA 1DTWB 1U28A 2K4MA 4K9LA 4QUKA 4PX9A 1KZ4A 3LVRE 4TKVB 2HY7A 3H5IA 5IZ4A 1OROA 1UDWA 3EG5A 1IOLA 3P4YA 2MYTA 5TLSA 1E1QD 1XZQA 4GP9A 3WIEA 4XDHA 2YWDA 2E6UX 2JEZA 3JQAD 4HK4A 2YASA 2QM0A 1V8DA 2R9VA 4UXJA 3FWKA 1HDOA 3MIIA 3Q0IA 3ELBA 3JQEA 4LVCA 4OFWA 2PKXA 3ROGA 5IN4A 3HO8A 1GKLA 3G0IA 3ZI7A 3ER9A 4NEQA 5CM9C 1DL5A 4US1R 1VHLA 1V3UA 3MJDA 1N2IA 5D6NA 2ZIGA 1E3DA 3P19A 2QW8A 1BS9A 3R3WA 5BVHA 4YT8A 3NZEA 4Z9FA 3BTVA 3QVKA 4OMCA 1SKQA 3HZZA 4G5YA 4MO2A 1S3GA 4DR5B 3ZNPA 4XM0A 4TWJA 2P7HA 3BBPA 1FJHA 4PYMA 3RPEA 4JHXA 2FZVA 2J5BA 1IOWA 2CLLB 4K9OA 4ZYZA 1JH9A 2DKOA 3ESYA 3GOHA 3D3EA 5EN4A 5IZCA 3EGIA 4F4FA 5FO1A 4J16A 3SBDA 4YDSA 4RSMA 3WFJA 1O4VA 1TL7C 1QIGA 1WD5A 3OIVA 4OQQA 3PQ2A 4FDUA 3GDOA 2QD5A 4MR7B 1N1GA 3QUQA 1S4MA 3E5RA 1IQUA 4YPOA 1T8TA 1RBMA 1B0UA 2GVDC 5ERXA 2X0FA 5A4DA 1N8SA 3TZCA 5KMGA 1CJCA 2F90A 4RA9B 1GYPA 4OBWA 2I6SA 2VDRB 5C31A 3THSA 3U13A 1OZFA 1JFFB 2KQUA 2PS3A 3TW8A 2SKEA 3W8RA 2X6QA 1PVVA 2WFZA 4R8LA 3DR3A 2R0QC 4ER0A 3OWXA 4DDUA 4WZAB 1U99A 4I08A 3SU8A 5JNTA 4UBKA 5D2CA 4DWJA 2OFOA 2OK7A 4OSEA 5EIHA 5HS4A 2QM8A 2FZCA 2XKBA 4A8JC 1L9KA 3C7KA 3DEJA 2LDBA 3I28A 4C0SA 3AB7A 4HLUA 2G9RA 4TV9F 2H29A 4WZAE 2VA8A 3IBTA 1FXWF 1A8HA 1C4KA 1LQTA 2ZBFA 3CG0A 4URWR 1DG3A 1RXEA 2FPOA 2WDZA 1OWNA 3F8SA 2QI9F 3U4QA 4YUVA 3T5DA 5ES4B 3D6TB 3I32A 4MRNA 1RMTA 2FUG1 4Y9UA 1AH2A 5H3HA 3ET4A 2CHEA 1FFAA 2J59A 4KN8A 2O0JA 3PPYA 3I23A 4BX0A 4FYPA 3KV3O 3NCHA 1YZYA 4CDRA 2A3NA 4UDXX 4RKWA 1FPQA 4L27A 4AQ7A 1P1HA 3QPVA 5EXXA 4QBGB 1LSOA 3AUTA 4ENSA 3PFFA 5IPFA 3M9LA 3BJIC 3LP6A 5COAA 4DANA 4ZDIA 1B1AA 1M8GA 2A5LA 1F4PA 4LJ9A 3RU2A 4FC6A 4M0MA 2Z9DA 3RANA 3F7MA 3RIEA 3TBHA 3AUKA 1I30A 1P3Y1 3EVBA 2R44A 3IAS1 3BG5A 4HWKA 1WSBA 3MWDB 2BW0A 2QQFA 1DQPA 5BNFA 5HOQA 1UXKA 2PLRA 3OA0A 4CU5A 5KTTA 1WR8A 3BAFA 3TTTA 1ZUNA 2PH3A 4WLOA 5JSZA 3MA0A 2QROA 1GA6A 3FF1A 5K6AA 4UQOA 5IKXA 4QXAA 1E9CA 2D5AA 3QPAA 5CJJA 2JJMA 3Q3IA 2AG6A 2WSSA 4LDJA 3O8OB 2VUSA 2XMSA 3VNBA 3M6FA 2BR3A 1Q77A 1TUIA 3P2OA 4D0SA 1QGZA 1X80B 1H4VB 1U4SA 4NABA 3MUOA 4RV5A 2DX7A 3DC7A 3JARB 5I8ZA 1CJUC 1UWLA 3RYIA 4CRWB 2RGBA 1EAMA 2GFHA 2XNHA 3V8EA 4JJZA 5JAOA 1Y8ZA 3AM1A 1SC1A 2JIDA 4OHVA 1BXKA 4OUDA 3DZIA 4KQJA 3C3XA 2QLTA 1AT1A 1CTQA 2FN8A 4C4SA 3AHJA 1N5LA 2P0AA 3VZDA 1X9GA 2BE9A 1QK4A 4TMXA 3T3PB 1RI2A 3C6KA 3O8QA 3JQFC 2VHZA 4CEJB 2B69A 2G5CA 2C9MA 4HSEA 4P4SB 421PA 3CLTD 5IARA 1WPGA 1WHSB 1E7QA 3EEFA 3UG6A 3GN2A 5JS2A 5EQJB 1C0IA 4DCMA 2PLAA 2IDZA 2BT4A 1UBTS 2RIRA 1ISIA 1ULBA 1ZW1A 2ZAGA 3MJVA 2BFEB 2X9GA 3G9QA 4M86A 2F1HA 1MJ5A 5DLDA 3VR0A 4QDZA 3USZA 4BCCA 13PKA 3MS7A 2HT1A 4N0PA 4G0OA 2X0DA 4MVXA 3WRYC 4N0EA 2O23A 3NHKA 1O94D 3K2IA 5DASA 2NTEA 1L1QA 3KR9A 3DCJA 3WIBA 1SOUA 4AMZA 1ISHA 4MQ5A 3AB8A 4JB0A 1XQVA 3HMQA 3GQBA 2DAPA 1LV7A 2RGXA 1VKOA 4LEIA 2XUQA 3ZGOA 2W2NA 3RWBA 2HK8A 5C8YB 4G8CA 3EGDB 3COVA 3UBMA 2XJ9A 4NS4A 4Q39A 4HAVA 3HDQA 4YT2A 3EVTA 5BOSA 3TRKA 4TTQA 1XSEA 2ZVPX 2YRFA 1CWUA 4CDNA 2I2DA 2NAPA 1ZXLA 1ZU5A 2C2BA 2VOEA 4OJNA 2R8YA 3RUIA 1I2DA 3K9QO 3QP9A 5HA5A 2RKWA 1DZIA 3DOEA 4K46A 1A04A 1V7ZA 5JH7F 2BDEA 2ZKIA 4G01B 2H2DA 3LW7A 1YGYA 4K7JA 4P22A 4DA9A 1DQNA 3SC2A 1V11B 3W5JA 4EW1A 1N2GA 2PY6A 3WRXC 2C2YA 2IEAA 2IYPA 2WF5A 3UOGA 4AIIA 4D82A 5KDDA 3PC7A 4GI5A 1ZVJA 4JBYA 4Q7LA 5TY0A 1ZP6A 3FCXA 2J7KA 3PEFA 1JMVA 4OKNA 1P75A 2J0UA 2ATCA 4BFLA 1Y1LA 2OLEA 4F2PA 1GNRA 4ETMA 4I6JA 4CXMA 2F3SA 5KX5F 1Z4LA 5KSZA 2R65A 1PLKA 4FE3A 1WKCA 2W2OA 1QIKA 5LXTB 1GPYA 3O1HB 4Q02A 2HSWA 3U4QB 3NCTA 1CJKC 4BZQA 1EVKA 1CK4A 3EGCA 3CT6A 2AE1A 3GJXC 2Q3DA 1OIVA 3ZZ1A 1G2PA 1A5SB 3GT4A 3LKZA 4BJ1A 4QKQA 4YR7A 4ZHQB 4MR9A 1XK6A 3T41A 1YDEA 2A1UA 4OEHA 4D7AA 3WLAA 1RFLA 3ZHOA 3A6DA 4FN5A 5K2OA 3R9XA 3KQKA 4BC1A 1LDGA 1JG3A 1S4QA 2B4RO 1GXSA 3M4NA 2AEMA 2GF2A 4P7KA 1ULZA 1ZN7A 3STYA 5GPBA 1TM1E 3WYCA 4ZYXA 3GK3A 1TC2A 5KAMA 4AUKA 4LSGA 3AP2A 1YT5A 3VC1A 1O95D 2PGDA 1NQTA 2VDUE 1ZAKA 3K20A 1L5OA 2A8YA 2POCA 3QPWA 4PCUA 3ZW8A 1X1TA 1R0ZA 3FSJX 2C78A 4IXTA 5C3MA 2H07A 2QU8A 2DY1A 2QYHA 1MVLA 4JROA 3JQGA 1R6AA 5FYDA 2C4NA 1ID8A 1XB2A 1PNTA 3O3OB 4PW0A 1N0IA 3D6UA 4RMGA 5EFOA 3HC7A 3TQCA 5LQJA 1QU3A 3MTIA 3BE6A 4LTNA 5LOVA 1E60A 2MINA 4D46A 4FYYA 1I9CA 4HWSA 4O59O 1WX1A 4P7BA 2AOVA 4RIEA 3T15A 4H59A 3TRDA 2X77A 3B82A 1VJ5A 2AOUB 5E6SA 5DKFA 3UC9A 2WHRA 2WWIA 3NM6B 4JELA 4NBNA 4GQAA 2VHQA 4GW3A 4NK4A 1UEIA 1CVLA 1PAUA 4Q05A 1CULC 2H7YA 4UNQA 4EVSA 1KPHA 2ZIVB 3EPHA 3H9UA 3I6ZA 3NH6A 2QMZA 5EXDA 3OWHA 1MXFA 2PSEA 5DHFA 4C6TA 3N1UA 4LVOA 4YJ3B 1KZHA 4BQNA 5BWMA 1W4AA 1ZICA 5HQTA 1EFAA 1M0SA 4KQIA 5FUXA 1IN4A 2A9JA 1RKUA 1VYUA 2W2VA 4HZIA 4M7OA 4QGBA 4AY3A 4IGEA 2XB6A 2ORED 3S40A 3MJHA 4BNDB 1JIKA 4YQEA 1O6CA 3I6YA 1YIOA 2Y05A 2BUCA 3J7AC 4V1CB 3IAFA 3ETDA 1DAPA 1PQWA 4R81A 1PFWA 2WSLA 3TLXA 1F06A 3B6KA 3KVVA 2AIRA 4LXIA 4TL8A 1V39A 5IAKA 4RTNA 3RRFA 3HSSA 1Y3DE 2XA9A 5DISB 3VI3B 1G42A 2N3ZA 2WM3A 2PAFA 2PUHA 3U44A 2VBIA 2YC4C 5JAUA 1SKYE 3Q6NA 4BQEA 3AO0B 2O05A 1YIAA 2YYAA 1G21E 4E30A 3FYDA 4E5NA 4QYIB 3FWYA 4CKCA 4JLBA 1LFDB 1FMLA 4J6EA 3UJBA 3PUVA 3U4AA 2BFFB 1QIEA 2VP9A 1AX9A 3EZ6A 4WVLA 5KYNA 4D8VA 2P9EA 3WL7A 1VI6A 3OEWA 1VFPA 3BS4A 3EXFA 4FPXA 4EFLA 2XHEA 3AOGA 4PO1A 2QNRA 4Y2JA 3GAAA 2VZ9A 4CKBB 3GXBA 2VJBA 3PDWA 4FKZA 4RBNA 2QMEA 1L5RA 3F5DA 1A9SA 1Z3CA 2IIQA 2ASEA 2OG1A 3CZ5A 3Q40A 1KEEA 4CLDA 5C8ZA 1E32A 4I55B 5KQGA 1N8TA 3SY8A 2QUZA 1WV1A 4EA8A 4QVKA 5DTMA 1RZVA 4E3WA 1JPNA 2WNIA 1NASA 3CQ9A 2Z57A 3VC2A 3KFXA 1QS0B 4MQEA 4UOQA 1QANA 3LQ2A 4WTOA 3ANNA 3X1ZA 3RK4A 4CTKA 1DGQA 1QTRA 4V02A 4G4IA 4YXWA 3HV2A 3HY3A 4TOIA 4KR6A 3C14C 3QITA 2FP3A 3LIIA 4WZBA 1OLOA 3UJAA 2IH2A 4ZALA 4H77A 4MAAA 4MS4B 3DDNA 1UBOS 1F14A 4F2GA 4LF9B 1NC3A 4BB0A 1LX7A 1M6VA 5AUQA 3QFFA 4QU8A 2OBMA 3TQRA 1KQFA 1RAFA 3HKCB 1H2XA 1T9DA 4OPMA 1QNLA 5L3SB 2AK3A 2ZI6A 4U7PB 5CITA 4B3BA 1JZQA 4RVFA 1NNUA 2VF2A 1OHHA 3CW2A 5L3VA 2CJFA 5JFGA 4OX9Y 5J40A 2FWMX 3UFBA 2O48X 3DB2A 3KYJB 2MR6A 1UPFA 3E3NA 2QZPA 1W1UA 3RC9A 1KFJB 2E5LB 1N5RA 3KDPA 3OZDA 5CYOA 1KAMA 3QGMA 3UW3A 3JQDA 1Y8CA 1FLAA 5LNK1 5LB2A 2WA2A 1TJNA 3VR5H 3Q15C 4JVOA 2P9CA 4I1OA 1WRBA 2BM8A 2WV9A 3H65A 3L6DA 3OPVA 1BYUA 3W3AA 2QTNA 5ILQA 4G41A 4MO9A 5HZHA 4L02A 4GEKA 4BBAA 5J4YA 4UEJA 2X4GA 1WZ2A 1YB5A 5H59A 1C7JA 3NKFA 3QTBA 1OX5A 2GZAA 2ZI4A 3GWGA 1V8OA 4BNJA 2NO6A 4V1CI 2WWVD 3SEZA 4FC7A 3LO8A 5D1NA 1PYOA 4C5CA 4WY5A 3RT9A 1PJ2A 4FOSA 1PV1A 1EINA 2XOKA 3BSFA 4I1RA 4NFLA 4I3GA 3UW1A 1UKBA 4HI0E 1RT9A 5K6TA 2O2YA 1PIWA 1G18A 3L82B 2GASA 4BXOB 1B14A 3MJRA 3LDUA 3ZBTA 3NI2A 3LJKA 4LZAA 4JSRA 2DULA 1P4HA 4UNPA 4IXNA 5LD2C 4L4ZA 1E7WA 2A7XA 2GJ4A 3INTA 2IYYA 4N5LA 5C2JB 5ITWA 5ISMA 4Q6BA 1E69A 5CIYA 3QEAZ 2LRHA 4KPEC 4L0MA 1ORHA 1ESZA 5A1TA 5IVPA 4QM6A 4BNKA 5BW4A 3BFKA 3OZCA 4FDAA 4G2NA 4IJ6A 4HAOA 1PDOA 2WSBA 5KYYA 3I6QA 2HDNB 3TLGA 1RTKA 1IDOA 1AF4A 1ECGA 1X19A 4KVZA 5JBNA 1UDAA 2YMLA 2YJZA 4F06A 3G8AA 3G79A 5ALJA 1HTTA 3GGJA 2NUPA 2PUJA 4MULA 2ZBDA 5C1BA 3KVRA 5T4BA 1BVHA 4OAQA 1NN5A 3R9KA 1VCNA 3MLBA 5CIQA 5DYYA 2B25A 4QHSA 3ZV4A 4MAMA 2SKDA 2Y99A 2OB2A 3T9CA 2BVNA 4C05A 4XYBA 4ZI2A 2ACEA 1E9BA 3E2IA 2SBTA 4NFHA 4HLUC 5ENVA 1K3FA 2ZZNA 2VNKA 3DMPA 2CDRA 3H17A 2GUGA 2F67A 5BWCA 1XK7A 2Z4RA 1Y3IA 5F35A 3PNPA 4FBLA 3IAHA 4RGVA 1BWSA 1S9HA 3F8TA 5FA6A 3RYFB 4ICIA 4IGAA 3IO3A 1F0NA 3ZY3A 1Q7CA 4EW3A 3I9NA 1SU7A 1U9ZA 3W1VA 2GWRA 2R5NA 1XHLA 2FN3A 1H2FA 2IOFK 2R00A 4MVJE 2NXCA 1U98A 4MGZR 4U2GA 4EQ6B 5A71A 2OR3A 2BISA 3EGVA 2WKRA 2QD4A 4RDCA 5U1PA 3PQ7A 2ZEJA 5FHQA 5EPEA 3JRNA 1Y6QA 4FGUA 3UGTA 3E70C 2H16A 5KTMA 1NM5C 1SG9A 3GNLA 1UKEA 1QVWA 2PX2A 3LC0A 2I29A 4KX3A 1X1CA 1QH8A 1S1MA 1CUVA 3LWBA 4QQRA 5EERA 3U39A 4Z8XA 4B8YA 2A0KA 3LWZA 3TZEA 3FPGA 3DW1X 2VT6A 4H1VA 3DOIA 4CQLA 3PCTA 5JLJA 1KYXA 4BNVA 2J6CA 2C3PA 3RB8A 1Z2CA 3EIQA 4K6GA 2JCBA 3ZY2A 4B3CA 4OKIA 3O5AA 4Q03A 5E2IA 2G5GX 3EPJA 4TQGA 1NUSA 3EYWA 2DM6A 4HN2A 5D3ZA 5DEIA 2W6MA 1Y6FA 1QYRA 1ZWLA 1Z7YA 2RONA 2V6IA 3FY4A 3HN6A 3JPYA 4I50B 4WN3A 5C4GB 1OB5A 1Q2XA 2D00A 2VXCA 1A7AA 3IHLA 4UBIA 5K8UA 4NCNA 3S8EA 5TRTA 5JYDA 4L0CA 2QE7D 4RE6A 1YRAA 1WQ4A 3IC5A 4QFMA 4RLHA 3OM9A 1I2ZA 2WDPA 1ZA1A 5ITVA 1YKFA 3MWGA 3AF5A 3FLAA 3AJ9A 5L3RA 1A4XA 2PD6A 2NVOA 2PA3A 4B6OA 3WVNA 4KR9A 3OBBA 4IVPA 4QLAA 1HQDA 2LD4A 2RDMA 3O8NA 4I9FA 5DX1A 5FI1B 3W90A 1MLDA 1JKIA 4ISCA 5DBGA 3VOTA 1QFMA 2X8AA 2ZSDA 1IXYA 1AKVA 3L4KA 4N7BA 1NPDA 1FS6A 2ZYGA 3AR3A 5EZ5A 4ZVRA 3ZWQA 2IYAA 5GZ3A 3OX4A 5HS6A 5K3OA 2UUCB 1C1YA 1HURA 1KO8A 1U6IA 2XVZA 4ZTUB 4CEJA 4N82A 3AZQA 1VJTA 3KE9A 1GYRA 4PZZA 2HPHA 3UKJA 1D0IA 1O1YA 2A0XA 2HO4A 4XOIA 3RGGA 1Z63A 1XU4A 3C7AA 2RD2A 4NCHA 2ZWMA 1U8XX 2LV8A 4UCXA 3TR6A 4EG0A 3K1YA 1NDHA 1TJ5A 2IUEA 1HPLA 4IIDA 4LYYA 4F85A 3NEYA 3OQVA 4PM4A 3CRNA 3BXXA 1XU9A 4YP6A 1BNCA 4QYSA 4A4DA 1R6UA 5KNDA 1EHIA 3MVEA 5E9JA 4ZO4A 2X8JB 2HLDD 4RLFA 1PZHA 4G8DA 2WICA 5A5VA 3ZWPA 3EXIB 1N0UA 3TE7A 4AICA 1B4DA 4XIGS 2F62A 4I55F 2I9PA 2G9UA 3ZPXA 1WBDA 1CFZA 1I14A 3KJNA 4ZHQF 1AHPA 1LFAA 4KKVA 5KWEA 1G20E 1QIJA 1LLFA 2GZ3A 2O1SA 3HYCA 2BHTA 1TVKA 3NGMA 3DQQA 3OKFA 1K1EA 1BAPA 2TMDA 3HKBB 3IPRA 1X38A 3IT2A 1Q84A 4PHCA 2OZPA 4MXDA 5GJBA 4BNYA 2CNWA 1PGQA 4RKYA 1E62A 2D4HA 4YREA 1RCTE 3TDMA 5AKEA 1H66A 3LO5A 3KT6A 2DR0A 4ATNA 1JG4A 4BIMA 4BGVA 3NJ4A 1M1NB 4NCAA 1GD1O 1U6KA 5KNDD 3LHFA 2Z4SA 3BGVA 5ESXA 4P3YA 1TD9A 1SHKA 3P32A 5T5QA 2GS9A 3TOSA 1G291 3OEED 1RVV1 2HAEA 2QXTA 3LC2O 4KIUA 5ECWA 2RFLA 3D6NB 3EMKA 1WP9A 4F38A 1D2GA 4TS3A 4EG6A 2KLHA 1MOZA 4YWJA 3KE8A 4EK9A 4QXQA 1NBMA 4BLSA 4AKEA 2EYQA 2QV7A 3GVIA 3MTQA 3BORA 3OLWA 3AF4A 4G5SA 3GNQA 3AM5A 3DFFA 4FSDA 4MA5A 4NQZA 3WLHA 5A62A 4LJKA 3VZQA 3CX4A 3RBZA 1GZSA 3N0XA 3PGMA 3OMWA 2QSZA 1L5HA 3FKSD 3DDHA 4UPDA 1XYVA 3K2BA 1JHXA 1ODKA 3CBQA 2WU0A 1TIBA 1GAJA 5TV2A 1EUQA 2A9OA 2E4WA 4OYYA 5SICE 2CLHB 4MYUA 5IMBA 1HTWA 3OBIA 4P98A 3K94A 1OPRA 2O2ZA 1QPGA 4WCVA 1RBYA 1VP3A 1XMXA 2QX4A 5FWNA 2JLZA 4DG5A 1L7NA 5KDLA 3VI4B 3V1LA 4M0PA 3UIEA 3OZRA 3URKA 3RM3A 1TUEA 3V4SA 2GXUA 4KDFA 2G82A 1ISJA 3DAFA 3GH3A 1A72A 4LHEA 5DLEA 3RGWS 4BIIA 4AJNA 3OVMA 5CDTA 2F9LA 5K2MA 3W5BA 5F3WB 1KSFX 1DELA 1QPBA 3O03A 4UBMA 5HCIA 4REQB 1MAAA 1NVGA 1BFUA 4R3WA 2EQ5A 4M1WA 5JD4A 1L3IA 3CSDA 1E0AA 3U80A 1F3LA 2WZQA 1X1BA 3GJ7A 3I9MA 3VPXA 3GFVA 4YJ2B 2AOTB 1CP2A 2K5UA 3A26A 4EEXA 1WABA 5AK0A 4D92A 1YCHA 4B3FX 5C7IO 3SN6A 1GPMA 1SCKA 4P7JA 1EIWA 3ZE0B 1Z4MA 4TMYA 3F46A 4XEUA 2Q3FA 1VKJA 1J25A 1ZY2A 2BUAA 2MSLA 2O50A 3F5MA 4QBIA 3JSAA 4FDTA 4U2CA 2AOUA 5E6SB 3A04A 5CCEA 2ZIXB 1HF3A 2RB5A 4WJZA 2NP7A 1TF5A 1R1DA 2IXBA 1YU9A 4CQNA 3W9BA 5BR4A 4XVRA 4WY2A 2IZ0A 4QBHA 4MHTA 3JR7A 3TW4A 1T0JB 2W6ID 4QYMA 4AAYA 1PS8A 1J90A 3HU1A 621PA 5JQWA 4PS1A 5FUYA 4W5TA 4PINA 4XI9A 4X97A 1LBSA 3K0FA 3UAXA 1E98A 5K8CA 2QX6A 2V6JA 2NUTB 1KFBB 5LBIA 1YBVA 4NJEB 3OG9A 2QSJA 1E79A 3AZOA 1CERA 1S9DA 4UUBA 3NHLA 2WQZA 2EOAA 5F4BA 5HX7A 4LJYA 4X63A 4WL0A 5AHKA 5EA2A 2G3YA 1EA7A 3GGSA 2P2ZA 4DIKA 5AJVB 3LKBA 3DZCA 4LMRA 2GSDA 4ENQA 2HJ9A 5A0FA 4O2AA 1T9AA 5FORA 2RHWA 3WXBA 3WK9A 3R5HA 4ID3A 1AZSC 1YO6A 5DGIA 3IXMA 5T4EA 4N5IX 1Z38A 4RPKA 3E4DA 1LKZA 4UUMA 1G1MA 5IJZA 5COBA 5NLLA 1XBTA 3C1UA 3E9NA 3K1JA 5IABA 1FDRA 1HDGO 4GVPA 1YJCA 5LB4A 5FPTA 1TAHA 1GCGA 3MWYW 4AY5A 1Z5NA 3CZQA 1P39A 3DZJA 5DLPA 3WLMA 2DGDA 4IH1A 1MNQA 1SHTX 1JG2A 2D7JA 4HJRA 1SQ0A 1WVIA 4MI6A 5DK6A 2C9DA 3H6GA 4ZU3A 5AVJA 1QJ4A 4H7DA 2NO0A 1E5XA 1XZDA 3MEQA 4LNAA 4M3NA 4AZTA 2JLXA 1UBJS 2H1WA 3FF4A 4WESA 4CUJA 3T1TA 4QDXA 1WMSA 4O4HA 4M49A 1KYYA 1KEVA 1TO2E 1WXDA 1FZQA 1G19A 3D4PA 3D7LA 3HB0A 5ALKA 4P34A 5B7PA 4DSAA 1WQ1R 3FNBA 2WW8A 4NENA 5IJWA 2M32A 2QZSA 2ZE5A 2C77A 3K31A 3ZOZA 5TS3A 2P40A 5JADA 1JI0A 1QHYA 3U37A 1N2SA 1AB5A 1R2QA 3GJ0A 2C9OA 3B3GA 3AG6A 5KYGA 2XCIA 4IHQA 4PBTA 3ZW9A 1GKKA 3WNBA 2Y0DA 4LY3A 1Z2NX 2DUJA 1M72A 1QLWA 1OX6A 1RRVA 5GMOA 5U4XA 1HLFA 4PCLA 1NC1A 1V5WA 3HV0A 1JLLB 3K9NA 4H1WA 3GP3A 3M4ZA 1YUNA 4R54A 1P8AA 1DAHA 3EBLA 4BWVA 4EMSA 5ER6A 5LP6B 4IUBS 1JU9A 1PFYA 2QL6A 2HK7A 3I04A 3P2MA 4LPKA 1Z0DA 5AM4A 4UMDA 5BSGA 3ZEIA 1DKQA 1FQJA 1K97A 1Y8QA 3WYEA 1ESMA 3VH2A 3D7RA 4H0NA 2WIKA 3SPXA 3RTGA 3G1UA 1FJGB 3GUVA 1D2NA 1NW8A 3Q4GA 1UIMA 1FIUA 2OM2A 4L9RA 3O2QB 1OAKA 1Z25A 5IMSA 1Y8AA 4FYWA 1ZFNA 1BH2A 3DLHA 3NMUF 3O8DA 2ZYVX 3WK5A 3ZCQA 3DAGA 2PAAA 3EDCA 3JVDA 4Q9NA 1ZI8A 2HPVA 4XSVA 4DL9A 5KOJB 3A36A 3ANMA 2BZGA 1Q3TA 4TLCA 3ADBA 4D9GA 1IH8A 4BMYA 1ZIPA 1LD3A 3DVQX 1MRNA 1QZTA 3ML1A 3E7DA 5CXSA 1HZJA 4V0SA 3BRQA 2X42A 1Q0SA 4GPIB 4OATA 4JX9A 4WKPA 5DWDA 1W87A 1O5TA 4YJFA 2IV3A 2AUMA 3W2FA 1LJLA 3ZUGA 5BXQC 3WJ1A 4GR4A 3E35A 2GRAA 1GRNA 3VU9A 2QYOA 1WMBA 2AFIA 4KC0A 4CV3A 3KK0A 2QTWB 1SVIA 2OGTA 4UU0A 4DILA 4EIWA 2Q45A 4J7CA 3AJDA 3PXDA 3Q1KA 5GZ1A 1SHZA 4PC6A 3V7WA 1EZZA 3QYAA 1PQUA 4BP9A 1BQEA 4EFMA 5T3YA 3II6X 3GJSA 4WASA 1EX7A 3DZGA 3F6PA 2NTVA 4UZFA 3STHA 5KVCA 2JH9A 1KH2A 3EQZA 4CE6A 5HCUA 3SS9X 4KXFB 4OHWA 2C7RA 1ECCA 1C8KA 1ACJA 4WH0A 2Q28A 4IHKA 4LXGA 4BWGA 2ZANA 1JEEA 1T24A 5F77A 4NPHA 3OF3A 2OZLB 5L45A 1QQAA 4O2LA 2I4LA 4OK6A 1JFLA 4PG5A 3U3XA 5GADl 2J07A 3KXDA 4B76A 4BVHA 3VOBA 3BX1A 2Q07A 4WT7A 4MQUA 2NUTA 2UV8A 3NHRA 2SHKA 3FMPB 4Y2QA 5J4HA 4TV9B 2W83A 3G9UA 1YK1A 2NTYC 5DHTA 4UOEA 4DS3A 3R0ZA 4S1OA 1UM9B 1QRRA 2FUG6 2G04A 3HVHA 2E3JA 3R5SA 1XHEA 1WVMA 4PC2A 4Q4AA 1JEYB 4LUCA 2GPWA 4EJFA 1H94A 3TD9A 2NU9A 1DOHA 2O3RA 4RJLA 2O4UX 1VLHA 2Q29A 4DLZA 1VPDA 5E4FA 2ZSEA 5LU8A 1Z0UA 3GEGA 4QXPA 1DMRA 4CTNA 4G1EB 1T0UA 1U9IC 1QG4A 1VGVA 1Z88A 1OXXK 2VVTA 2QPOA 4LXXA 4V0OA 3LHSA 4ENWA 2QTAA 2QTBA 5G41A 9ABPA 1T34A 1ZEMA 3T61A 2FPLA 5LA6B 1VE1A 3EXG2 5JH7A 5K3EA 4L3VA 4X1KA 3OSUA 2UYYA 1C4OA 1B2RA 1DXHA 2FPGB 3L7JA 3E61A 1NFRA 3MS4A 2GHQA 3BICA 4RZHA 4D8XA 3KSBC 4YCAA 3UJDA 2HSDA 3HCOA 3HWWA 4LXHA 3IE2A 4DYDA 5JVDA 3FMOB 3BMOB 5ERGB 4AJIA 2YWFA 3C15C 2I7XA 2FFBA 1Z6QA 1ISFA 1LJ8A 4UTNA 1QYCA 5B2EA 5KNBD 1EE9A 1MR3F 3MCWA 2DERA 2V03A 3PEWA 5B37A 1DT5A 1X74A 5D3KA 3EIXA 1WW2A 2Z5FA 2A9PA 1R12A 2C3MA 2JGDB 4RA6B 5TQ2A 3OJCA 3A1DA 2ZSAA 1JALA 3I45A 4YA6A 5T7BA 3DDWA 2FW0A 2NXJA 4W5RA 5JJCA 1SVSA 5H9WA 2BFCB 3SMQA 2C5SA 4GLFA 4MVJA 2NQ8A 2ALJA 2CE2X 2XYHA 1ZD9A 3OO0A 3QUSA 4HLNA 4Y9DA 3ZWWA 3EF0A 4HBGA 5LC1A 1SIBE 3X2EA 4M55A 3UEOA 1JDJA 4IJKA 3TXXA 1DKRA 1RW4A 2QQEA 4YLEA 1E8NA 4MUYA 5SY6A 1FUUA 4BL5A 5JD5A 4RL4A 3FLBA 3JQBC 5BNTA 4S05A 4HNAA 5TMEA 1P18A 1PT7A 3F3KA 4MUXA 5AP9A 3DVRX 1JB1A 5ALLA 3KT8A 5BMVA 1ZEJA 1IVSA 5K20A 4H18A 1KIMA 2Q5HA 3EIOA 2JJ1A 1ZD3A 1VIMA 2C3OA 3MFQA 4L9WA 5HIKA 4FW9A 1O57A 1QX4A 3N58A 4WBNB 5KPJA 5F23A 1NVBA 1YR8A 3DE1X 4BU0A 1NMEA 3EOAI 3NUZA 3EXHA 3U7HB 4QGAA 1TAQA 4XX0B 3CIOA 3DEKA 3EPRA 4O8CA 5MFPA 4PWYA 4HV4A 1NF9A 3B48A 2NVUA 1MH1A 4ZCQA 5E1BA 5KB3A 2R7AA 3EVFA 2WWYA 4B7XA 1KAQA 1V1RB 2EERA 3OLXA 2CSXA 4H31A 4NAVA 3X2FA 5G3YA 2C0CA 1KO7A 3IP7A 3JQ9C 5EZYF 1C41A 1Y80A 3PJFA 2W2KA 5KCMA 1GNLA 1OU4A 5I7EA 2VH5R 2QR5A 4ZIRB 1P7CA 3K6SB 2OORA 2P6UA 4PYJA 1J9ZA 4G0WA 1F8GA 4H1TA 1XF1A 3NHUA 4G84A 4GFDA 4NX2A 5B1SA 2VDOB 3Q3CA 2CDCA 3SG0A 4PFSA 3K8OE 5BN5B 5B57C 1V35A 1KYVA 2HREA 2RGGA 5H16A 4FGSA 2IUUA 3O26A 2OAP1 1GRRA 4WXRA 1SNYA 5E6RA 4JD5A 4JZKA 1ZWKA 4C43A 1F38A 2AZMA 3M1YA 3GN1A 1VSQA 5HF8A 1I33A 3L1UA 2E21A 4MWEA 3QYPA 2YOHA 1H6CA 4YCNA 2RGWA 2QRUA 3BDIA 1W4CA 2NPOA 4KLZA 4V0MA 1BD3A 3HJCA 4II2A 3A4YA 4DLWA 4I5FA 1H5UA 1UFKA 4U39A 1QFJA 3W77A 1JHOA 3H1PA 3O95A 1CCWA 4NMHA 5AQEA 1AGNA 3H8SA 3PK0A 4EJMA 1J2RA 3P8ZA 4MMXB 2YTZA 4YFVA 3ZE9A 4EPWA 4QT4A 3HYRA 3W5UA 4WK2B 1D9XA 1Z6GA 2FEAA 5DHUA 2CCGA 3FI9A 3KIPA 5JY1A 4QDUA 1E3EA 2B7LA 3FAKA 3UMFA 5AM3A 2P69A 1VSBA 2ZUTA 5DM1A 3ZDZB 4WBNF 3KTAA 5K3FA 2XA2A 4OSOA 2V7TA 4L9AA 1H2AS 1RM3A 4NCBA 2H9IA 4X84A 4ZKDA 4EYEA 3SVZA 4TGLA 3HVIA 5AFSA 3S2UA 3HHEA 1JHPA 1Y7HA 5KMGB 1NX6A 1AHNA 1XRNA 2HBRA 3W8DA 5AVRA 5F5LA 2FPGA 1P1BA 2P30A 3O84A 4CNQA 1B8UA 3T7TA 2Z5GA 2VYNA 2FMKA 4I1VA 1M2HA 1FVOA 4QFBA 5TPWB 4C7JA 1QM5A 5EXPA 3U9TA 3EH1A 2CCKA 4ZAYA 1FZTA 1CR6A 3N86A 4UFOA 5AKGA 5KHLB 1HE4A 5C51B 3E58A 4FSHA 5MN5A 3G5MA 1Y89A 2D59A 4NCJA 4QPPA 4GH5A 1P7PA 4R2KA 1Z3IX 1ORDA 2Y0PA 4GWKA 1YNOA 4XDZA 3KZ1E 2PKQP 2VPPA 4K03A 3DLBA 1AN9A 2O8FA 4MDHA 5CMLA 1G6Q1 5AR1A 1H8ED 5LM3A 1BJKA 5DHSA 5J1SB 3RVNA 1ZK0A 4EJ2A 2AVDA 3MBOA 3I3SR 1B15A 2O2GA 3HY4A 3IDZA 2ZRAA 3HG7A 3N59A 4HEHA 4TKLA 3U4IA 5E9QA 2XWBF 4C89A 5CFPA 4MV1A 3PWTA 3T9BA 3DLPX 3CPHA 1U2GC 4JJ6A 4MUIA 1VOTA 4ZODA 3TBFA 3HXQA 2VJNA 3C4VA 4O4LA 2EFDB 2Z8YM 2E4VA 2XMQA 3HHPA 3AHDA 4POOA 5I3CA 1ZGAA 1SB8A 2MSDB 4TXNA 5C3UA 4ENTA 3CVOA 4QSHA 2I9KA 5CLGA 2WMNB 3EQ8A 2XUGA 1BD4A 1ZGZA 4OYHA 5IYZA 3FTDA 2OXEA 4BO5A 3I5XA 3T6KA 3R7NA 2O2SA 3IVAA 5JASA 1G6KA 4KYIB 1IZ0A 2RHGB 2C2HA 1Q19A 3BJMA 5FUWA 1Y6ZA 4BEBA 2IZ6A 4NBVA 3I01A 1OASA 2R5WA 1Z0SA 4Q7JB 3SJBA 1QGUA 1B23P 1X77A 2KHZA 4IIJB 4R8SA 4MINA 3ZS9A 3FYSA 3OP4A 4G1UC 4X6LA 5FQNA 5M3BA 1OA0A 4TTSA 1O96B 3BRWD 1LPBB 4E3ZA 4KGVA 2Z9BA 5KI6A