2OSVA

Crystal structure of znua from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
283
structure length
262
Chain Sequence
AVVASLKPVGFIASAIADGVTETEVLLPDGASEHDYSLRPSDVKRLQNADLVVWVGPEMEAFMQKPVSKLPGAKQVTIAQLEDVKPLLMKSDFNMHLWLSPEIARATAVAIHGKLVELMPQSRAKLDANLKDFEAQLASTETQVGNELAPLKGKGYFVFHDAYGYFEKQFGLTPLGHFTVNPEIQPGAQRLHEIRTQLVEQKATCVFAEPQFRPAVVESVARGTSVRMGTLDPLGTNIKLGKTSYSEFLSQLANQYASCLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords High-affinity zinc uptake system protein znuA
publication title Crystal Structure of the Zinc-binding Transport Protein ZnuA from Escherichia coli Reveals an Unexpected Variation in Metal Coordination.
pubmed doi rcsb
molecule tags Metal transport
total genus 89
structure length 262
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2osvA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2osvA02
1KAEA 5FLYA 3K1AB 4WZBB 5GGXA 4CL2A 4TKUA 4PM4A 4FI3F 4WN9A 4UTPA 4TKVA 4INPA 5M34A 4OVKA 4BBPA 1QH8B 2AFHA 5M3BA 2Q8QA 1G21A 4WZAA 3AEUA 3EIXA 1QH1B 2PHZA 4WESB 4ND8B 1G20A 5HX7A 2QI9F 2XH8A 1M1YB 4GICA 2OV3A 5BVHA 4MDYA 2YNMD 1G21B 4WZAB 3AESB 3NU1A 4M7OA 2R79A 5AFSA 3LHSA 1XVLA 3HXPA 1ESZA 4HMPA 2XUZA 5JJ5A 1M1YA 4G07A 4K3VA 5JPDA 5KOHA 1PQ4A 1FP4B 1N2ZA 2X4LA 3R5SA 2MINA 4TKUB 3GI1A 1N2CB 4WNAB 2OV1A 2XQVA 3MINB 5CR9A 2AFIA 3U7QA 4INOA 1PSZA 3PSHA 3U7QB 3HH8A 5M29A 1EFDN 1N4AA 1TOAA 3TLKA 4XPIB 3MINA 1H1LA 3ZTTA 3TNYA 4ND8A 3MFQA 2M6KA 4NNPA 3AEQA 3MWGA 2PRSA 2XDQA 4FILA 4FKMA 4NNOA 5CX1A 3ZKAA 3PSAA 3BE5A 3EIWA 4TKVB 2MINB 3AEQB 4H0FA 5JG7A 5GGYA 2OGWA 1MIOA 2YNMC 3R5TA 2Q8PA 4DBLE 3TEFA 4WN9B 1M1NB 3PDIA 3MWFA 4G09A 1M1NA 3PDIB 5HDQA 2XY4A 4PAGA 5BVHB 2PS9A 3ZK9A 1QH8A 1M34A 3ZK7A 4XPIA 4WESA 2R7AA 1G20B 1N4DA 4MO9A 5BVGA 1K0FA 3AEKA 2AFIB 4HMQA 4MX8A 5BVGB 3AERA 2AFHB 5JOQA 3HJTA 4N01A 4LS3A 1KARA 4LJSA 1KAHA 3AESA 3LI2A 3AETB 4H59A 1FP4A 5B58T 2M6LA 3UJPA 1K7SN 2ETVA 5KOHB 4WZBA 5M2QA 1K75A 1QGUA 1L5HA 4UDNA 1L5HB 1MIOB 1M34B 1QGUB 4FNAA 2WHYA 4HMOA 1QH1A 2XV1A 3AETA 3CX3A 5KOJB 3ZK8A 5KHLB 4IRMA 3AEUB 1N2CA 4WNAA 2PS3A 5I4KA 2PS0A 3MD9A 3AEKB 2RG7A 4MLZA 4OXQA 4UDOA 4HN9A 5KOJA 2OSVA 4B8YA 5CX1B 3AERB 3BE6A 4OXRA 1K2VN 2XDQB 2WI8A 3G9QA 2O1EA 1H1LB 4UTOA 3K1AA
chains in the Genus database with same CATH superfamily
1BD4A 4GI2A 1N2CE 1G8AA 2C95A 3WRYC 3TZEA 3D64A 2ZKLA 2WOOA 1L5SA 2BFFA 2X6QA 1GHTA 2Z4SA 1U4OA 4DJTA 1C1HA 5HFNA 1KZ6A 2E49A 4KP7A 3TGLA 3OU7A 1PQYA 1XXHB 2A33A 4K9KA 1GILA 4BU1A 3TB6A 1JA9A 5TSDA 1F20A 3ZWXA 5GZ3A 4R9VA 3RFTA 3D0KA 5M3BA 4BAUA 1NJ2A 2J67A 2X22A 4KIUA 4PZ9A 1L4LA 4YRQA 4NCXA 1CDEA 5SYMA 1UJ5A 4ZTZB 4HI0E 1TUIA 4LZLA 1YVUA 1U0OC 3UAYA 5A1JA 3U44A 3N07A 4G1MB 5FUBA 5H3HA 3JWHA 4B3TB 2R8XA 1WVGA 1NT4A 4YACA 2NTVA 3WBBA 3MT0A 3VGJA 2D5LA 4Q3EA 2XWQA 5LD2C 4HBGA 1AGYA 5KOHA 5CM9C 3DEFA 2FR8A 1HDRA 2WKRA 1P2DA 3ZN2A 3T61A 4W5QA 5HEKA 5EMHA 1MIHA 2ZVJA 3P20A 3TR0A 3IEVA 1Q1EA 3N8KA 2ZTMA 4RF3A 1BN6A 2YWCA 5DTIA 4C4RA 3BGOS 1JFLA 4P0PB 2V7XA 3EWNA 4TRNA 5AI6A 3PVSA 4EX6A 1E1LA 2C8LA 1CUGA 3BXFA 4MQEA 4QJIA 2ECOA 5A7HA 1JTVA 3AR4A 3H83A 2W70A 4EHLA 2CMHA 2OQ2A 3QUBA 4NBWA 1EFPB 1T0PA 2P2CA 2VDVE 4G0OA 2PUBA 2W6JA 5DHSA 1WZ2A 4YK7A 4DPMA 1DKPA 1JP7A 2VATA 4UHBA 2PMCA 3SHVA 2ETXA 1TJ3A 3FAZA 4NJEA 3SEZA 2VQFB 1T5HX 4MV9A 3TW8B 1QAMA 3PNMA 3IESA 3U61B 4HNGA 4QSHA 3RNOA 1IDN1 4GNKA 5FPTA 3U4QA 5DFAA 4KOAA 4BEWA 3DBRB 3EMVA 4LMBA 2ZRPA 4MV7A 2OGZA 3JQGB 4QARA 3EGXB 1LI4A 4AKSA 5M04A 3R3ZA 1D2MA 2WR8A 3BQNB 421PA 4DMFA 2H52A 4OFXA 2ZSEA 2QJWA 2XDYA 1ZMTA 3OY2A 3C5HA 4G97A 1PW5A 1A5TA 1UWCA 5KO2A 1PS8A 1CC1S 4TQGA 1D1TA 2Z95A 1JLRA 1LF5A 3A27A 3LCRA 5EXPA 1CIVA 1QS0B 3BPSA 3NHAA 5DYYA 5I3ZA 2QAGA 4K6KA 2X0DA 4BZWA 4IYJA 5HUJA 4A8PA 3G2QA 3FFXA 4KXYA 5FTLA 5HRUA 1JHMA 5H4GA 3KHSA 3S29A 3PI7A 5LP6A 1Z26A 2QI9C 4K88A 5I5EA 2ST1A 1XU9A 2AH5A 1GVHA 4LHZA 1YHNA 2WTNA 5PNTA 3WSVA 3VR2D 1YVRA 3WL7A 4FMCB 4WXEA 1J8DA 2UKDA 2W93A 3AEKB 5TR9A 3KQOA 3IR5A 4L50A 4OXQA 4UDOA 1PEAA 3QELA 4X20A 3GIDA 5EMKA 4XQEA 2Q7OE 5B7QA 3TOCA 4DWJA 2I65A 1FS5A 2Y8EA 5EL0A 3FOFC 2P9EA 1ZJYA 4NAUA 3L18A 1ZEMA 3C43A 5F51A 3UQZA 5LJLA 1PF7E 4MW5A 2C0QA 4EYKA 4EA9A 4CCSA 721PA 1AMOA 4K0KB 7MHTA 1EIWA 4UHFA 3OWHA 4KW7A 4KI7A 2JFBA 3PNOA 2BKUA 5ALNA 3GNSA 1H2BA 5B37A 2Y3IA 2R1TB 4AZ3B 2BFPA 1D04A 4NCHA 3WSWA 2J3QA 1EDOA 2AOVA 2FZCA 4KXVA 1XZLA 2IU4A 2AOWA 5DYIA 3THWB 1WKCA 2CLIB 3JAKB 4Z86A 4GRAA 1X2EA 3EGXA 1YF3A 5LD2B 1P1KA 3VR6D 5E4TA 3LIIA 2I4IA 3H7IA 2WB2A 2AN5A 3ASZA 1GNTA 1R6UA 4KO1S 3KFVA 3T7KA 4A92A 3TD6A 1T8YA 3CLSC 2XNHA 1ESZA 4YUXA 3UA4A 4BPRA 5IKMA 4XX1A 5FUVA 2NZ8A 1FB5A 4EPTA 4DRYA 4I5DA 4ESEA 2FI1A 4PG6A 4UTZA 10MHA 5KYVA 4P3KA 5FL3A 3ZUPA 4EB6A 4LV6A 2J9YB 3GU3A 3IIKA 2FGKA 3PDWA 4U2KA 5B6IA 1Y4DE 1GTZA 3TL6A 1NLFA 1UJNA 1MX9A 2I6QA 3KKZA 2BDTA 4E09A 5KQMA 4O63O 1F2UA 2PGNA 3LRTA 4R7GA 1P9WA 2GBIA 5J40A 1QE3A 1MX1A 3G1TA 2OENG 3HP7A 5FO0A 1K0UA 5KQSA 2JKVA 2DTXA 1PZXA 4E7PA 4GXQA 4RTQA 5JSQA 2XEDA 1OI4A 1ZSVA 3JD4A 3GLFE 1J2JA 3IJ5A 3NMUF 3CNQS 3D2BA 4W5TA 2OOKA 5A4JA 3TQRA 4AP9A 3LKZA 3NHFA 1AE1A 5GJVC 4YO7A 2J45A 5DGIA 3THXB 4FFVA 2Y0PA 4CM7A 2I6XA 1EFRD 3GLHB 4GX0A 2IXEA 3OCVA 4GP6A 5JOQA 4IJUA 3R75A 4DJAA 5BSWA 4U2DA 2TECE 1P2BA 1JU9A 2NT4A 1Z25A 4XX0B 1C41A 5EJGA 5L4NA 2ISQA 1FL9A 521PA 3GCGA 1VJDA 3KSZO 4D7AA 2R7AA 1G20B 1CRQA 4UW9A 1O4WA 3TLEA 1WZCA 3HXLA 3CVOA 1PLJA 3DOIA 3L0PA 1RE1A 1V4VA 1SULA 5EG5A 4F9FA 4KQHA 3CVJA 2C2WA 2X9QA 2EFHB 3G9UA 3NDJA 3OMLA 3PNKA 4L8LA 2VDKB 2ZJAA 4S24A 5TQ0A 1ONBA 4D92A 1X7YA 2PXXA 4IIYA 5EINA 5T8KA 2WTMA 1ZDMA 3QUAA 4YCLA 4U6SA 3IUPA 4DLTA 3C3KA 4HWSA 2E48A 3CRNA 3ZI4A 2QIOA 1AX9A 4X1KA 4A73A 3W5JA 4MRMB 4O4HB 1UBEA 2XECA 4RVSA 3SKXA 3A2LA 2GAJA 4LYHA 4BTLA 3QLTA 1ZVJA 4OH1A 1F3LA 3HRHA 3E9RA 5ALKA 1M8FA 2NYUA 4PPYA 1MC4A 4X45A 3CVYA 2BEWA 3MC1A 1U8FO 3ADOA 4O1MA 4DE5A 5IM4F 3L7OA 1PK7A 3KBOA 3NBKA 1UIMA 3QBEA 1B3BA 4BKOA 3KSUA 1ENYA 4CZ2A 4ZIRB 4QA9A 2Y77A 1T1EA 1DWUA 1PG2A 3GARA 4I7EA 4KTVE 3GH1A 3G9QA 4MUYA 5COAA 3WR5A 3U16A 3LHDA 2C8KA 3N9IA 3DAYA 4EY8A 4YV7A 1REQB 2C3PA 4GWGA 1JQAA 2WSMA 3O94A 2H7CA 3QFFA 1TAUA 1GP2A 1ZISA 3IDZA 5ADHA 5LBUA 3I6IA 5HFAA 4MVYA 1P5HA 4B7CA 5SYNA 1E3LA 1JPVA 2FWNA 1K7FB 4GXNA 3W5AA 1I10A 1OBOA 1AS2A 4XQGA 4BNIA 5BW5A 2Q4TA 1TJ5A 3OTGA 2OO5A 2XKBA 4JB0A 4DJJA 1J21A 2QLMA 1TKAA 1XQVA 2IEBA 4FFBA 3ESQA 3QVKA 4LDQA 2OK7A 2QK4A 4HQKA 1W8DA 2WFLA 1HZZA 4JBWA 1RHMA 1ZX1A 4K03A 2HA6A 4KSBA 3RAEC 1VHLA 1HZZC 5I8PA 5FPQA 4DQUA 3PD1A 4OQZA 4QBTA 5A6SB 4MZDA 3LUCA 3DCNA 4MCJA 1GZ7A 3RIHA 4G0WA 4LOHA 1L5GB 4EA8A 2PUCA 1Z17A 1ISPA 4DIMA 3T5AA 3GI1A 4URUR 2VFAA 1A4UA 1IHDA 1V37A 2YWEA 4P3OA 4ER3A 5C9ZA 5H68A 1TM1E 1KZHA 2WFZA 3O26A 3Q41A 5B3AA 4LBYA 2IYRA 4PHCA 4O4IB 5DNAA 5HRAA 5TPZD 4BP3A 2CUNA 3G17A 1GGHA 3P32A 2QU8A 3CA8A 4BKQA 3II6X 3QWHA 2KWIA 4IQ0A 1B76A 1Q7CA 3PCRB 2PXCA 4H1HA 1G8SA 4NQRA 3T3IA 5KVVA 3E05A 3RG2A 2V1XA 1SFRA 3M6UA 2OHGA 3UATA 4YDHB 3WY9A 3A36A 1S2DA 5EE1A 5F7OA 3RVSA 1SUSA 4NE7A 4H17A 1X9GA 3WGGA 4ZVLA 2WQ7A 5K6RA 1G21E 3FVRA 5K6TA 1H85A 3HI4A 3R9KA 3RC3A 3JQ7B 3W7AA 2JKZA 4GSYA 4M83A 3DXYA 2C5HA 5JJIA 2V7TA 2VC2B 4B17A 5HE8A 3MWLA 5GGYA 4ZI7B 2FPPB 2WAYA 1T1RA 2YNMC 3HFSA 2IU0A 1EJ2A 1CD5A 2I4MA 2JLRA 1U2DC 4TVBA 1J2YA 1MT3A 2D1SA 2JFFA 3ELYA 3NHLA 4ON9A 1GKIA 1F1BA 3C8ZA 3F98A 3I39X 4RIGA 1WP4A 4KZKA 5B2ZA 2FPXA 1P4GA 4EDHA 3INGA 4Q48A 3FVVA 2FTKE 1PJTA 1H69A 1XEFA 4P31A 3SP1A 4ARSA 4B83A 2JGLA 5BV0A 1J8QA 4K6OA 4XGIA 1KI4A 1AURA 2NZVG 4V02A 5BORA 2JB9A 1V48A 4QU9A 5ERGB 3MS7A 4IJMA 3DE3X 3VNBA 1LK0A 4Y1EA 1YRYE 2VBFA 3G9ZA 3C2QA 2JBAB 4U1RA 2R8ZA 2XVXA 4LEIA 4GP9A 4DLVA 2GTIA 5KX5B 4B87A 2AIRA 1A5ZA 3UJNA 3IKTA 1YKGA 1O94D 2AJ8A 1AB5A 4KAJA 2XXAB 3OF3A 4CKXA 1WVIA 2OE2A 1O7JA 1T4DA 3FPJA 4OYLA 1V6SA 2J8ZA 2ZB4A 5AWFC 4Z51A 3C1TA 2Q4EA 5JZSA 4BP8A 1B93A 4N76A 2C83A 4ZYYA 3FDZA 3L41A 3TL3A 1R9MA 1ADCA 1D03A 4ZDKA 1USVA 5BW8A 2JGEA 1OMOA 2A9RA 4G37A 2IRWA 2AYXA 4A03A 1XG5A 2GD0A 1ATIA 1SUDA 3DE7X 3K6RA 4HAZA 4R69A 5E1DA 1P1RA 2WTAA 1NW9B 1M10A 1N3IA 1Q0ZA 1RPNA 2FVYA 1Y33E 2PD3A 2ZBUA 4JUAA 3WIEA 3ONDA 4ER5A 3N8NA 3RS8A 4YAIA 4LY3A 3L5OA 1LW6E 4XCQA 5KNBA 3CE9A 1BDMA 3G88A 4LFBB 2FF7A 5SZJA 3G2LA 2OV4A 4MWBA 1Z45A 2F1JA 3NT4A 1QRRA 3NUZA 2PMWB 1T6NA 3T1VA 1FRZA 4S05A 4BX8A 3LJKA 1ZL0A 3A1DA 1AKQA 1PUIA 2R44A 2W6JD 1G21B 3ETLA 2MR5A 4GR4A 4UMEA 3RSLA 4QJ3A 1JE1A 4TMYA 1NVDA 4BV9A 4G07A 4KMSA 3AVXA 3REGA 3CFYA 2IQ5A 3DP7A 4RPJA 1QP8A 1QXSA 4JP3A 2RGCA 2GZ2A 2VVTA 2G83A 2YICA 3RFVA 1AHPA 3CRMA 1C29B 3KAKA 3IJEB 4XQ0A 1ECGA 1C3VA 1PJLA 1SKAA 3UWDA 5LVAA 4U0JA 1XNQB 4V0ME 3QXJA 3F9RA 4BFSA 2FJ0A 4JSYA 1MENA 3A2NA 4F2GA 5EJ6A 2HYDA 3DL2A 4FFRA 4Z0PA 5GZ6A 4H1UA 5COQA 4RMIA 5KMGB 1UXIA 1QDEA 2NTNA 4MVJM 5T5QA 2VHEA 1T5TA 3VR0A 3GIWA 5IUNC 3E7WA 4MI1A 1I4TD 1RKUA 1TD9A 4N47A 2BWJA 4TTRA 4MR9B 3WAGA 4PR0A 3PNYA 2VJBA 4TQ9A 4EJ6A 5DEOA 3OZTA 3D1JA 4Y0VA 5BWMA 4D3ZA 1VE1A 2B1IA 3UJCA 1W5TA 1WXXA 4NV1A 4CLHA 1U2QA 1LVGA 4KXMA 4G86A 1SIBE 5HIJA 3IMEA 3S8EA 3KB2A 1Y8RA 4R1OA 2VHWA 4MMYB 3TM5A 1KERA 1RYBA 3ZCVA 4MMZB 5TQ2B 1M5RA 2RAPA 3R5JA 1Z4LA 1UDCA 2BSXA 5L7YA 4NENB 1Z07A 3LP8A 1SKUA 2WIAA 1X1QA 4QQNA 4RVDA 4ALMA 1KRHA 4JLOA 3CUKA 4EW3A 1T5SA 3GAZA 5JS1A 1JHDA 2WK1A 5KC8A 4HQOA 5FWNA 4CG0A 3I58A 2RGNA 2Y6VA 4FLMA 2FX5A 1T5OA 1XRQA 4N01A 3P26A 3BJZA 2QGNA 4BQEA 2GXAA 1RLUA 4CMAA 3DQQA 4G84A 2E89A 3PHJA 2OTCA 2DPYA 3AJEA 2GHTA 2VJAA 2ZROA 4OB7A 5U4QA 3UGJA 4BGDA 1M0SA 1Q74A 2R6ZA 4YJFB 4ACAA 1HEUA 1GAQA 3VV2A 3F2VA 2VK2A 1MU0A 2G88A 3GL9A 4U6NA 4KQJA 4MGEA 1BEZA 3DWIA 3ZJ5A 1AKNA 2BFAA 1Z47A 4BBAA 5KVQA 4ZI7F 4KNYA 4EENA 4F4FA 3HYLA 3P0RA 2AMLA 3Q3JB 3PTLA 2GPSA 4RZIA 1WAMA 2VJPA 1E2DA 1PTJA 3GJ5A 5T4EA 4B0PA 4B8YA 4TSFA 4C2AA 4RTSA 1GPAA 1R3UA 4EI8A 2FPOA 2FEAA 3V48A 1Z3IX 4GBMA 3ZLTA 5DRYA 4G01B 1KR2A 4YP5A 3IPCA 1MZPA 4PZDA 1R5BA 2PU7A 1KMNA 1MA0A 3KT6A 5BSGA 1FZTA 2ANCA 4QT4A 1TD1A 2PU5A 1ZBQA 4UHKA 1DKQA 4HAIA 4AKIA 4H9GA 3B8EA 4B6RA 3L43A 3NOXA 1IHPA 1GSOA 1KHTA 2XYGA 2I7VA 3OA0A 2JEOA 1Q1NA 4M22A 3GFSA 2WABA 4Z7JA 3RVNA 1XD2A 1KDZA 4EJ2A 3KOWA 1E96A 2YCBA 3GCXA 2WM3A 5LB2A 1QVZA 5K0LA 1E2UA 2YZNA 2FCRA 3TMYA 3P4YA 1EGHA 2EGUA 2DTEA 3AC0A 3TZLA 5JS8A 2QN1A 2FSFA 1PGPA 4QLAA 4C4SA 2EYUA 1P2VA 4EGFA 2MT9A 3IHKA 3HCAA 3R5SA 1LEHA 1RXEA 1V8FA 4TKUB 1XMPA 2B37A 4OQNA 3WLNA 1N2CB 4FWBA 5FEUA 3RYIB 1PAUA 2CNNA 3IDQA 5BV8A 4E2WA 6Q21A 1YZ3A 3PWSA 2HQOA 3SWWA 4INOA 1NBAA 3AY7A 4UQLA 4M7WA 3RVJA 4H0NA 1R5OA 4DLYA 5CBPA 3JD2A 1IPHA 3I04M 3NIGB 4B75A 4D8XA 5AVTA 3ZWDA 1QK3A 4DC0A 1A97A 1FDWA 2XDQA 1S5PA 3P0IA 1IFXA 1NASA 3SJ7A 4LTMA 1GEEA 4C87A 4AG3A 1A27A 1WF3A 5A6SA 4TKVB 3W8EA 1DC6A 3C6KA 4HLNA 4PTYA 3WL6A 3ZCPA 2V6JA 2D1QA 5FR1A 4UOEA 4DJDC 2HSWA 3Q12A 5HJEA 3IAXA 5KI6A 4HWPA 3QEMB 1T0BA 3ASVA 3L40A 1JSLA 1SVOA 1PFGA 2ID4A 4MW7A 4DA0A 4RD0A 2ADFA 2QVZX 3T5BA 4R1LA 3PCXA 3HDTA 2EWMA 3A3KA 4PAGA 4W8GA 1M2OA 4FTWA 4YA6A 3SICE 4TV9A 4BX3A 8OHMA 1FSPA 1TO2E 4LXXA 3IPXA 3OETA 1DS6A 4PZAA 1XNJA 4TRMA 4HGNA 2FCAA 1OI7A 4RHFA 4UATA 1X0XA 1SCKA 2EZTA 4LIPD 3TKLA 1DQZA 3T9BA 3TR5A 3H2YA 5A7GA 5BO5A 3TEJA 3LFHA 1ZMBA 3S4YA 2QL9A 2DKNA 3GK3A 3JQAB 4K8OA 4MR7A 2XNSA 3HJGA 3S70A 1QGUB 3DBRA 5JMTA 3CNOA 4G5OA 3MCVA 3NWOA 1J06A 2QRJA 5FLKA 1FXSA 2H63A 3MW8A 4AO6A 1G8GA 5JD5A 3G5AA 3F49S 1C30A 1GR0A 3X43A 2BGWA 4HH3C 1HWYA 3B1FA 4BNGA 2O8BB 2PWAA 4FFWA 3HG7A 3CZPA 3GLRA 2UVPA 1PK8A 3BIWA 4RYDA 3SX0A 4G0VA 4ARZA 1Z0DA 3V80A 1CFJA 2XMDA 5BSMA 3LY5A 4FDUA 2XDQB 4GLJA 1FTNA 2WMOB 3OLVA 5COBA 1SCDA 2FP4A 5IKEA 3DMTA 4BVAA 1Y1RA 5JRJA 2JCSA 2IL1A 2QTNA 4H18A 4UD2A 4N12A 1CP3A 1I0ZA 2OXEA 4DA6A 1JAZA 2P6MA 3CF2A 4EB6B 1B8VA 1NRJB 2F62A 3CT4A 1JEAA 1TW3A 4HTFA 3RODA 2VK8A 3GCWA 1E4YA 3LO8A 3QVSA 4BLUA 1YFLA 2P7HA 4HUJA 1DKOA 2MSCB 4PZ0A 3VKGA 5KNLA 3LY7A 3UT5B 4LRWA 2X2OA 3RSHA 2F67A 4CMIA 2DJ5A 4EDFA 3FI9A 2C5BA 2ODTX 4HBZA 3REFA 4J1SA 1US8A 5PGMA 2X6RA 3RASA 2YMLA 4C01A 3D4PA 2GHRA 5P21A 2PZBA 2BH2A 5GJBA 1OFUA 2ZIVB 1I2CA 3NOQA 5IXJA 3F5SA 5B4TA 2ZE5A 2H4WA 3JQAA 4ZDIA 1X94A 2B7LA 3AR3A 3LKVA 2YXLA 3UCFA 2QEQA 4LTNA 1T8UA 1MHPA 1YCHA 1QHNA 4HNSA 2WJGA 1A7JA 1KSFX 4NXNB 3DOHA 5CR9A 5BRAA 1TZMA 3CPEA 3Q87B 4BLWA 5DXJA 3VYUB 1PNRA 4PIVA 4RDCA 1BE6A 4NG5A 3HBAA 4L7QA 4M99A 1QIMA 2D2FA 2RDMA 2WJ6A 2YIVX 4O8ZA 3SNKA 3QOYA 3WIOA 1NLYA 3QFHA 4JOQA 5CEJA 5K8IA 3UENA 2GXSA 4M86A 4MAMA 2BI8A 3LBIA 1GZ4A 1I7LA 2WE7A 3A9CA 1OD6A 4PYKA 4X61A 3SBOA 4K7JA 2I4RA 5MDHA 3SEFA 3PEEA 2GPAA 4UBIA 5HF5A 1UAYA 4B2LA 3MJ4A 2F4VB 4FMCF 4RPHA 3ZWNA 3GGCA 4AWAA 4KQMA 3VPXA 3LF1A 1PK9A 1WMBA 3RYCB 2EFDB 4Q1EA 2OK8A 2GK4A 3RLIA 1MOZA 1JIXA 4L8GA 4W9RA 5D51S 3DVQX 4G41A 3K9HA 4R84A 5BN4B 4ZGWA 2AVNA 4TTVA 5AD1A 1ZCBA 1E1NA 1JU4A 2G77B 1WVMA 4X1IB 1OW3B 1A82A 2A92A 5KJCA 3CZCA 3U37A 1VJCA 4XR4A 5FB3A 1KYIA 1ACJA 2AFHB 1UCFA 2YJNA 1TTPB 2HMWA 1Z74A 3M5CA 4U7PB 4EK9A 1BMFD 2VNKA 4CN8A 3DZ8A 3Q9NA 3D6NB 4GUAA 3SXJA 4QATA 1V41E 3FN4A 4MDHA 2PRIA 1KFJB 1ZD9A 2H4HA 2VJMA 4MWGA 4IIHA 4PZEA 4PVCA 4ZAZA 1GKUB 3LY8A 5TJ9A 3TFQA 4UTNA 1WCXA 2GH1A 1R6XA 2VPYA 3FFTA 1DKRA 5DYGA 2WF6A 5LZ7A 1PFKA 4GZLA 3K0KA 3AHGA 1XV5A 1QOZA 1T0HB 2DPGA 2EFCB 2NT3A 1DPGA 3W4IA 3MWDB 4E5UA 2HJ9A 2RGRA 3HXOA 3PNSA 3E53A 1RCTE 3TX6A 5I7RA 3WAJA 2IGTA 3SBEA 1V2GA 4YUVA 3UPTA 4ZCRA 2XBMA 3F8SA 1JR4A 2VHUA 1T9DA 3D8TA 1Z36A 4F72A 3PPYA 2R8BA 4YJDA 4JJ6A 1SRQA 1E7WA 2BDUA 1ONNA 4XD7A 5LLSA 1E5TA 5JQWA 1N3YA 3E84A 1P9LA 1X1DA 1XLTC 4XM1A 2RFLA 4ERNA 3MIIA 5H02A 3X1KA 4Q3BA 1LNQA 4ZOLF 5HK8A 3HU2A 2C42A 3OQJA 4DDKA 3O7MA 1Z22A 5JSFA 4W6QA 5KVAA 1LKZA 2ZR8A 4X7BA 1FFDA 5CM8B 2BAGA 4RTLA 1ADFA 1F8GA 1YB4A 3UMVA 5TLSA 1UAAA 1QLWA 4YMTA 5MHTA 3UHPA 2B7BA 2IXGA 1I94B 4Z3OA 1ZNQO 3MWJA 4Q7EA 4QHTA 4OHZA 1W25A 2WE8A 3O1LA 2BGIA 1L4FA 3L8EA 4M1KA 1B0PA 2Q9UA 3E27A 3OE1A 4DABA 1K7CA 3NKVA 2WUDA 3WDSA 1DJPA 1KFCB 2OCLA 3FNGA 1ODJA 4OXYA 2XWPA 2X13A 2F8LA 2QTLA 2FEWB 4TS3A 3I62A 1JR6A 4RPGA 2O3RA 4M7PA 1YIDA 4C0WA 2OGUA 3WRVA 5JJ5A 1D09A 1GADO 4IMRA 5AW9A 3WFIA 3KB1A 1AOXA 1PQ4A 4NBRA 4E5DA 4F11A 3TNJA 5I6DA 2QMOA 4ZV4A 1NW8A 1N3LA 1SKYE 3GUHA 3ZDXB 2W2NA 4B5KA 3ERCA 4QGAA 1QVRA 1ZUNA 1X8LA 2VDUE 2XUIA 3HA2A 3FE2A 3M8KA 4QPCA 5DTQA 3UAZA 1N36B 3S6JA 2Y71A 1FY2A 3F1KA 2ZGVA 3TVDA 2EBWA 1EP1B 4CKZA 1NHGA 4BVLA 3D6AA 4YREA 2P6NA 2J3HA 2P9HA 3B52X 4G0PA 4QELA 1JB1A 4MHOA 4RKEA 3W8FA 4CMKA 2PBFA 1PJQA 4WNYA 1TCVA 1TK2A 2HIHA 3D6FA 2G5TA 3RIYA 1NE7A 4KYVA 1JBQA 1UBFA 4BNXA 1CE8B 3MSXA 4OATA 4X90A 2KI5A 4I6GA 1JJ7A 1RADA 4N03A 3TXXA 1XTSA 5IP5A 1DQRA 3KKQA 4ESVA 4N49A 3VI3B 4B80A 1JJBA 4CF6A 3BWDD 3L7IA 4RGBA 4ASUA 3QM1A 2IYEA 1UBCA 2PT7A 1PLLA 5K9ZA 3F3KA 3PVZA 2J5XA 4OSPA 5IBRA 4A6EA 1X0VA 2EF1A 3OJEA 4E70A 4TL9A 1M1NB 3A4TA 1PV4A 1AO3A 4G09A 4S3MA 3PI6A 1RYHA 3WLPA 2WNHA 1S2OA 2O14A 5FFNA 4ES6A 3ZXYA 5JCPA 1Q7BA 5SV2A 2ZYRA 1E2BA 2NU8B 4LF9B 1RWPA 3CVVA 1N6IA 2PCLA 1ODTC 4NONA 3IEMA 4OM7A 4ABTA 3IA2A 3JRXA 5FUWA 4FVTA 2Q8NA 3CRZA 3L7BA 5AYVA 5FBRB 1FC0A 1PL8A 2EGHA 1EVIA 1WNTA 3PD7A 1Z2EA 4IMJB 4LNUA 1AG9A 4L08A 1FMCA 3PFFA 4I9NA 3THSA 5LP6F 3P1JA 1FF9A 3TW6A 5KOHB 3G8DA 3LGAA 4EQ6A 3I5XA 2E85A 3HDJA 4Z2AA 2R96A 3RSFA 3R9WA 3JAWA 3NX4A 5SZKB 3V7FA 1N2OA 2YKGA 3RREA 2Z5FA 1KIMA 2AS0A 3PS9A 1QMGA 1C1YA 3WA7A 4NOMA 4MQUA 2DEUA 1VCOA 3LUJA 5ITSA 3DQZA 1TQ4A 4KBFA 4WNAA 2R8RA 4J1NA 2VZ8A 2O6LA 1HDIA 2G28A 5FR2A 1O9BA 1PV1A 3DE2X 4IDQA 4O2AA 1ORIA 1QRUA 5LOVB 1I3CA 1GRQA 3QU5A 5J59A 3SPXA 3NPAA 3B53X 3KPJA 3V6MA 3I64A 3G68A 3KVNA 3ZJTA 2AG5A 4P8RA 5EIBD 1IXZA 2FFAA 3FPBA 3K05A 3L1HA 3Q0EA 5TY0A 3W90A 5JSHA 5GIPE 3AF0A 4C78A 5LXTF 5C5EA 5LQUA 1D6JA 4JB8A 1P17A 1P74A 1RPTA 2FX2A 5ED4A 3OVMA 3OZ7A 4HNAA 2WV7A 4O4JA 5KWIA 5AJZA 1AO0A 5EMNA 3I53A 4PO9A 3W9UA 5EJEA 2B8WA 3HN7A 3MAJA 4DARA 1FUUA 4IVNA 5KCZA 2VWHA 4HRVA 5IBQA 3HA5A 2ZU6A 2JLZA 2Y4OA 2XXBA 3QF7A 2NVUA 3TZHA 4AJ9A 1RWMA 1IK4A 4MKIA 4X8HA 4JMPA 4MDYA 4OYHA 1JMYA 2X7JA 3AI2A 1BD3A 3OPNA 1BS1A 2X3UA 3IHWA 4F0JA 3B2EA 3JRNA 3RUAA 4CFSA 4LFCB 4MWZA 2O3JA 3FKSD 1FXWA 2C82A 1NQOA 1N2EA 2YDXA 2YRWA 4TV8B 1I5OA 1M2NA 2NTJA 1AHHA 1EXMA 2C00A 3IQIX 4M53A 5FBZA 3SYRA 3UJ6A 5ISMA 3RVPA 1BX3A 2IOHA 2QMEA 1JVNA 3CW8X 5A7FA 1U9CA 1CW2B 4UJ5A 4ZQHA 3ZCUA 3WLHA 1Q21A 3KOZA 4JLMA 1OX6A 4D9FA 1LRLA 2WYHA 2DE0X 4YWHA 5BYAA 1FP1D 2QMYA 4C6TA 1ZMXA 5C35A 3MRTA 1U0JA 2IYQA 5G0VA 3NBXX 4DPKA 3E8SA 1EG7A 2WYVA 3DHEA 2ODBA 4TL6A 3RJTA 1TCAA 3P9PA 1OZ0A 3BZUA 3ZKAA 4G1FA 2IKSA 2P6OA 5GM2A 5BMVA 3OESA 1UMBA 7REQA 4KNWA 4R7TA 2HJSA 3PIIA 1WBDA 3MQFA 4NTZA 2VRNA 4F93B 2E6UX 3VJRA 2QLTA 3X2EA 4HYYA 1EUDB 3TDMA 3F96A 4REQB 5AVOA 4URHA 4TMWA 4ZO7A 1Z5WA 5EHGA 4OHPA 1JMVA 2X3YA 2ZBVA 2ZTLA 3DDUA 1BWQA 3HPRA 4JP1A 4K26A 2AJDA 2O2JA 3MCZA 4L15A 2VNJA 2PS9A 3KJQA 3FZNA 1AQYA 1BHO1 1MC5A 4KE6A 4OV6B 4EGSA 5AVXA 4E15A 1YXMA 1QCCA 3I9KA 2CWDA 3JAKA 4OBWA 1G8KA 2ZI4A 1VSVA 3KAJA 4N54A 2B8EA 3FOBA 4A0QA 3GFBA 5EUCA 1A8HA 2Y1XA 4ZALA 3PDHA 5EWMA 5DM60 4MUBA 1NMZA 2DUWA 3QKTA 4PXYA 1A8PA 1L5KA 2WJ3A 3ANNA 3GRYA 3BWYA 3TLMA 1A8SA 1KP3A 1JG6A 1QE5A 2QUKA 5TQ2A 3VDXA 1Q3HA 1JR3A 2YMPA 5FHQA 3LA8A 1F3OA 3GEGA 4RD3A 4DXHA 1ABFA 3R0ZA 2OMKA 3RSSA 1KY4A 4QTZA 2CCJA 4X7MA 3TQFA 1NQTA 1RYZA 1G1MA 4WCFB 3O74A 1H66A 3Q7TA 1B6GA 1C7ZA 2BI4A 1VMDA 1JIQA 2CC2A 2VH1A 2JD2A 3G2MA 3L4BC 3NC4A 3VX3A 3SC2B 5IABA 3JQFA 3OIUA 4EG4A 3L6CA 1YCDA 3NC0C 1BCRA 5K20A 1NM5A 4N6GA 1RVDA 3RQIA 1JHUA 2I91A 5JMPA 1H1DA 2Z8YM 3AM4A 4DEXA 1JSZA 2J0UB 3KNZA 4C43A 1GJRA 3DZJA 3DW1X 3U9TA 3Q0IA 2DVMA 1YE5A 2BIFA 2IE0A 2XYVA 4MLDA 3RANA 4WA8A 5DLPA 1I6MA 1KETA 4V0RA 2X40A 2ORWA 1TK3A 3KEGA 3ER8A 1JDPA 1PJBA 3QX3A 3PRHA 4Y0AA 5F9MA 2P27A 2I4NA 3UXEA 5B1IA 2YQ5A 4JYAB 4Z9YA 3UC5A 1PBNA 2VUIB 2WSYB 3KJNA 2TMYA 2XT6A 3OX2A 5DZSA 2G0TA 2ZWIA 3OIWA 2AW3A 1E3DA 2XA2A 3ANSA 4UMFA 3DC2A 4REOA 2R79A 3C0KA 1QB8A 2V5VA 2WUFA 3ITKA 3KHKA 2INGX 4V24A 5EWMB 3ENQA 2HK6A 3TZBA 1QHXA 3DCYA 2VN8A 3TSYA 2QRQA 2DYKA 2H9IA 2EX0A 4J4TA 3TLXA 4PICA 3ODPA 4DCPA 1YQGA 3BMQA 5EY5B 1XYVA 2VNIA 2JGDB 2XQVA 2B2XA 3U1VA 2VYCA 4I46A 3OZGA 3VR5D 4D8VA 3F67A 1QCZA 2FSVC 2R8OA 3BVPA 4AC9A 5B1EA 4QJBA 1HGXA 2YYSA 1EFDN 3R20A 4OHYA 4F71A 2IA5A 2RB5A 1Y5LA 3K96A 3B5IA 3DFMA 4Q4AA 4QTUB 2YS6A 3T5DA 2B1GA 5I9TA 4CTNA 3U0VA 3FHTA 3ZV6A 1EVZA 1UWKA 2O23A 4EKDA 1RPZA 1OLUB 1E64A 2PX3A 4LXQA 4L1KA 1BQ3A 1BN7A 1GDDA 4Q37A 2D6FA 2PT5A 1GPLA 7YASA 4OMDA 3N6RA 4P32A 1ORVA 3FGZA 1P3DA 3HSSA 2QP3A 3DC7A 4QAQA 3S99A 4B6GA 4F3CA 1WY7A 5BWNA 1IBCA 5DHUA 2XVYA 1GNSA 1S8OA 4C4XA 1IYZA 1ILEA 2RGXA 1K6XA 2JDIA 2ZUFA 2H1FA 2MYNA 1Z8HA 2BFDA 4FDAA 5CFMA 3WRYA 2PBRA 1U5CA 1GU0A 3HKDA 3AIKA 2BFWA 4WESA 4BNDA 1EXVA 1VQ1A 2VTDA 2UZ4A 5ECGC 3EQZA 4F8YA 3EC1A 1E1RA 4JROA 4KLRA 4LDNA 4MI3A 4TLMB 4ZEXA 4XOUA 3S7TA 2HK8A 5KU7A 3PGA1 3M7IA 1CSEE 3RRNA 2VHZA 4TTQA 4KLCA 3AFIA 4FGUA 1U3UA 5ESDA 4U2FA 3G49A 3TMKA 3MIZA 2J6BA 2XMGA 1MIOB 4TWZA 1XZFA 4G23A 3DD5A 4RVOA 2C07A 3LTEA 1YCGA 4YFYA 4AJLA 2V9CA 2XV1A 1PJSA 3AETA 3IP5A 3WDMA 1XUOA 5JO9A 2PYIA 4YJ2A 1Y1QA 4LHWA 5K3FB 4UJ3A 4DY4A 4D8UA 2H16A 2V98A 1E3IA 2OL4A 3AH8A 3LCUA 2VRCA 4NV3A 3IQHX 5K6AC 1N2IA 2VP9A 4G8JA 3VU8A 2VSOA 2AUTA 4WRRA 4QOEA 4ZOCA 1TM5E 2QBYB 2UYOA 3HVRA 3K09C 1J07A 3N2GA 1BXRA 4L5CA 2QMZA 4GPIB 4WUVA 3Q0TA 2VT3A 2O8FB 1BRMA 1C0EA 3AZPA 4PLZA 2QTVA 2FRDA 3RDPA 5JI3E 3KLMX 1GL6A 1RJFA 3B1YA 3LX5A 3Q6MA 5D3MB 2A7XA 3EPHA 1OFGA 2A1TS 1YVDA 2XB8A 1NY5A 3DYVA 3KS9A 4M1EA 2B98A 5JSUA 4YRZA 3DZHA 2AZ4A 1V9LA 5IM5A 2XODA 2A5YB 5AM3A 4LI0A 1MGOA 2EZ9A 2R4TA 3HDVA 3GCDA 1JHRA 1U3GA 2OG1A 3I09A 4X92A 5FA8A 1TJ4A 2HKIA 1K8QA 2H08A 2Q5LA 3CRQA 3E1GA 3OURA 4IJ6A 3FVTA 4YCBA 3SVLA 3AB7A 1W1UA 4D9JA 1HV8A 2CXXA 4WESB 4YROA 4BNDB 4NJMA 4UBMA 4YYZA 4A82A 5J2UA 5JBQA 4ZOAA 3TD2A 4QFMA 3OCUA 3ABOB 3IB3A 3NP7A 3IBTA 2CHQA 1Q0RA 1VKHA 3I1IA 5DHTA 1U2RA 4RHCA 4CKEA 1AMNA 4KDCA 4MYCA 4PGFA 4X91A 4D96A 2ZXEA 3DV0A 3TUIC 3W05A 2C88A 4DQLA 4E4TA 2V6BA 4PQEA 1RQ2A 4EP1A 3T9EA 4IJKA 2F1HA 3DP9A 5T6BA 2C20A 1GXSA 2HJWA 4MMXB 1VE7A 4IIDA 4NV0A 1F2UB 2VSXA 1KE2A 2W8BA 3LF2A 4HQ0A 2ZBQA 2Z4TA 4OJMX 4QDUA 5B1SA 2ZRBA 5FDFA 3UH1A 1IN6A 1WL8A 2C94A 1WV0A 16PKA 2H5IA 1E32A 3JQBC 3K72B 1TUBA 4OQDA 4XB2A 5ES3A 4AY3A 4DSAA 1BXRB 1WSBA 3HXMA 1II0A 4IF6A 1VE5A 3FYCA 2W6PA 2AC4A 2IQIA 2QRMA 1EWVA 1G9XA 3AUFA 4EWLA 2O2IA 4MJ7A 3OT5A 1LTKA 3N3AC 5E4YA 6YASA 2LZ0A 1BGVA 3L5KA 2VDRB 3OT1B 4JOCA 4ZQBA 4KFTA 4BE4A 3Q5DA 2GAIA 3H97A 4WAUA 3LP6A 5H83A 5I7SA 2P4SA 5DNYB 2RBGA 3GDGA 4D5GA 1GZHB 5EWJB 4P4LA 4N40A 3CRW1 1N4DA 2ZIXB 3KLNA 4TMFA 5F5NA 3VU0A 2Z3WA 3ZU4A 2AYZA 4AUKA 4BLRA 4C7VA 5CB6A 3KEQA 1RABA 1VJGA 2IU6A 1AN9A 2JA1A 3I8SA 3IHLA 4NHEA 1F06A 2VKTA 4FCVA 4UDYX 4Z9AA 3TLCA 2FMXA 3ZHTA 3PQEA 1NATA 4GEGA 4YRTA 5IVPA 3EOBI 3Q5GA 4NP6A 1QFMA 2GD6A 4LDRA 5FUQA 1M9NA 2XI4A 4IXDA 3JVVA 4TUYF 4AS1A 1RKBA 4LGCA 2FW1A 4LBZA 4GP7A 3D4NA 3RU3A 2V59A 4O59O 3NTRA 1UKCA 1UXOA 2P9TA 1D2NA 1Z37A 5NULA 3V8BA 3EVCA 2D0IA 5EGSA 1PUXA 2WT9A 3QBDA 1RI2A 4MTLA 4QGGA 2W48A 1E0AA 5FBLB 1L5FA 4PWZA 3TH5A 4CM8A 5CB8A 4P9NA 2G06A 3OQBA 5IG2A 2PZJA 4OREX 1PHPA 1UFRA 3AERB 4I36A 1ADYA 4MR9A 4WDQA 5L8VA 5KWVA 4CIYA 3UK6A 4CQJA 3KKNA 2UXCB 5B57C 2GA8A 1VHJA 1NAHA 4K9LA 2YHBA 1ZMRA 2G6BA 5CDGA 4JYBA 3AJDA 4FD2A 4DL9A 5IBPA 4XM0A 4YR7A 3P9CA 4LX8A 4PFJA 4F06A 5CB4B 1QTQA 1KY3A 1G59A 1J4AA 1SOAA 3T1OA 3LXXA 3G5LA 4R98A 3W2IA 3ENWA 1QX4A 1XA3A 4R54A 3ZGYA 3IQXA 1N7JA 2P2LA 2VDPB 3OIYA 2W22A 1TTQB 1KDVA 1GN9A 2CEKA 2HEGA 3OWXA 4NZMA 3C6ZA 3DFFA 4Q19A 4TX1A 4LYAA 1GZUA 2JHAA 4IVPA 3WNCA 4TVSA 3WK7A 1APBA 4R2JA 3UMYA 2YWFA 5DT9A 1E3MA 2QMHA 1FPQA 5JAPA 2HREA 3WXBA 4DR6B 4BO6A 2H8KA 4EG7A 1Y1PA 5HMLA 4M60A 4E51A 1OLOA 1XDZA 2HF7A 4PEVA 4TMKA 1J0XO 3BMOB 1HORA 1Y5RA 3BC1A 5DN6A 2OV1A 3A6PC 2EIXA 3VKWA 5I7WA 2O5CA 2BTQA 2DBVO 4KR9A 1B43A 5IH7A 1FFXB 1E9RA 4U7HA 1O0CA 2YHIA 2ODNA 3ZS9A 4FX2A 4O2BF 3BJEA 3PZRA 2W8ZA 3DOUA 2JJYA 1Z4QA 3P8ZA 1FNSA 2VWGA 1GQSA 1DEOA 4DLBA 3ZIDA 2Q2WA 1NVWQ 3FJOA 1CETA 4PLVA 4A5OA 4IVRA 4RZQA 2HDWA 2IYAA 1PG0A 2V7QD 4W1PA 3GLFA 3IPAA 4OGGA 4GD3Q 2D0OB 2VCHA 5KYYA 4LRTB 2FG7C 2CBXA 3EF1A 5HZMA 3ETJA 3PGVA 3QU7A 1ZI6A 2P69A 3E22A 1T2CA 3GH3A 4KB5A 1DDIA 5DM0A 1UL1X 1FZQA 2PWYA 4KVFA 3GZNB 5KC9A 5DM1A 2XGJA 3VNSA 4NH4A 4AJ2A 1W7AA 2CFSA 3G8BA 2HU8A 1E6KA 1U2TA 2AN3A 2VLIA 2R97A 1E89A 4IH4A 4LC9A 4RD1A 5KSYA 1OVMA 4RZXA 2Y9MB 4JJ4A 4XPIA 3D31A 3RK0A 1NXOA 2JDID 2I5PO 2ZRAA 1ODCA 3UHOA 2PO5A 4QBIA 1L8QA 4S1OA 5JI2E 13PKA 1A7UA 3F9IA 3N2ZB 3D3QA 4JELA 4TV9B 3C3XA 4RSMA 4ZEOA 5CEEA 3ETDA 4I4IA 5B3KA 5ED0A 2NAFA 1DC4A 4BN4A 4LWOA 4D9BA 3VR3D 2UZ3A 4FFSA 4QBHA 1D9XA 3UMBA 2ZRDA 2OD7A 3LCJA 4NU5A 1UKZA 3SM9A 3UKJA 2DWCA 4CG3A 1WPGA 1MJFA 1MT0A 2IW1A 1QTRA 1N0VC 2R6HA 2WM9B 3IJRA 4ZI2A 3HS3A 2LWIA 1PYGA 3FZYA 4ME6A 1CDZA 1NWCA 4N3CA 5EHQA 1AKYA 5B1YA 4WOBA 4DIBA 3L46A 5K3SA 5HOQA 3MVEA 3OKAA 3GNLA 4XQCA 3PEVA 3QWIA 1C4WA 4E3WA 3QMVA 3Q7PA 1EHYA 5K1ZA 4QSMA 3TAXA 4TLLB 4D3SA 3UV7A 1OHHA 2C1XA 4A2QA 2C31A 2H17A 4POOA 1WW3A 3W3AD 8AT1A 5HWSA 4MAAA 2I3ZA 4K2AA 3EIOA 2VH5R 1IN7A 2ID7A 2PT9A 4IZOA 4D46A 4EA7A 5CB0A 1QO0A 2Y0EA 4BJ6A 5BPFA 2KLHA 3H5RA 2DQYA 3SS8A 4JLDA 4XYLA 1T3SA 2VK4A 1OVGA 5IARA 1HFWA 1RKVA 3MJSA 4JEMA 1E7SA 3M82A 4G4IA 4RZSA 2XRYA 4C14A 2QTMA 3ZZTA 4PX9A 3ILHA 2IFTA 1M75A 1VKJA 4YAGA 3REOA 3IAHA 4AW9A 1VDZA 1UM9A 1SRRA 1MN6A 4DVJA 1I7QB 4OFWA 1QHHB 1OX4A 1W73A 4GFDA 5I9BA 4ND8B 4BFYA 5I7HA 1ETUA 4MQEB 2R84A 5CBKA 3C4VA 5FUYA 4FCCA 3B78A 4OBBA 3WBJA 1LZLA 1V9SA 4YV0A 5KQGA 1ESCA 2PGJA 3WB2A 3L7AA 4MWSA 5FNVA 3BREA 4MIEA 1UMBB 2DBYA 1N8NA 4M8KA 5GPBA 4BMSA 1JBEA 1MC1A 4JITA 1OWLA 3K8OE 5FUMA 1P1CA 1C8BA 1H6AA 2GZRA 3B70A 5GJCA 4KN5A 3QEAZ 1ZG3A 1Y8ZA 1Y3DE 4COKA 3PR1A 4BJ1A 3UFXB 1IOLA 1KI1A 4K86A 1FNMA 3MNFA 2BGNA 1H3FA 1ZK1A 4I4LA 1XMJA 3TBKA 3W9SA 4ZYZA 4J0HA 1D2CA 1BS9A 3ZLJA 2JGKA 2AFIA 1DBVO 3WP0A 1GCIA 1PR6A 2B1RA 4P0TA 1D4FA 1DWQA 2FUCA 5HTKA 4OMFG 4TXHA 1S3IA 1KEZA 2QZPA 1AXRA 1YDGA 1DWPA 1VIYA 4UEKA 1QU3A 5IJAA 1Z4JA 4M8SA 2H7VA 3VNQA 2DKFA 2ZT6A 4NNOA 1KI7A 1XEWY 4HGZA 2BJWA 4O4JF 3TBFA 5KYKA 1VLMA 3E3NA 1TZCA 4OSOA 1SB8A 4X63A 4Y1RA 5TVKA 3ZE2B 4NXMB 4KQIA 4MVJF 2XCLA 1T3LA 2GCGA 2XHZA 1KMIY 3LM8A 4RACA 4UM9D 5AVRA 3MTEA 3I0NA 2GHIA 2O4UX 3EBPA 3R5TA 1QF9A 3AR9A 1X87A 3BB3A 1HA3A 4MUFA 2WJVA 4D02A 5ECYA 4EYOA 2UXBB 3EG9A 4YGXB 3T7DA 1J0BA 3O8QB 4CT0A 2NSHA 2IS6A 2B78A 4B7UA 1W85B 4GOJA 5JROA 1UC4B 4J3NA 2YVLA 1ZLYA 2IY9A 3M6IA 3VR5A 1L4NA 3GZ4A 4RELA 4A0GA 4B6PA 3M4JA 1BGWA 1WZUA 1JZSA 2Y4NA 3CZRA 2P4UA 1LSUA 4PLWA 2ZG6A 1B2RA 3EY9A 2XOXA 2OUKA 2Q0QA 3ZNNA 4KITB 4U7DA 3SIWA 3I37X 3P27A 3LTNC 1PFUA 4Z3KA 4Q7QA 4H31A 1QGDA 3RBZA 5U1PA 3NCHA 1C7JA 1NN5A 3I5UA 2ZRIA 3U3JA 3U3MA 4BKRA 4FYKA 1XP5A 3ZV7A 1L3CA 2P41A 1RXIA 5UKDA 4C3UA 2HPVA 2WWHA 1M8PA 2J09A 4KBYA 3J81A 1NBEA 3AI1A 3KJFA 4AT1A 5DNUA 2EJCA 5E2IA 1M8JA 1XI2A 2XOKD 4TTSA 2UU9B 4ENTA 3N2EA 5G0UA 3IB6A 1NNEA 1QG2A 4C89A 4ZMSA 1JYSA 3LKDA 4IIGA 4DZZA 1H2WA 2E4ZA 2A0YA 3OM8A 4BDTA 2QJTA 2FSPA 3ZYCA 5F9HA 4JR0A 3LDAA 5TC4A 3SBDA 3VHRA 1K9VF 1YR7A 1M7HA 3I1FA 4NYIQ 3V2HA 2J4FA 3WYNA 1DTEA 1IMJA 2C99A 3WADA 2MMGA 4NMWA 4G2NA 3T3GA 5DNWA 1Q12A 4GPEA 1KJJA 1OWPA 1X8JA 2JK1A 4DPLA 4N7JA 1OZAA 2HD4A 4K6HA 1O95A 5BXYA 1H8ED 4XB1A 1LF0A 2CK3D 3B6IA 5ALDA 4CG2A 1RJ9B 4P1ZA 5IKOA 4J7CA 1VB3A 5HTOA 3NBUA 2H29A 4JOBA 1NUHA 3MUEA 5IAOA 4JUBA 3AHFA 3CEPB 5DASA 4MUEA 4WCVA 3ULKA 4Q4AB 3WMGA 1S8NA 2A88A 3PWKA 4AAYA 3JWIA 2E82A 4KQ6A 4XSGA 2IOYA 5LP1A 1XZGA 5SZIA 3V2GA 4OOEA 1EQUA 1HL7A 1EGVB 2QX8A 1GCUA 1HG0A 1Z33A 2YV2A 3FRJA 5AQEA 4BLVA 3HYCA 1HYHA 4FT4A 4ZZ1A 2BZSA 1G0OA 5ALTA 1SUCA 2A94A 5AJWA 1L8OA 2YXEA 4G0MA 4RL4A 4P7FA 1FCJA 1E4OA 3ZU3A 1DKUA 2EARA 2QROA 5IKXA 1DHRA 3EGOA 3AFHA 1QIFA 3H2HA 1QP7A 1I3OA 2VYFA 3ICVA 3SZGA 4QPPA 2AUNA 5DE3A 2IHZA 5AT1A 1C4XA 4Y2XA 5FTJA 4EY4A 2QVGA 2IH2A 3ZDCA 1ZOPA 5SY9A 3WIDA 1DCTA 2COUA 3MMXA 4LOJA 3VZBA 3UJ7A 4M1YA 3RARA 3TGWA 3M70A 4EB8A 5BN1A 4K0RA 4F97A 2GCOA 4M0DA 4TWRA 2VDWB 3VAYA 4AICA 5IF3A 1YBHA 4DCTA 4I55F 2GN2A 1SUWA 2P4HX 3Q3VA 4G67A 3MLBA 2PJRA 3OUTA 4WZAE 2P1ZA 3O1HB 1KYTA 3BTSA 3L0ZA 4PAQA 5IJZA 4Q4LA 3ZHZA 4FOSA 1CQIB 1Y3BE 1EDBA 2BMJA 3ZKWA 4DZRA 5L95A 4HEA6 2G1AA 2V4UA 4L73A 1Q95A 4ROSA 1GU7A 4OB8A 3EIUA 4M89A 4EKYA 2L18A 1ISSA 4YPOA 4E2XA 3KWFA 3ILVA 4WKOA 4KKVA 1FTSA 4LCJA 2CLDX 3D4IA 4MR8A 3UHFA 1ULBA 3HBFA 1WTCA 4MV6A 4DDHA 1G2IA 1PZFA 1OU0A 3PGKA 4Z4EA 2FUG1 1XMXA 3OKCA 2XLBA 3MOGA 1SCQA 2ZJ1A 1PJ3A 2Q9BA 4MVWA 4QG3A 4PLCA 3SVZA 3H3XA 4ISCA 4J16A 1DX4A 3H1TA 4M8LA 5DOZA 4W1RA 3GLIE 1M6EX 2PV0A 4P4GA 5F3RA 5AJVB 1ZL2A 5JV5A 4FB4A 2FRDC 3FSJX 4ZPJA 1VBMA 4YT8A 2ZIAA 1ORHA 1RCUA 3DFIA 4HNRA 3C97A 1V4BA 5DO9A 2IP2A 4KV9A 1V43A 4MGIR 2VAXA 3ZIAD 3EEQA 1SBHA 5FPKA 5BNFA 4CQMD 4JC5A 4EG5A 3PNBA 2ZI3A 1FLAA 1LUAA 3ST7A 1N8KA 2XYPA 5JZBA 1HKUA 1Z0KA 3AWIA 1HNNA 5ULLA 5CDUA 1XQYA 3H11B 1SIOA 4TSKA 4J0QA 5H0IA 2XDWA 1TXGA 1VSTA 2A5GA 3CEJA 3ZWWA 5K3OA 3R8FA 1YH3A 5ALOA 3L8ZA 3PJFA 4B73A 1COWD 1SD2A 4AI6A 3W4KA 4D4GA 5FWYA 3U4CA 4RNDB 1EK6A 1FSZA 3GUVA 5GP1A 1U1EA 1F9AA 2JHCA 4L3OA 2ZPUA 3A9WA 2P6UA 3IBSA 4MZXA 2M32A 2ACEA 3PRKE 2DX7A 4EKIA 2OYSA 4FCTA 1JKIA 4LRSB 3N2LA 5EJIA 1KQFA 1M6YA 3PXXA 1PDOA 2Q3MA 3DT9A 4JT8A 1ZZGA 3OHSX 1RU3A 4COOA 1TUGA 2PZFA 3CGWA 4B6EA 4CV3A 4C7OA 3B1WA 2FFBA 1KBQA 2JLCA 3CGGA 4CR6A 1O95C 2ZYWX 1T1SA 3LWNA 2HCFA 4J8PA 1OAAA 4L9SA 1QIKA 4PLYA 4NJEB 5JBIA 3QSYA 4AJ1A 5JPDA 1H2AS 1A9XA 3H65A 1ZCFA 1UR5A 2KMLA 2YJ4A 1CG6A 1JDTA 2IUEA 3GPLA 2ZYAA 5EMMA 1EK0A 2EQAA 3NGMA 4YJGA 1JAIA 2ENUA 4DJFC 5I9LA 1PJ8A 4A36A 1UBGA 1QC5B 2Z6VA 2H1IA 3K0EA 2YN0A 5AUOB 4LF7B 5D3KA 2YR0A 2FUG6 1LLQA 5IVDA 2NZ2A 5TIIA 4E21A 5HQJA 1Z7YA 3DKRA 4RVCA 4RTJA 4MA0A 1XKTA 4HYTA 1O5TA 2ICAA 1BE1A 1GCAA 1XROA 4IIUA 3H8VA 5FJIA 2IV3A 3QW4B 3O1JC 4QVKA 5FL7D 1NX9A 1OPRA 2G4LA 2OZPA 2MR6A 4LZPA 1GG8A 3ZHVA 4H7IA 1SPBS 2G0AA 3IDOA 1VOTA 2D4AA 2OFWA 1GQQA 2EBFX 2RAVA 3MELA 4PBTA 4BMCA 4FMBB 1RWWA 5HKAA 5G1NA 1Z15A 2BMAA 4NMXB 1CZHA 3AO0B 3LPAA 4IKOA 1Z18A 4YQYA 2X0FA 4O2BB 1M2FA 3MRVA 3CNNA 1XVVA 2CDBA 4OL9A 1KQNA 3PHCA 4M9XA 4DSOA 2ZRNA 1QVWA 2ZPAA 3R7BA 4G4SP 4MUIA 1G42A 1JHOA 1ZQ1A 1VPEA 3H2KA 5KHAA 1MV8A 1R4MA 2FFHA 4C04A 2JFHA 1KKUA 4LAFA 4WN3A 3R9XB 5B36A 1Z0JA 3JWJA 1SXGA 2DPMA 1IY1A 1QCYA 3VDQA 3X2SA 2WYWA 4E4RA 1G0NA 1OKKA 2YMMA 1Y82A 4OLJA 3R3XA 4I4TF 3EZGA 4WNIA 3DAHA 4ZD6A 1KH2A 2RH9B 2R6AA 1XQXA 4FOLA 3JQQA 2AG1A 3GJ4A 1BJRE 1UXHA 1IXRC 2BVNA 2RGUA 1M2EA 3EGDA 3MTJA 4FZVA 4YO8A 4XEUA 2IEZA 2H4JA 2ZETA 5LYJF 3K2IA 3ETNA 3IFSA 1SXPA 4NBLA 4GPBA 1IY8A 1JG7A 3AR2A 2VT2A 3CV3A 4AJPA 2I62A 2GPNA 4QQRA 4B7ZA 5MN5A 4UAUA 3CS3A 5BSTA 2PUDA 2VJLA 5HM8A 2VI5A 3RS4A 2FE1A 4QOSA 1UBMS 3LYLA 5C1OA 3OY7A 4LVCA 2WI8A 1GDHA 2O2SA 3N0XA 5H7XA 2OKGA 3E9YA 3UUGA 3EXFB 4B3CA 5B58C 1O9HA 1VIVA 4HPJB 4TWJA 2GNAA 1I7DA 4B33A 3IOCA 1TPZA 2CWWA 4DMLA 4WK2B 2V9PA 3OEYA 4B8ZA 2W2QA 4EPYA 2XVZA 3HADA 5C8YA 4PRKA 3BT7A 3AZOA 2Q28A 3PK0A 5F9FA 1IQUA 1ZD5A 3C3AA 3KTAA 5C8XA 1LV7A 1EFHA 3NRCA 4G85A 1IL0A 3MB5A 3HKCA 3PYMA 3ONEA 2JAQA 2RH8A 5EXTA 5HQ3A 3BOSA 1H0HA 2W2VA 2V8OA 1L4GA 1Z2PX 4ZK2A 5TXGA 3L6UA 1J5XA 1YFJA 3EF0A 1VYUA 2PS1A 2XNKA 4QVIA 2AXNA 3LAWA 1U63A 4AJOA 1Z5UA 4MA5A 5EEGA 4YRAA 3RSZA 1YZLA 4K6MA 3Q9LA 1AZSC 1OCEA 3HVKA 4ZT7A 2O05A 4YRMA 3AIOA 2O19A 1PFYA 1RBYA 4O33A 2Z9CA 3M2PA 4NULA 4OQLA 4Q16A 3OX3A 4TS9A 5G0SA 3W5UA 3GCZA 1YVPA 2X4IA 1B15A 4F86A 3QQ5A 3ON5A 3C4JA 1OBFO 3N2NA 3OZUA 4HWOA 4MLCA 4GOLD 3TLZA 1GIAA 1WXHA 2ZTUA 3B12A 3IUQA 5F64A 3MMPA 5IK2A 1P29A 2D13A 4Z4HA 4A0FA 1W36B 1OXUA 4OAOA 1NW4A 4J0DA 3L92A 3MPOA 2RKOA 3D6UA 1NMXA 1YUBA 1J20A 1V7ZA 1KGSA 2RHHA 5HFJA 1E2FA 3HB0A 4MIYA 1GG5A 3EA5A 2QL5A 4F84A 4D4LA 4WFQA 5T4FA 3TG8A 1RXCA 1D2AA 3TQOA 1ODIA 1Z4OA 4HVLA 4U7FA 1WPQA 4YUWA 1RLOA 1SZCA 1XDBA 2YVAA 1YCFA 3A1FA 3FNHA 4HR7A 4NAHA 4RZHA 2JAWA 4J7UA 2G80A 1S7GA 1RAFA 2H4ZA 4BYMA 4CRWB 5B4UA 3O2QB 1E2MA 1PW7A 1PTKA 3ANTA 4HGYA 1IEXA 4OL0A 3UJDA 2II6A 3BSFA 4M9ZA 1CUDA 5HQ3B 3P2KA 1ISFA 1WDMA 3K70C 1GQOA 1H2FA 3O8RA 3HMQA 3HP1A 4FYJA 1Y1SA 1T3GA 3AONB 3FWYA 4LS3A 4QUKA 2CMGA 1L4YA 1OI2A 1AQLA 5AKIA 3UAOA 4EHDA 1R5NA 1OFIA 4OP3A 4DANA 3CNLA 5JZMA 4ZYLA 3ITDA 3F47A 2XUOA 2OCKA 4LN1A 1R16A 4YP7A 1F0KA 4A91A 2BMFA 4BO8A 1OXVA 1U2PA 3CBGA 3UJHA 4D2IA 5EIXA 4CEIB 3KOXA 2DR2A 2RCYA 1WDTA 2ZOSA 3QU2A 3AFOA 3PHGA 5LQSA 4CCYB 1GYPA 4OXIA 4CKWA 3OTWA 4PYNA 4WZZA 1W5BA 1L5YA 1LBSA 4GIBA 4PCUA 1OX4B 3GRAA 4GQAA 2FYTA 4KQXA 3A4LA 3RROA 5C5DA 5IEJA 2HTEA 1PT5A 1YJ8A 1TIBA 2HIAA 3RG8A 4B3MB 2A35A 5KINB 1WUKS 3EA4A 3F6SA 2OVBA 3ORSA 2CGEA 1X7WB 4DQ0A 1ZD1A 5B7PA 5JC8A 5I4CA 1IQPA 3V4LA 1E9AA 2OCGA 3A1UA 1T6XA 2I78A 3NXSA 1KAEA 5EJ8A 2Y76A 1EAYA 1R50A 4TYPA 1OB5A 3HBMA 4AO8A 1U0TA 1GAWA 8LDHA 1PWEA 1W0JA 1LPPA 4TKUA 3GLUA 3LVQE 3KDPA 4RULA 5I7EA 6REQB 2GAAA 4M49A 1ZKMA 4DNQA 1BFKA 3E1SA 1F12A 1OV4A 2GBGA 2HA5A 3M5PA 1KTVA 4NCJA 2B82A 3E9EA 2CZGA 1I51A 3A1EA 2VF2A 1QH1B 4LA4A 2R0QC 2P3QA 1G7RA 4X1OA 5G1PA 4DKXA 1X80A 3D1LA 3JCZA 1TA0A 1LFDB 3PUZA 3DUWA 3GZTB 1YONA 3KJHA 1AU9A 3O8OB 2C2HA 2P2ZA 5B5SA 2RIRA 3DBLA 3NBAA 4ZT2A 3BBLA 2VJQA 4IRUB 3C3CA 3FZGA 3R6WA 1B14A 4B3IA 2YHUA 5T3YA 1BCSA 1ZJ5A 5TQJA 1FRVA 1ZKDA 5CM2Z 4AMBA 4XH9B 5DN9A 3SZ3A 3NANA 4C4PA 3IQFA 1AKMA 1JH9A 5I9MA 2ZP1A 3HUTA 5K0CA 4C4OA 3DFUA 2W00A 3UW1A 3ESZA 1JFTA 4IIVA 2WJWA 2XCSB 4FT2A 3SSOA 2W8BB 1CP2A 2J5BA 3ZJ4A 3M1IA 3NGLA 1IJEA 2P77A 2JGNA 4EHAA 5AKYA 2I1LA 1I3KA 4LW8A 5BW6B 3Q1LA 4ARCA 4A2PA 3VOTA 1TAHA 5FTMA 4HUQB 3AEYA 2YWXA 4FNMA 8GPBA 4IO0A 4YP9A 5JNUA 2LKCA 1NMYA 1E1DA 5EQTA 1VG1A 2WWWA 1JX6A 2D8AA 2IUSA 1K27A 3CB2A 1CJCA 1LK7A 1UPAA 1ZOLA 1KVTA 3GBPA 4JLKA 3PXAA 2OCAA 4TMVA 4ZYTA 3THYB 4PONA 3VOBA 4PGHA 5LU8A 1DE0A 3BE4A 3SK0A 4JMLA 1IRXA 2BKEA 1ZGGA 4JVLA 2UYYA 2B4TO 4FE7A 4MICA 4FGKA 4YT5A 4I81A 2DFLA 2C4MA 5D5QA 4TPKA 3L0BA 5LR6A 2OO5C 1MO6A 2EOAA 1SC9A 1W4AA 2NYAA 3AUKA 5HM6A 2PMEA 4LQDA 4X60A 5I3CA 4ND5A 1Y80A 2IEIA 3DOOA 3EA0A 4HVTA 2XLCA 3QENA 5J2TF 4FJ2A 3UUEA 1TGVA 2QT1A 4DDWA 3CZMA 3H1AA 4G5SA 4V1CI 1TLLA 1E3EA 4UDXX 3EZ7A 1QP0A 3D81A 1P5RA 4DIOA 4F91B 4ATNA 1K68A 3U4GA 1JDBC 1FNNA 3QVXA 4MQ6A 3AEUB 1OPXA 1TX4B 3BMCB 1UJ6A 4C21A 4ENWA 1C8LA 1EINA 5CA0A 3FLEA 2O4CA 2RMKA 3ZDDA 3OHMA 3RT1A 3ZW8A 2PLNA 1HE3A 3HSKA 3OFND 3JQAD 1JG4A 1PVDA 2OWEA 2R86A 2WWIA 3A7DA 1NMEA 2CSUA 1CEQA 4OBXA 4R2HA 5DK6A 5ALHA 3T3PB 3T4XA 5CLGA 3V7UA 4MS1B 1P33A 1RW4A 3NHBA 4BO4A 2FWPA 1KAOA 3A7EA 3ADKA 2I3AA 1E7MA 4QM6A 1Q0PA 2XWJI 1KIFA 1P2FA 2A14A 1TDJA 2YV4A 4TXJA 2ZVQX 1V1RA 1V3VA 3KR2A 2JAHA 2K5UA 2BFCA 3ZDQA 4BV2A 1YA4A 2EZ8A 1JIKA 3FXAA 3VZRA 2BD0A 1CS0A 2QLJA 3FOWA 3A10A 3MEQA 4BV8A 2NU9A 4QBKA 2WIBA 5JCOA 1X7DA 4IGEA 1KS9A 2QAIA 4FMPA 1MABA 1UKYA 1ZLXA 3B1ZA 1FA9A 3KUCA 4NZ9A 1A9ZA 1P7PA 5TMBA 3WWEA 4D57A 5IT4A 2LVBA 4CKBA 3HXPA 1IB0A 4LY9A 4WH0A 4RZ3A 4XEHA 4Z5XA 4ENVA 4Y8VA 3A1WA 5FV7A 4DLRA 2TYSB 3HZOA 3KT3A 4GKJB 1KQ3A 3BMQB 4K28A 4KVZA 4OK6A 3I45A 3UKDA 1UBTS 3WYFA 5CAEA 3QVWA 5E9AA 3V97A 4YBRA 1OZHA 4BWYA 1VSUA 4WCFA 5KYTA 1FJGB 3IQWA 4K1XA 3TDKA 5TPWA 2H7YA 1M33A 1DQYA 2GEKA 2GF9A 1J0EA 3P7MA 3UV6A 1MVLA 5JISA 5K8LA 2ARKA 2RI6A 1YR8A 3H7AA 3IVGA 3D6HA 3B85A 1ZEJA 4Q1BA 4CMJA 1KR5A 4UNSA 5ER6A 1LTHR 2VL7A 2BTQB 2IEYA 2QUZA 1Q5PA 3A04A 1H05A 3HKEB 3N05A 3T5CA 3BCHA 1GQ2A 1E9CA 3O82A 2ZB8A 4NNPA 2FZ5A 2ZSHA 2E5WA 3A1SA 1DDOA 5DJ5A 3KSDO 1PO7A 2X76A 3IT0A 4N39A 1W49A 3OZBA 6AT1A 1UDAA 2IXBA 4FJ1A 4MWTA 4P33A 3T5PA 2ESRA 3CT6A 3WZ2A 4DSTA 2WINI 1LWNA 3QTBA 4MUNA 3Q3HA 1XL0A 1YD7A 1E66A 1PZMA 2QM3A 2LIPA 3CZ4A 1ILWA 1JQ3A 2I8LA 1J23A 2KBEA 4O8CA 3PPVA 3ZHXA 1WY5A 1WZIA 1JKFA 1JA1A 2FG5A 3MS2A 5HDQA 3K0FA 4RZ2A 4HB4A 5JYDA 1V4NA 1H6BA 3RTCA 4IHJB 1LCIA 5JZVA 1KH1A 5A5GA 4XTRA 1BJKA 2D5CA 1GYQA 2R5FA 1PUJA 2B2NA 3EH2A 4RQTA 4M0UA 4CUKA 4OFBA 4LOAA 1QBKC 5KYWA 3RTAA 1E9DA 2A86A 1WQ1R 3N76A 2Q3EA 1QHGA 4I8IA 1H6DA 2P7IA 2OCDA 2BM8A 3FMOB 1TIKA 1BW9A 2AFVA 4QWWA 5DBFA 4BLSA 2ILVA 1CRZA 3UAXA 2QYOA 1K75A 2HFKA 4G4GA 2WIKA 3EC7A 2CXNA 1N32B 4FYPA 1B1CA 3OC6A 1JIVA 3U7EB 3K2QA 1GL3A 2QY6A 4XOIA 1TMKA 1VBKA 1ZM9A 1PR5A 2NNLD 3OLZA 4ZVTA 5TPWB 2H1RA 3SYMA 5JAHA 3M6AA 1U11A 1FBNA 4GYYA 4HWKA 1N57A 4YRRA 4DRZA 4F3NA 3DCIA 5DU2A 1X6VA 1LXCA 5LBIA 3IBFA 1ULTA 3MYYA 4YJ2F 3F7TA 4LHYA 2CLFB 4KH0A 2REBA 3AGQA 1WDLA 4BLTA 2TSYB 3B1KA 3UXHA 1A9SA 1IN8A 5BWCA 5D5HA 4DG9A 1RQGA 2LCFA 2ZJ5A 5C53B 3QFRA 2J5RA 1WQ4A 3O1IC 4PN7A 4XLTA 5EXEA 4AMZA 1R74A 2QR3A 3RV4A 1E18A 4WGGA 2CNWA 5K0SA 2ZJ2A 2X3FA 3ZY4A 4LK2A 5JNWA 2PUEA 4B3GA 4AJNA 3REQA 4BEBA 4Q7KA 4XFJA 4Y2HA 3X0DA 2Y68A 4EJSA 2EQBA 3X1MA 1GG9A 4WFKA 4EFNA 1Y3FE 3ECAA 1RQNA 2NACA 3L0YA 1MORA 4DHWA 5LP6B 3HXKA 2O7RA 5JY1A 5H80A 3DNMA 1I80A 4N0DA 1FUIA 1QZXA 1LNSA 1RMYA 1CY7A 1W5AA 4HN4B 3ZBUA 1G3QA 3TNDA 2IODA 3KJXA 4ZRMA 4R05A 4Q3CA 4HAWA 1NQAO 1X3SA 2AUMA 3L0IB 1FP4B 1TMYA 4ZJYA 4EARA 3FFBA 5DHQA 4YI3A 4TWIA 1XJWA 4Z7QB 2ZS8A 5JUWA 5IN5A 5JJCA 4UCQA 5LUAA 2YXDA 3ISJA 3LDHA 3RS0A 3L6RA 1JWAB 2P67A 4IFIA 3T0IA 3DVSX 1T15A 4I1YA 4NEQA 4LTDA 3WMWA 2JI4A 3DO5A 1VMKA 2YVKA 3GUZA 1WOYA 3JQGA 3W0LB 3W5HA 4ZOLA 3RRZA 2YDYA 5EJ4A 4DLSA 1K4KA 1PTJC 3S27A 4NYMQ 2DHDA 5EIWA 3GPIA 3B8HA 2EJBA 3OMXA 3ZGLA 3ZDBA 1YDFA 5T41A 4DYVA 1O08A 3B5JA 3PICA 2MINB 4AYWA 4JI7B 1I6LA 1WHSA 4JAVC 4DT1A 5HR5A 1VC2A 2A8YA 2WJ4A 3M3PA 4QHSA 1SIWA 1B8NA 3KKMA 1Y6FA 3A4NA 3T9DA 2M6SA 2NO6A 2Z56A 5AXCA 4FM9A 2HCTA 5CFPA 5BUCA 2O5RA 4E2YA 1R1DA 1U2GA 5CLJA 2G5PA 2XQJA 2XY4A 2YWJA 3GJ0A 3KZOA 4D25A 1KMQA 1PWHA 3ZVRA 4JWTA 3ZV3A 1YUMA 1SU8A 4CM4A 2HWUA 2AI1A 1VJ5A 2K2WA 4HZUA 5BSEA 1SBTA 2C9YA 4UFOA 2C0PA 4FGZA 3EVTA 4WINA 4ESOA 3ROEA 1HLDA 5CK5A 5BSFA 1F6BA 5ARBA 4BFCA 2JNWA 4RQUA 4EPXA 1U98A 2VHJA 4PV7A 3X1XA 1DBPA 2R751 4J2HA 4LYFA 4FE4A 2OXIA 1FJXA 3HO1A 2V6GA 2J3IA 3QPAA 2H2GA 2ZDQA 4BNVA 4JLBA 1PBTA 2QLFA 2NO1A 3PFCA 4A6DA 4D9GA 4J0JA 2D2VA 1N7GA 1OTHA 2YWHA 1LY1A 1MJGA 1UODA 3C39A 2FPUA 5DPMA 4CMIB 4UASA 1JGTA 1P5FA 2PVSA 1X70A 1KSJA 3ILSA 3THWA 4R1UA 1L6RA 1DG3A 1Z4KA 2IP1A 1MAVA 1U1CA 3HCPA 4J4HA 3EFBA 4MRAA 4RIEA 4XWAA 1G7TA 1TYBE 3CX6A 4N3AA 4BNWA 3DL7A 4YQFA 4QNMA 2ZWMA 3W1EA 5DW0A 1WZNA 4QBFA 4UE3S 3D8NA 2VHTA 2WWVD 1UPFA 2F59A 4DYHA 5LQCA 1QRDA 2ZSKA 5LA6B 5EMLA 5BYBA 1SK9A 3WHIA 1MQ8B 5KU1A 1EHCA 2K7ZA 3R77A 2X5OA 5GONF 4QJ5A 1WXIA 4TT8A 2IXFA 4K9PA 3ZD9A 3GHYA 1WMAA 3HLKA 5E7IA 1NDUA 2VUHB 5AHKA 3AM5A 4FYHA 4KPEC 3AJRA 5K03A 3U7HB 3KT0A 3KZVA 2JJQA 2IVFA 5CAEB 1IEQA 5J4VA 2GEFA 3CURA 2LRHA 3PLNA 4V2UA 1O97C 4I6EA 3DR3A 3WIVA 4IL5A 2JJ8A 1O8CA 4D81A 4G4JA 3WLFA 4LRXA 5IYZB 3UBTA 2O8CB 3GQBA 3RF6A 2RK6A 2JFOA 3CF0A 1M2VA 4F85A 5G4KB 3HKEA 4JJ8A 4EI9A 3ADCA 5LZ8A 2H5JA 1OFTA 1OHHD 2OM6A 2WD8A 1J25A 3MTQA 2X1VA 3D0OA 2NQ8A 4KSYA 4NOKA 3H0KA 3GJYA 3PF8A 3RO7A 2JJ1A 3CUTA 2IITA 1JR3E 4IX1A 1DT3A 5EA2A 3NTLA 4HRAA 3A4IA 3AQIA 3C6YA 1VHDA 2CD9A 4H77A 4Q3KA 3ZPXA 5CG1A 1LLUA 3DG9A 1E5VA 3RVDA 3K6SB 1JSXA 1K7YA 2ACKA 4NBUA 3OQIA 4YJHA 3VHLB 1QGED 1V8PA 3AKZA 2CV0A 3IIMA 4H1VA 1RRCA 1OASA 2J3LA 3OEHA 5FYQA 1NYTA 1NRIA 5DX8A 2CYAA 3MCWA 3HYSA 2BHTA 3TQQA 4IQ8A 5KMGA 2WAXA 4JY7A 1Y7PA 3I1YA 1MPTA 1QMPA 3UA3A 3KKEA 3EWSA 5ALLA 4BRSA 4DEVA 3RC9A 1VRCA 2E4YA 4DIDA 2IDKA 1M54A 1AN0A 1PT9A 7ABPA 3KOUA 3CE6A 3QG5A 4OUDB 4RPLA 5H16A 4CKBB 3DKPA 2WSLA 3U5ZB 4FBGA 4PZLA 3H5NA 1YU6A 3F3SA 3C3MA 3HY6A 2PX4A 2BM1A 5TT1A 3U7RA 4RKRA 4YJ3B 1DG9A 3GXOA 4B3SB 4HH4A 3GP3A 3PPIA 3UCEA 4A7PA 1J22A 4N9WA 4GVPA 1CVIA 1E58A 3HO6A 4YS6A 3ZK9A 1T9ZA 4Q3LA 3G0IA 1A9QA 4NBVA 1GRRA 2Q2QA 4MYHA 3NM4A 2AE2A 1U7XA 3JR3A 3JU3A 4EFKA 1VRWA 2B1QA 1ISJA 1UZUA 2GKSA 2OAP1 4FZ5A 4S1PA 4TS4A 4MVCA 3RH0A 5BVGA 1W6RA 2JCBA 2Y2UA 3WRXA 4QUAA 4W82A 1B8OA 3RPEA 4K9OA 1P8JA 4DMCA 1Z82A 4B7XA 1PV2A 2W6QA 3BWMA 1N5LA 2F17A 1C7RA 2VBGA 3ED5A 4G5XA 1V7CA 3DD1A 2Q6TA 1NBME 1CUVA 1NVMB 4GPZA 4DREA 2JCVA 3IAAA 2ZI9A 4OKNA 3CLHA 4EI2A 2MOKA 4DSZA 5AIBA 2YFHA 3V1NA 1UFKA 1UC5B 3JQCA 3NWJA 4G0ZA 3DLPX 2JATA 3F6YA 2C84A 3I9V6 3CCBA 4QTYA 3ZVMA 4OQYA 3CN7A 3LT5A 3RVBA 2WNSA 3PB3A 5KYYB 4L5IA 2OA0A 1WB4A 1PNQA 2HB6A 3ZCXA 2ZYIA 2ZIGA 1GVNB 1K63A 4CN9A 1GNQA 3OZWA 4OHCA 2Q4RA 3LOQA 1OWOA 5BQOA 3LLVA 1C7IA 1CUXA 4KX3A 2PWPA 1PGNA 1XRLA 5MN4A 1OUMA 1CY0A 3L7CA 4BHTA 1MG5A 1TYDE 2I33A 3FG9A 3T52A 1NYQA 2KSQA 2WAMA 2G82A 3F1LA 3FPEA 4RYLA 2G3YA 1P61B 2HK9A 4KWCA 1L1QA 3P9QA 4E88A 3U3XA 1EVLA 1RXSA 1XDDA 1ZC3A 3GFRA 3GMIA 4L07A 1XZ8A 3TB4A 5IUKC 1QKJA 1FPMA 2AEJA 1ZWLA 2YFYA 3VZQA 4TV8F 1WD7A 1NR1A 4GZMA 5DOVA 3PXCX 4DCSA 4TKMA 1CNFA 3TVTA 2OV3A 3UTDA 4YFVA 4E0BA 5AQ1A 3NH6A 2YNMD 3AIIA 4XM2A 5IANA 1Z2DA 1K92A 1ZCAA 3KX2A 3NU1A 4GW3A 4L6AA 4KXFB 4LYYA 1AK2A 5JLAA 3O5AA 1JLLA 2XSZD 1X74A 4RSRA 4X24A 3RAFC 2X4LA 2EG9A 5C4MA 1UFVA 4DMRA 1P3Y1 2FHPA 2IHVA 4UNNA 4ALNA 3SIXA 1GD1O 2VHVA 3U09A 3W2TA 4NEGA 4G9GA 5AH0A 3JQ9A 4YRNA 4ZFNA 2KYRA 4HGQA 4HYEA 4TV8A 4P5EA 1MX3A 1AKEA 1UBKS 2D5BA 3GGDA 4PC7A 3IV6A 4UHCA 4NBKA 2Q6IA 1QDLB 1LH0A 3OBIA 2RB4A 5GTDA 3NOOA 1QQ5A 4DWWA 3AEQA 3LT2A 5IJ9A 3TGPA 2IUFA 4O02B 2XAAA 4RSGA 1N33B 3SIRA 3D4LA 3TTXA 3A70A 1Y37A 3P2IA 3LQRA 1CJMA 1OLSB 3H4MA 3SXPA 4EOGA 3V46A 2YC4C 4X93A 3CVWA 3I05A 4D0RA 2BISA 4PQGA 3RVLA 1LBTA 2XIJA 5J2UF 1CT9A 4KUEA 1J9EA 1FE8A 2EKPA 4W5HA 4EG1A 4CKEB 4V0LA 1ZOOA 4EJMA 3T1QA 2QNBA 2WSIA 2VRCD 4DWOA 1JJFA 3CR3C 1Q57A 1T91A 4KPUA 5K4AA 2Q1XA 2WMYA 3IBCA 5K3DA 4F9GA 1DHTA 1W4CA 1C3JA 1H2XA 4S0XA 2KE5A 5F1KA 2OILA 3N8HA 4QLBA 1FNDA 1XZNA 4QASA 3LX8A 4FNGA 1QFXA 3CRRA 3H84A 1JEYA 2BFNA 1FTGA 2HH9A 3BKWA 3CKLA 2J3KA 1P0CA 2DKOA 4GDMA 4OB6A 4UUQA 3K8YA 4WA7A 4PO1A 1QRAA 3DNPA 3O3OB 2AQIA 4EJSC 4XGQA 5ALPA 4H59A 2MU1A 3OZFA 2PA0A 5HS6A 4H3HB 4ENPA 1O03A 2B8NA 2R9VA 2OBLA 4D43A 1G60A 2NZWA 4MULA 3S2YA 4ZQIA 1IHUA 1LVUA 4UMDA 3IIEA 4MV4A 1A4RA 1SCJA 3NV9A 4OYYA 3FVQA 3G7SA 4HPXB 1WS6A 4U3JB 5JPCA 1CPYA 2NYRA 1VZ3A 4LZAA 4BB0A 5DLDA 2CZQA 2G63A 4POAA 2CYCA 4GPTA 1Q44A 4C7KA 4HRXA 1DINA 2I66A 3AUYA 1D7AA 5A4IS 3IT1A 2Z2YA 2DUNA 5AHXA 4D3YA 3S68A 1DL5A 3RTEA 1EH5A 4YPVA 1EG2A 1WO8A 1KZ4A 3BGDA 1XRNA 4EVIA 3KVVA 5IU6A 1DARA 3SC2A 2JFNA 2D0PB 3SHFA 2CT8A 3VBCA 2AZMA 1C7EA 3I4LA 4Z53A 4KIWA 3RTBA 4AIIA 6LDHA 1OA0A 3F9CA 3M2TA 4R6WA 1DEAA 3ZWYA 4EHNA 3IP8A 3PDCA 4ZA2A 1X1CA 3ZY5A 2OHVA 5EOVA 2WDPA 1DRWA 3C8MA 3L7JA 4GHWA 1ZOSA 1AV6A 1XJ5A 1S4QA 3TPCA 4TUYA 1X42A 4HLDA 2DERA 1T2NA 1BX1A 1HDZA 1TZKA 2YWBA 3AHJA 4JBYA 4JXJA 2YV5A 4LVUA 1VGQA 3HKCB 2FQWA 3OM1A 4OLHA 4QODA 1EVYA 5DBIA 3QXGA 4FEAA 2ZJBA 2P35A 3TIVA 1ZNWA 1SXJC 3KYIB 1CY6A 4HXGA 5IYZF 5C1DA 3MWKA 3EOZA 2A0WA 2AJLI 2WTXA 2H2AA 2VPQA 3KQVA 4I66A 1P19A 5JH7B 1X39A 1QOQB 4DGSA 4UQPA 5A5VA 4CTOA 3OEEA 1IDOA 4EG3A 4KAAA 3WIBA 2G6TA 3C8HA 1QK5A 1VPLA 2QTBA 4TYMA 2ZJFA 5FAXA 5HCUA 4C5CA 3EASA 4R2LA 2QUAA 3FMIA 4M1WA 5AW7A 1Z34A 2BW0A 3QPVA 2A78A 5C4GB 4CLOB 3D7NA 1GRNA 4MWEA 1WUIS 3MXTA 1COZA 4MS4A 4BRUA 4DN6A 2C2KA 2JLVA 4M1ZA 2J6IA 3QMPA 4M0EA 2N75A 3H13A 3B89A 3PQ8A 3CUEF 3SU8A 1PQWA 3ZHCA 2A0UA 3VO1A 2WLTA 2X4DA 5TEVA 4UE6A 2NIPA 4HB2A 4LV5B 2HMAA 3FWHA 3NJRA 4WKBA 3JATB 1CDDA 4L16A 2JG3A 1E0KA 1N8SA 3KB6A 4W8HA 3GLSA 1FDRA 2UXDB 1VSBA 2AFHE 4K9QA 2OKCA 1GGVA 1ZM7A 1KMHB 1SUEA 1Y8CA 2GJ4A 3LWZA 1U5BB 4YJHB 3KTAB 5JPIA 3SYLA 3T0FA 3IP9A 1IM5A 2A9OA 1UK9A 1WHTB 3O9VA 4NLLA 1SG6A 1BEUB 3W6OA 1RHJA 4FOTA</