1KAGA

Crystal structure of the escherichia coli shikimate kinase i (arok)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
169
structure length
158
Chain Sequence
EKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDLEGEEGFRDREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTPLLHVETPPREVLEALANERNPLYEEIADVTISAKVVANQIIHMLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate kinase I
publication title Crystal structure of the Escherichia coli shikimate kinase I (AroK) that confers sensitivity to mecillinam.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 52
structure length 158
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2001-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kagA00
4LYFA 4V0KA 3EG5A 4OHVA 2B21A 4TSFA 3CB4A 1W0KD 3DDCA 5DO9A 1H8EA 1SVOA 1EFUA 2GAAA 5AUPB 3FHTA 4R71A 3EZ2A 3GD7A 3BWDD 1U9IA 1RYFA 4LBVA 3RC3A 4P33A 3MJHA 1KZGB 1Z5ZA 3KB2A 2CCJA 2JLVA 1IXRC 1OV4A 5KSPA 3FKSD 5AK0A 2JLYA 3QNUA 4M8NE 1KMQA 1L7VC 4K8OA 5EUMA 1IBRA 1C9KA 2KSQA 3MAAC 4RD6A 3NVAA 1KI9A 4Q21A 3TAUA 4BFSA 4BZPA 4ESHA 5BN4A 1VMAA 2ZSBA 4KITB 1W49A 5IK2A 3REFA 2IYTA 2VSOA 1GL9B 1JR3E 3KQUA 3KUDA 1D6JA 1KDRA 3FMFA 3QXHA 1F2UB 3FTQA 3AVTA 4DDVA 2RGBA 3F5FA 3PUYA 3EASA 3RRMA 1ZYUA 2EFHB 3RS7A 4URVR 4TMWA 1E9RA 3CRMA 1W7AA 4U02A 3DMDA 4LZZA 3CRQA 221PA 3QXJA 1Z6TA 3KB1A 4MH0R 3AF0A 3DVLA 2QENA 4HEJA 2EFEB 2D62A 4Q48A 1I4LD 5HE8A 4QJ3A 5HCNA 3NTUA 4OI2A 3J81k 3OE7D 2OXRA 3QI2A 1OB5A 1H8HA 1A82A 1UF9A 2ORIA 5B64A 3D7MA 3RVBA 1TAGA 4A6PA 3M4YA 4Q7KA 2CL0X 3T34A 3WRXC 4D26A 2W58A 4WAUA 1UADA 1JJVA 1Q3TA 4IOLA 5FOTA 3GLIE 2QAGC 2OESA 3UG7A 3ZDQA 2LKDA 5TY0A 4RFSA 2W0MA 3OEHD 3SJBA 1XJQA 4OKSA 2FEMA 1NI3A 4MUBA 1E1QA 1W5SA 2J41A 5KPJA 2QU8A 4HDCA 1VCIA 4JKIA 4WBSA 4K81B 2ZYVX 1SVMA 3NG1A 5BXQC 5J4VA 2O52A 1NVUQ 2FPLA 1E96A 1E0KA 3LBNA 4NH0A 5EE1A 2CK3A 2O0HA 2WKQA 2J7PA 2AKAB 4TL8A 5CDFA 3BB1A 4C4PA 5GJBA 3SDZA 4JBXA 3VR2A 2E1RA 2NQ2C 1OJLA 2OBNA 4RCZA 1NN1A 1FX0A 5FTLA 2YWEA 3L43A 4H1VA 421PA 2VTKA 2IS4A 5KPDA 4C0BA 3RHFA 3LXRA 1ZP6A 4CW7A 3PR1A 5EP4A 3P26A 3EZ9A 4QXAA 4XVRA 3MWKA 1WF3A 1E2GA 1Z0DA 3CRW1 3QG5A 1QHHB 4C0QC 2XJ4A 1HTWA 4QHSA 1E94E 4NTZA 2CJWB 1W1WA 3FVQA 1R5NA 1R2QA 3FKQA 1FP7A 1KK0A 2ZS9A 1XMIA 4M22A 4RFSB 1UEIA 4QBFA 3ZZ0A 2XGJA 2WZQA 1CTQA 3NEYA 2RB4A 3AKEA 4QL3A 2BV3A 5CK4A 1R5OA 1IN7A 4ON9A 4W5HA 3I3SR 3A4LA 3OIYA 4IDPA 1MKYA 4ZDWA 3JZAA 4B47A 1KO1A 2XTNA 3NH6A 4M1YA 2W2XA 2OFWA 3CUEF 1E2HA 4B32A 3BRWD 1XEFA 1XXHA 1NP6A 1KSGA 1Q22A 2E9SA 1SXJD 5BYKA 2NPIA 4XVQA 4EIWA 4D4KA 4NE2A 5CB8A 3B85A 2OCBA 4ARZA 4XWKA 5JS8A 2X2FA 4JLMA 3SHFA 2BJWA 1NVXQ 2FPMA 1ZM3A 1Z0AA 4QKQA 3H4MA 5M04A 4AYWA 4FN5A 1XP8A 1NSTA 4QBGB 4R7ZA 1B0UA 1U81A 1WB9A 1G8FA 4OBEA 1ELOA 1G18A 3IKJA 3WY9A 1QHGA 2CJWA 2F3TA 2ZS7A 3CR7A 3QE0A 3RAPR 4CVNA 2R2AA 4LC0A 4PFSA 5BYJA 3SE0A 5JSZA 1R8SA 2XAUA 4D80A 2IF2A 4RCYA 3I5YA 1N0WA 4UNRA 1DBSA 4X8HA 2FFQA 4I1OA 521PA 2QPTA 3AP2A 2QL6A 3MGCA 4URZR 3QIAA 1E0SA 2BCJQ 2Q3FA 2ZI3A 3I8XA 2Z4SA 3KXLA 4H1UA 4PHGA 5FR1A 4E09A 4LY6A 4LCBA 1T3HA 3QJYA 3RS5A 4C0SA 2JLQA 3HU3A 3WP0A 2RGNC 3Q3JB 4PO1A 2A78A 3R20A 2PT5A 4WOPA 3ASZA 2CCGA 3G5UA 4LUCA 3VHXA 4EFLA 1AS3A 1UBEA 3DKVA 4TQUS 2NO0A 1QHXA 1XMVA 2ZPTX 4DLSA 4YONB 4JLNA 4CEHB 4LBZA 1AK2A 2OXCA 1F3OA 1DAFA 1RZ3A 1UDWA 5K8LA 2DFTA 1G7SA 5CM8B 2VP9A 2V1UA 3FGNA 4URWR 4EPTA 1CEEA 4DB2A 1GNQA 2FN4A 4M0LA 4U00A 1S2MA 3P4YA 1VG8A 4Q00A 1UJ2A 3AVQA 2YKGA 2GVZC 5EXXA 3K0FA 4QJ5A 5G53C 3GPLA 5JSZB 2CHQA 1P62B 3CNOA 3A1WA 2OILA 2XNDD 3CBQA 3BE4A 4LPKA 3KXKA 1DAHA 1OIWA 2ZRKA 1JB1A 1P72A 3TK1A 2AKYA 3LWNA 4MRRA 1W0JA 4RSGA 2FSIA 4UXHA 3T1OA 4HYYA 2IYQA 3VU9B 5TMPA 4KFRA 2RMKA 2IA5A 3KFXA 1E1RA 1OT3A 2O8DA 1W36B 3EPJA 1T3LA 1RRCA 1Q1BA 1HQCA 2ZM5A 4US0R 3UG6A 1NJFA 1M74A 3AF3A 4ZDIA 3U7FB 1Q1ZA 3D3QA 2YWHA 4XIGS 4WXRA 3S1AB 1U90A 4BQSA 1E9DA 4KODA 1T4GA 1Z29A 4DLVA 2ERXA 2VA8A 2AR7A 2QEQA 3A1TA 1Z83A 1QHYA 5HR5A 4ACAA 3H1TA 1OXXK 2F1RA 1OE0A 1P3JA 4PSVA 1SHKA 1ZUHA 4D4LA 1U2RA 2W00A 4D25A 2YINC 2PZEA 2W6JD 4TYWA 1KYIA 4AY2A 3W6NA 3NBXX 3K0FB 4HUQB 4BFZA 2AD5A 2C03A 1E9SA 1E2QA 1G8YA 2OEPA 1US8B 1IHUA 1NY6A 1SXJC 1X8KA 3TAHA 4AURA 1Z07A 4DLTA 2O8FA 5JHHB 4JVNA 4KHZA 4GOJA 1AGRA 2HYDA 3BH0A 1F2TA 1RJ9A 1YRBA 2WHXA 3VU9A 3PEWA 3AQ4A 4LGMA 5JEEA 3BFVA 2J7KA 1N5KA 2RAPA 4IXNA 4Q02A 1CJTC 1UAAA 3L0OA 1N6LA 2ZRHA 2D4HA 3CH5A 1KO4A 1N3BA 1EFCA 3GEHA 2JA1A 4P4SB 2VHQA 4R2IA 1AQYA 1QZXA 4ZDKA 4OYHA 1VG9B 4Q4HA 3I61A 2FA9A 4M9XA 1T0JB 5J47A 4EUNA 2MMGA 1EFRA 4M1OA 3QSYA 5J4YA 1N2CE 2PZFA 2YWGA 1N5JA 1IXSB 4GT1A 2IHYA 4PHFA 4BEJA 4JSYA 3ICEA 4HLDA 1FW6A 1GG2A 4AI6A 1QF9A 1PVOA 2WWXA 1QDEA 1XDBA 4RVCA 2P6UA 4OHZA 4PPFA 1Z47A 1V5WA 1SKQA 2PBRA 3DL0A 1M6NA 2R6DA 1EESA 2DWOA 2QE7A 1AA9A 1NG9A 3R8FA 1EXMA 1T6NA 2X77A 4AYTA 3UANA 4Z8YA 2O0JA 2NG1A 3GLIA 4TMTA 2OAQ1 2QTVB 3MFYA 1H8HD 4NMMA 4LV6A 1E9AA 3TH5A 3FDIA 3H86A 4IDQA 4LOAA 4MYCA 1TTTA 4BLOA 4G5RA 3HU1A 4HLQB 1D2EA 2XTZA 2GVDC 2EFCB 1OIXA 4DLUA 1D2MA 3SU8A 2GHIA 3Q9LA 3ZQJA 2P0EA 4C0LA 2P2LA 1ZD8A 1FNMA 1SULA 1XNJA 4HLCA 3CLVA 3VR4A 4P4SA 3CX6A 3MUFA 1BO6A 3WYAA 2VPPA 4B73A 2D74A 3PEUA 3RYTC 1QVAA 2FSHA 5AJYA 1XEXA 2WPDD 3ASYA 3A6PC 2ZUDA 2IYRA 3WRYC 3B60A 3H0KA 4PPGA 4DKXA 1QBKC 3EAQA 4WZAE 3EWSA 3QG1A 4JVMA 5J5CA 1X1SA 1DARA 5JI3E 1S3GA 1H65A 4CDGA 4J0QA 3GJ8A 1D5CA 4QOSA 4LJ7A 5FOXA 1LY1A 3MWJA 3GLIB 2MSEB 2ZI6A 3SEAA 1AS0A 4YMUA 1DTSA 4HZUA 2V54A 1OXVA 1U8YA 3B9PA 4G5OA 1W36D 3WBKA 1JR3D 1ZIOA 3GMTA 3QXXA 1CP2A 1QHSA 4G0NA 2R8RA 2KI5A 3T12A 2GJ9A 2B7BA 2FFAA 3H2YA 3KL4A 2VP4A 4YLGA 2RGEA 1VIAA 2CEAA 5DHFA 3WYFA 1J7KA 1DAMA 2WICA 4DCVA 4F4IA 4M1TA 3QPWA 1U8ZA 1N5LA 2FG5A 2D7CA 1SVSA 2LKCA 3QY0A 3A58B 1XEXB 1SVLA 3I4LA 4R98A 4R9UC 4RZ3A 3WNCA 4V03A 5DIFA 1N0UA 4JLBA 2OCYC 4ZCLA 3WP1B 2O8BB 4OL0A 5TARA 1D2NA 5HZHA 4LJ6A 3EA0A 1A1VA 3PG5A 4PC6A 3X1DA 2FDCA 3B1VA 3DM9B 1XD2A 1ZD9A 2REBA 1UKEA 3KTAA 4FWTA 4WZ6A 3TRFA 2HXYA 3IEUA 1ZC4A 1Q1EA 1P60A 1NMYA 1BMFD 3GJXC 1OF1A 1TUIA 3ADKA 4MGIR 4ZCMA 3R9XA 2IEZA 3CPJB 2GXAA 4KXFB 1JALA 3EXAA 5FOSA 3CPEA 3BFKA 4URUR 3SS8A 4W7SA 4C2UA 2MSDB 2QE7D 3AKDA 4KSCA 4EJSB 4Y0VA 2VEDA 4IDOA 2FJUA 3O8RA 4L9WA 2BBOA 4G01B 5FUXA 4G5GA 3ND9A 3VKWA 1FMJA 4PANA 4CYMA 1GNRA 5DGXA 4DDUA 1JPJA 2IXGA 2ZRNA 3C5CA 2Y8EA 5DN6D 2BBTA 4WZBE 2IYZA 2R6FA 1UBGA 5AJZA 1UEJA 4L5BA 2V6JA 4DCUA 2PZGA 1XMSA 5JCPA 1CRPA 1XTIA 5AWFC 1EG7A 2XEXA 2TMKA 3U7HB 3SOPA 4V0LA 1Z6XA 4LRWA 4DZZA 4U5XA 3QXSA 1AZTA 3GLGA 1IN4A 3U2QA 5F9HA 5CLQA 3K70D 121PA 3THXB 3SHWA 2Z83A 3VR5A 3E5HA 2GZAA 1SZPA 5L3RA 1JXOA 4KCGA 2BWJA 2ZYTX 1FPMA 2HCJB 1KI8A 2W6ID 3ECCA 3FHCB 4UXJA 3SQXA 4I81A 4IFBA 2WJYA 3B5JA 4C0HA 2HUPA 1S3SA 3P4XA 3MMPA 2P67A 1OXTA 2ZJBA 3TNFA 4TQAA 4DLZA 1KO5A 4A82A 5GJCA 2AD1A 3Q85A 1E2MA 2CE7A 3IO5A 4GNKA 1RKBA 3NDBB 3HU2A 2B8WA 2QM7A 5B2ZA 2YOHA 2BBWA 3ZIAA 4GOKA 4NCJA 3DZDA 1IJEA 2CDNA 4FCTA 1OXUA 4PHTA 2AN9A 2GF0A 2A5FA 1XTSA 4TLCA 4DSNA 4PC1A 3BC1A 2PLFA 5CYPA 3CNNA 1HE1C 1CKEA 1JXMA 1U99A 2XSZA 2ZVPX 3PUZA 4AK9A 3ADDA 3PVSA 4RD0A 4DIDA 3KQLA 2O8CB 1V43A 1A2KC 3C15C 4Q9KA 2GETA 4JJKA 2GBLC 4N3NA 1MO3A 1KI3A 4MGYR 5FTNA 1C4OA 2YNMA 4HAXA 1PLLA 2IUUA 4NYJQ 5EP2A 3DHWC 2ZI4A 4QRHA 2KE5A 1MO4A 3VX4A 1KNQA 2EYUA 3P27A 1G4AE 2ZSFA 2BEJA 2KBEA 1X8JA 2ODNA 4M4SA 1MRSA 2QT0A 2VL7A 3QF4B 4QG7A 3ZS8A 1LVGA 1AM4D 2C78A 4KI0A 2Q9BA 3QENA 4GP7A 1OSNA 2J0UA 1NKTA 1X3SA 3KJGA 3D6TB 1NVWQ 4HAZA 3ONWA 2CLDX 2FSGA 2CNWD 4QHTA 2A30A 2W6JA 2BHRA 3AP1A 2P6NA 2JJ2A 3GLFE 5FBWB 4UXIA 4B71A 2YOGA 4QBIA 2AK3A 1GVNB 3RRYA 4B75A 1N25A 2J46A 1TNDA 2IYWA 4LHXA 4D0LB 1TU3A 4Z1MA 4TYQA 2O8CA 4NYIR 1UPTA 3O8DA 4OI1A 3T1TA 3MSXA 2ZRAA 2GAOA 1I4DD 1CRQA 1T3SA 4G3XA 4B3DA 3BOSA 3IGFA 4BLSA 4HDQB 2BMEA 3CWZA 4FCVA 4OQLA 1KI7A 1XCPA 4MRSA 2V4ZA 4RD2A 2H57A 2GJKA 4L4UA 1RRGA 4Q1CA 5FBLB 4B3GA 2YJTD 3K0AB 1ZNYA 4GSYA 4WVFA 5GVRA 1E79D 1Z2AA 2IYVA 3K0SA 2GEVA 3QF4A 2WMOB 2ZRGA 4NP6A 1TQ2A 2JJ2D 1DS6A 3T61A 4IDHA 4QBHA 2QT1A 2WWGA 3U4QB 3QKUA 1F6BA 4A36A 2BKEA 2C2HA 2J0UB 2ZXUA 2QRZA 1JPNA 5F2EA 1Z28A 3ADCA 1FX0B 2BEKA 3IEVA 3E1SA 5FOWA 4X8MA 4GBMA 3K09A 4OQNA 2I4IA 1VKJA 4PXAA 1XPUA 1JQLB 2QAJA 2RKOA 1JQJC 5FOVA 2FX3A 2HJGA 5H1YA 4FXPA 3W34A 4XH9B 5IT5A 1E4YA 2ZS8A 2ZJZA 4OJQA 4JJZA 1E69A 3TLXA 2O5VA 1VDZA 2X1VA 1TU4A 1HQYE 2AK2A 1R6BX 1TF5A 4LDJA 3RSOA 2IK8A 2EW1A 5EP1A 5FPTA 4M1SA 4X8OA 2XSZD 3V4FA 2IF0A 2IYYA 1I4TD 2MMCA 3B1WA 3IUYA 5FOUA 5JWRA 2WJIA 1AKYA 1QHIA 4BRUA 1T91A 4TWZA 1P75A 5A4JA 2A5YB 4NBSA 5AUNB 1SHZA 3K0AA 1YR6A 2FWRA 1NLFA 1YZLA 5LD2B 2Q9AA 4N0EA 1Z0FA 4TLEA 4PQRA 1RRFA 2JDIA 2V55B 2PEZA 2DR3A 4RZXA 1JAIA 4ZPXA 2AFIE 2XZPA 1N5IA 2AX4A 3TJZA 1GUAA 3U4QA 1HE8B 2REOA 1P2TA 1TQDA 2QGZA 4ARZB 2IBMA 5P21A 2FNAA 2WAYA 1COWD 5FTMA 1NIPA 4F92B 4NCNA 4D82A 1VCMA 1L2TA 3RS2A 3MLEA 5CK5A 2P65A 5C1BA 3IIKA 1ZD1A 1YE8A 3ZJYA 4LJAA 1W36C 3B78A 4EPXA 2REXB 1A7JA 3SYLA 3N5CA 1XRJA 3KFVA 3FKSA 3VR1A 4EQ6B 5DLQC 5EE3A 1NBMA 4DUGD 5IF9A 1TQ4A 1R7RA 3CPHA 2C77A 2RHMA 1P6XA 2ODEA 4BFUA 1SQ5A 2GCOB 1S8FA 2PCJA 3AB3A 4A15A 4HZIA 3EX7C 2FFBA 5EE9A 2XXAB 1G3UA 3NBFA 1R10A 1Z63A 3REGA 3OE7A 1AQUA 2YZ2A 2WSSD 5CJPA 3W5JA 4D81A 1PV4A 4LJ9A 2ZANA 3W5IA 4DLRA 1VCOA 2NOAA 5LBIA 3N2EA 2GK6A 4LBYA 5DYIA 3ZIAD 5CB6A 1IY0A 1GAJA 2R6AA 2NZJA 3NH9A 4PZLA 5F3WB 3U60B 1G16A 3CWQA 4FCWA 2F43A 3SZRA 2D7DA 2WOJA 3BB4A 2WJJA 3AVWA 2WBLC 4HAWA 2C99A 2ZRLA 3T5GA 4KFUA 3W6OA 3SN6A 2Q3MA 3KKPA 2HLDD 2XOKD 3LQQA 2JIZA 2GKSA 4YXWA 4CEHA 1Y3AA 4LHYA 2YHSA 3GJ7A 2GJSA 2EQBA 2YWFA 2IHBA 4PQYA 2AXNA 1KO7A 4GZLA 4FINA 1KGDA 2H92A 4TTQA 1TF7A 4EPRA 1NMZA 3B7GA 2ZI5A 2W0SA 4BLTA 4PPNA 4Q9JA 4EQ6A 1YR7A 3AVPA 2FOLA 2AWNA 1W4CA 3QUSA 1YR8A 1II9A 3TE6A 5CDFE 2GF9A 1X86B 3CF6R 3E70C 3EC2A 4OHYA 2WV9A 1T0HB 1OPXA 2XZOA 4O3MA 3X1YA 2GCOA 5KSYA 1CS4C 1E2KA 3VAAA 3C8UA 1QRAA 1W4BA 2QM8A 3VMFA 4E03A 1SXJE 4KYUA 2CLCX 2Z4RA 1DELA 2AHOA 2IL1A 4NPHA 4TT3D 2J59A 1J8YF 2QY9A 2JJ1A 4DXAA 1KAOA 1MR3F 5JBQA 3KXIA 1DG1G 2O8DB 4GRAA 1TX4B 3Q7QA 2D3WA 4FIDA 621PA 3PIRA 2F43B 2ZE8A 1G4UR 2WAXA 3UWOA 2GZHA 4B44A 4Q66C 3NC1C 3S1AA 4Q4JB 4UJ5A 1CJVC 3FYHA 1UBFA 2RH5A 2DYKA 2QZ4A 4CEJA 3TSWA 1E32A 3CH4B 1E9FA 4F91B 3CR8A 4TMVA 3WXMA 3LY5A 3A37A 5FI0B 3TGPA 1L4UA 2ZRCA 5TXGA 1G8HA 3T1VA 2ANBA 2HT1A 3F3YA 4AG6A 1OFIA 3CX8A 5G3YA 2ZUCA 3M1IA 1Z2CA 3L82B 4JLAA 1GRQA 4NYJR 3HP1A 2O8FB 5BW8A 3TUJC 2IUSA 5A5GA 3VNVA 5FBQB 5JEDA 3RNLA 4LBWA 2ZSAA 1KJWA 4LHVA 1F2TB 4JZKA 1T8TA 5DH9A 1E9BA 1FUKA 1RJ9B 1RYHA 2BM1A 3LX8A 1E79A 3FMPB 3F0TA 1CXZA 1P9WA 4P31A 4E22A 5CITA 1BOFA 3TUIC 4HI0E 1IONA 2QMUA 1YKSA 4K46A 4LYHA 1ZC3A 4C3ZA 3VNUA 4TL6A 3VR6A 1TADA 4CRWB 3LVQE 2QPOA 2JEOA 3B9QA 5H70A 3RRNA 1AJEA 1JEEA 4LPSA 2OAP1 4JS0A 2R62A 4NZYA 5K8TA 4Q4HB 4Q4JA 1NLZA 5J4HA 3Q7PA 3BERA 1G5PA 5FUWA 3T06B 1L4YA 2N42A 1GP2A 4UQOA 4CEJB 4CGZA 3OIWA 4JLKA 2Q9CA 3U61B 5KU1A 1E4VA 4Q1EA 1A2BA 2VP6A 2IT1A 3EZFA 1RW4A 3FHOA 4NYIQ 1OB2A 2A3RA 2BC9A 2FMXA 2GEDA 1Z6GA 1NBME 3RS4A 1MH1A 2A5JA 2H1LA 2RGDA 2ECKA 4B2IA 4BEBA 2GILA 2GWHA 2GXSA 1NRJB 2G9NA 4RJLA 2OCPA 4OHXA 1W4AA 3PEVA 4LK2A 5SZHB 4GZMA 1XWIA 1ZVQA 2EVWX 2MSCB 3DZ8A 3UMFA 3V9PA 2C98A 3UIEA 2VLIA 4XVUA 5EXSA 4HAUA 1VYVA 3U44A 3AUXA 4KBFA 3N70A 2NO9A 5C4MA 2HYIC 4UKDA 2JCSA 3ZD7A 4RD1A 1UKVY 4Z51A 4M2LA 3THYB 4BGDA 4HATA 5IDVA 4KVAA 1Q12A 2ZAOA 3BGWA 4UJ3A 4E07A 2DB3A 3UWKA 3EZ6A 1EFRD 1IN5A 2JAQA 3EIEA 4FW9A 4ZKEA 1WBDA 2JJ1D 1OH5A 4I99A 4RZ2A 2OV2A 5EZ5A 5JLJA 3EWAA 3C4JA 1G21E 3AUYA 3LW7A 4OI4A 4BLQA 1CLUA 1R0XA 5FBVB 2CBZA 2LCFA 3RC8A 3EZ7A 4HSEA 1I2DA 4GPTA 3JVUA 4KBGA 5L3QB 1W47A 1G7RA 3LRPA 4CIDA 2IS6A 2VBCA 4FD2A 3HYTA 2PLRA 4XD7A 3AVYA 2F7SA 1XZPA 1GNPA 3MCAA 3AGPA 1ZJ6A 4PC7A 1W48A 3TIFA 2ZRMA 4E5UA 4IW3B 3K09C 1K8RA 1XTJA 1W0JD 2GRJA 4I1VA 3U6BA 1KOFA 2YOFA 3NWJA 2ORWA 3U44B 3OF5A 3VQTA 3LLUA 1CR4A 2V7QD 3PENA 4W5JA 3ZS9A 4HZUB 3NEJA 3R9WA 2FSFA 1J90A 1LS1A 2A5GA 3VX3A 5AUQA 4LYAA 1ZM2A 4PSKA 3WBJA 2VHUA 3HPRA 1OHHD 3U6KA 2FFHA 3IQXA 3ZLJA 1KKMA 5JMTA 1CJKC 3I92A 1OH8A 2F1JA 2CXXA 3RRZA 3KKQA 3U3JA 2XTMA 1G9XA 1EK0A 2FH5B 2A7QA 3W90A 2J9RA 5BN3A 1E2DA 4DJTA 3PV0A 2AWOA 3PEYA 5DHAA 1ODFA 1F48A 2OUKA 3BXZA 4M9ZA 1ZM9A 4ERNA 5L3QA 3SBDA 5IRCD 3HWSA 4M1MA 5KNCA 5JJIA 5DN6A 2GZDA 721PA 1XD2B 4ITRC 5L3VA 2OBLA 2ZYUX 3KTAB 3VR3A 3WMFA 1P2SA 4NCIA 1T5IA 3BBPA 2OFXA 4EPYA 1Z3IX 1TEXA 2FF7A 1P9NA 4MGKR 4ZCIA 4TZ6A 1SXJA 1U0JA 1ZCBA 1G6OA 1KK2A 1A5TA 1OKKD 2PX0A 3LV8A 2P5TB 3LQRA 1JR6A 4ASUD 2FZLA 2QROA 3LNCA 1KDPA 4DLXA 4BPBA 3A1VA 2QA5A 2JDID 3K53A 3B6EA 5FL3A 1VIYA 3M0EA 1XJ0A 5AJXA 1NMXA 3ZGXA 3ADBA 2D2EA 3AH8A 5HKKA 2XNDA 3IBYA 3ZVLA 4Z54A 4IDNA 1YZUA 5E7JA 4LJYA 4TZ0A 4FWIB 3THWB 1E9CA 2J1LA 4Q1FA 4MA4A 3VFDA 2X8AA 4Q1BA 4DDWA 4LHWA 2A5DA 2B92A 2FEOA 4CT4B 2GTPA 2B7CA 1X6VA 3DEFA 1DO0A 2UZIR 3OEHA 4Q01A 2R6CA 2GBLA 5E4FA 1Q0UA 4WXPA 4HLUC 3NDPA 4B2LA 2H18A 5FUVA 3BIFA 3HJNA 5HPYB 4KAXA 1RVDA 4OJKA 3TQCA 1W5TA 1G3MA 4LJ4A 4NKRA 2VIIA 1XFAA 2OLKA 1E2EA 2R44A 4XWAA 1DAIA 1GKUB 4EJSC 1SXJB 1FQKA 2G1KA 3ZD6A 1F60A 1GOTA 5GADl 4NL4H 4AIIA 1S0UA 2OSBA 1YZNA 2BMJA 1G3RA 1E2JA 2W2TA 4Q1AA 2DWPA 1KNXA 1MABB 1Z08A 1HA3A 1N6OA 4Q7JB 3GFTA 4TN1A 4IEIA 4A6XA 4BASA 4BFWA 5B58C 2QSZA 3WYGA 3L0PA 2ATVA 4V0OA 3TW8B 3BD9A 3NIBA 3THWA 1HURA 4II7A 1QHNA 4L8GA 4EKDA 4US1R 2GA8A 2JIZD 6Q21A 1BIFA 2QBYA 3P20A 4NCKA 2OCAA 3AVOA 1EWRA 1GILA 1HEIA 1DG3A 2C95A 1DVRA 3LFUA 4YMVA 3NHAA 2JASA 2OT3B 3UATA 3JVVA 1RE0A 4QNMA 5JS7A 2ZR0A 2FZ4A 4S35A 3KJIA 2QP4A 2GJ8A 3AVUA 1YVDA 2BMFA 2IYLD 3BB3A 5LD2C 4TMXA 3X1ZA 3ZQ6A 1KI1A 2JLZA 4A1FA 1FQJA 2G1JA 4MRNA 4CT5A 4B35A 1GRNA 3W9YA 3OAAA 1ZU5A 3W8RA 4XSGA 2XZLA 2VRWA 4PX9A 3I32A 4L9SA 4BFVA 4LWZA 4C7OA 3D8BA 3TW4A 4JLVA 4JLJA 2OM2A 5HZKA 5LPNA 1MABA 4XTCS 2GCPA 2LWIA 2CK3D 3FOZA 4M9SA 3G0HA 2GXQA 3LAWA 3A36A 5DNYB 1S9DA 2GESA 3JZMA 1ZIPA 5SZIA 5HTKA 3O47A 3SJCA 1E99A 2KB0A 3IIMA 2NIPA 2ZJOA 4DRZA 2BBSA 2VQSA 4QFMA 1VPLA 3VKHA 5KDDA 4LV8B 2Z43A 5JI2E 1AN0A 3P1JA 2QNRA 1KSFX 2AL7A 2FE4A 1LV7A 3FPAA 1II8A 4BZXA 3WHKA 3B1YA 1W0KA 4N1AA 1GKYA 4A8JC 2W2VA 1CR2A 2C9CA 2YC4C 5KNDA 1U0LA 4B34A 2VSXA 2XB2A 1XB2A 4A92A 2WM9B 2QI9C 3K0CA 4AKEA 1R0WA 4HAYA 4JBYA 4MYHA 4QGFA 2QAGB 3CRRA 5D3QA 1XX6A 1KTVA 4A0HA 3CNLA 1NLYA 5B30A 3LBHA 5TV2A 2QMHA 2VP0A 1TPZA 4POAA 1G8GA 1SVKA 4HUTA 1EX6A 1T8UA 2G77B 2EYQA 3LH5A 2HT6A 3CONA 5HKKD 3R8CA 5AR1A 1M2OB 5J40A 5JHGB 2ZEJA 1GFIA 3TKLA 4DSUA 1II0A 3I1FA 1S4QA 2NO6A 1S9HA 2PT7A 5E7IA 3CZQA 3EA5A 4YQFA 2J87A 4D4MA 3BJIC 5C2JB 2B6HA 1Z0KA 3SJAA 2ZI9A 2QTHA 3BH7A 2CNWA 2QG6A 3VHLB 4JVSB 2B8TA 2V8OA 4Z8XA 4BLPA 2OE2A 2HEIA 1OXSC 1OFUX 5KDLA 1KHTA 2DFKB 3WNBA 1EGAA 2KBFA 2RGCA 4JLOA 3FWYA 2WMNB 3AF1A 1N6KA 4AKHA 4PZYA 5D3MA 1COWA 1D9XA 4M9QA 2O0KA 2QORA 4JMPA 1E1RD 1G291 5DI9A 3A8TA 4OK3A 4O2LA 2OZEA 3M6AA 1AGPA 1BH2A 1LF5A 2IC5A 2IEYA 1M7BA 5K8UA 1U98A 1VG1A 2QGNA 4AKIA 2FGJA 2I1QA 1KJYA 1ZMXA 2DY1A 1OLOA 5SZKB 2KWIA 1GM5A 1Z0JA 5LDDC 3SFVA 2VSFA 1EX7A 1NVVQ 3W3AA 4AWXA 3OIUA 1OYWA 2I1VB 1J99A 1QVRA 4H9GA 2WIAA 3K70B 4DUGA 1MO6A 1E1QD 1XTQA 1M7GA 4TSFD 2F6RA 4BZQA 1GSIA 1JI0A 1GWNA 4JL5A 5TDHA 3R7WB 4IVPA 2QQ0A 2J0QA 5JRJA 1KZ7B 3C7KA 1O87A 3N2IA 4MRVA 4Q4LA 1BMFA 2EWWA 4MKIA 2F3RA 2C9OA 3U5ZB 4ACBA 2ZSDA 3IPYA 4IRUB 5JJLA 1E6CA 4FMCB 1ZUIA 2ZROA 3QEJA 3DM5A 3K0EA 2EWVA 2RGGA 3I73A 2NZ8A 1N6HA 4PC2A 1G7TA 4JL6A 2O8EB 1EFHA 3OHMA 4TYNA 4GFDA 4B2PA 1SKYE 4BLRA 2XXAA 2SHKA 3KQKA 1E98A 1DAKA 1G7CA 1TMKA 4PO9A 4R2HA 2WKRA 4P32A 5GJVC 4KLNA 3WMEA 3B2EA 1OYYA 1IN8A 4XWOA 3RLFA 3QKRA 4P4UA 1XTKA 4F93B 4V0NA 2D06A 3TBKA 4DLYA 3CZPA 4N0DA 1AZSC 2DBYA 3EIQA 3TQFA 5E3HA 5CJ2A 5H8WA 2RHDA 3NHBA 5GJWC 3BFXA 1RPZA 1NN0A 1NN3A 1T9HA 2V6IA 1J8MF 2F1HA 2ZRFA 4JT2A 2H16A 1DO2A 3O8CA 3RWMB 3TMKA 4Q47A 5KTYA 1KK3A 1U0HC 5ELXA 3B8HA 2CHVA 2IYXA 3QOFA 4PPQA 2ZTSA 4HAVA 2H5EA 4Q03A 3OESA 3ZVRA 2IX3A 4PR0A 3BAFA 2ODWA 3QBVA 2JLRA 1Q57A 4I4LA 5HE9A 2ONKA 1NKSA 2F55A 2ODBA 3TR5A 3X1WA 2GDJA 4XTRA 1YZQA 2IWHA 1UDXA 5FFMA 1K6MA 4NDZA 3B82A 2FU5C 3AF4A 4JSTA 3IQWA 1ZAKA 5EE0A 2IXFA 3W8NA 4EPWA 1ZUNB 2C04A 5CYOA 4DIEA 5FPSA 3EARA 2IW3A 2QQEA 2VHTA 1DAGA 3OAAD 1G19A 1H8ED 1VYTA 5EXTA 4HDOB 4PTLA 3E2IA 3CO5A 1LS6A 3UPUA 3W3ZB 4QGHA 4C30A 1XD8A 1OIVA 4MYUA 4P3YA 4BECA 3QKRB 1JAHA 4ZIRA 1KKLA 2BMDA 1HYQA 2QPAA 5DISB 1X8LA 2WSMA 1BS1A 1OKKA 4IOKA 2K5UA 2G0NA 1ESMA 5FPKA 2JGNA 2AFHE 4D0GA 4DHEA 3EPKA 5B57C 4PO8A 2HXSA 4M1WA 4JYCA 3KZ1E 2V3CC 2CHGA 3I5XA 4A2QA 2N1BA 4B76A 1E2LA 1YZKA 3K9LA 3LD9A 4A9AA 1G6HA 1ZBDA 2WTUA 2PMKA 2QP3A 4AC9A 3FFAA 4YMTA 4A0GA 4X8LA 2RCNA 3A4NA 2W83A 2XX3A 4JYBA 4KVGA 2RGAA 2GEUA 2QMOA 4Q19A 1Q21A 1Q44A 1HV8A 2ZE7A 1ETUA 4C0JA 3MRSA 2IUTA 5FPYA 5FL7A 3GLHB 2CL6X 3GJ6A 2V9PA 3QQ5A 1JECA 1G8PA 1CULC 1Z0IA 1E2IA 2BOVA 2EU8A 1GIAA 4JIMA 1DAEA 4GL2A 4OK5A 4O0MA 1RFLA 5AJWA 4TT3A 2YYZA 3MJRA 1IOZA 2ZJ5A 1J2JA 1NL3A 1MV5A 1TUEA 1Z22A 2Z6VA 3B13B 5L8VA 4I1UA 1IJFA 1G41A 1CJUC 3A1SA 4BUJA 1CBUA 4Q4AB 2ZRIA 2JLSA 4M21A 2G88A 1UM8A 1VG0B 2ZAMA 3GLFA 1GZSA 1U94A 4MRPA 1YU9A 4TLAA 1YZGA 4DBLC 2PJZA 4NHOA 1WBBA 4FMCF 3SYKA 4TMKA 4NU0A 2ORVA 5FR2A 5AJVB 3LXXA 5J4LA 2Q3HA 3BK7A 1XJCA 821PA 4UNQA 2VYFA 1ONBA 2ZVQX 4MKFA 2NPFA 4ZI3A 1UKYA 1GDDA 4BRWA 3X2SA 1VTKA 1ZNZA 3OIVA 2H8KA 4TL7A 1KDTA 3QPVA 3IIJA 4MGZR 4M53A 1F2UA 1KSJA 2BJVA 3GLHA 1RRPA 4MQBA 1G3QA 4MDEA 3Q72A 1VHTA 1KI6A 1Q1QA 3AP3A 4GP6A 1E2PA 4B48A 4LC1A 4FMDF 1FL9A 4BFTA 1P73A 2ZRJA 2R6GA 3KKMA 4NONA 4GMDA 1P2UA 4PAOA 2QRNA 2WWFA 3SC3A 3THYA 1TEVA 2IS2A 3L0SA 2QTFA 2WPDA 3HR7A 4B6FA 1NG1A 3RWOA 2KJQA 4OK6A 1G64A 2WIBA 1N6NA 3KJEA 3ZYCA 3H84A 4FMDB 1D8TA 4KFTA 4C2TA 4Q4AA 4TTRA 2R65A 1R0ZA 3SR0A 5KHOC 3GLFB 2FV8A 1W46A 3OFNA 3IDQA 4PHHA 3OEED 2IYUA 3AM1A 2C96A 1XCMA 3DKPA 4A2PA 1FZQA 5EE5B 1N0VC 1NN5A 3RS3A 2PX3A 2ZI7A 3IHWA 3QBTA 3DPUA 3F8TA 1PJRA 1SKYB 3L0IB 1VCNA 1WDTA 3I8SA 1CR0A 3DO6A 3GQBA 4A2WA 3KKNA 4MITA 3R9IA 1S1MA 4A0RA 2I3BA 2NO1A 2CL7X 4DLWA 1GRRA 1KI6B 2V1XA 3MWLA 3UKDA 3K9HA 1AKEA 3IPXA 3D31A 3KX2A 4WW0A 3Q5DA 4RD3A 4BWYA 3CIOA 5J4KA 1KAGA 3PUXA 4AD8A 3KQNA 4PC3A 5DYGA 2WJVA 3EPHA 2G3YA 1FFHA 2ZITA 5EZ6B 1NBMD 4D4JA 2A9KA 1VHLA 4CF7A 5FI1B 1ZCAA 1QHHA 1AS2A 4DT1B 4Q9HA 4QNRA 4V0ME 5BWMA 1YHNA 4EFMA 3CW2A 2OO7A 3PFIA 3L8YA 5KNBA 2QSYA 4YC7A 3AKCA 3AKYA 2OBMA 3RABA 2Q0HA 1HUQA 3ND8A 2RGXA 3KJHA 3WMGA 2OLJA 5G41A 3KDSE 3SBEA 1MOZA 4RKFA 4OHWA 3U3MA 1IQPA 3T15A 4B33A 3DOEA 1K5GA 2GNOA 2DPXA 2WJGA 3BORA 5KSOA 1KJZA 4G1UC 3ETLA 3LDAA 1T5LA 1XXHB 3IO3A 3KUCA 1U8AA 1PUJA 2CMKA 4OQXA 4M1KA 3RSLA 4RD4A 5EQTA 1A4RA 4IEEA 3NBYC 4JLDA 1NIJA 3C16C 3GP8A 5AUOB 2ZE5A 4A4DA 4IOJA 5GVSA 4D0NA 2IYSA 1RC8A 4GOXA 3VKGA 1VYUA 2OFOA 1DE0A 1W44A 4B3BA 2JJ8A 1KI2A 2C8VA 2GCNA 4Q7LA 3UMSA 4QJ4A 1Z6AA 4L16A 2PJRA 4DT1A 5BQ5A 1NF3A 1CJMA 1WP9A 1KY3A 2J3EA 2NGRA 4OQFA 5JFGA 3PQCA 4WIAA 1ZINA 1Z06A 1YRAA 3HR8A 4A8JB 3QF7A 1RIFA 2R9VA 1HH4A 1WA5A 1YQTA 4S2EA 4A0FA 4F38A 4I1SA 1P61B 4OQMA 3EC1A 1U9IC 4Z1MD 1LB1B 1OFHA 2WSSA 4DCSA 4ZI2A 1CR1A 4KJZA 4DEXA 1KIMA 4Y0AA 1KSHA 3FMIA 5DSZA 1N6RA 1FTNA 1P2VA 2VF8A 4Q5IA 4RZUA 1XPOA 2H7VA 4IOMA 1KK1A 4AKGA 1E2FA 1ANKA 4NCHA 2ZJAA 2XB4A 4DEYA 3SI7A 4DCTA 1GTVA 2EFGA 3CX7A 1XMJA 2JLWA 4RY2A 1R0YA 3K8YA 1XCGB 3EIHA 4U7DA 2VH5R 2WWHA 3AGQA 3SQWA 4LYJA 4ZV4A 2NO7A 3QEOA 2E87A 1NY5A 1S96A 4B3XA 1ZM4A 1FUUA 2AXPA 1E0JA 2VHCA 4AG5A 1G5TA 3LO5A 1WE2A 2ZIAA 3MD0A 4KU4A 2ERYA 5JWOA 4CEIB 4IFEA 2YVUA 2UVQA 3ZZUA 2QBYB 3PCRB 4JL8A 4HLUA 1TF2A 2A2ZA 4ILEA 1G5RA 3ZVMA 3NC0C 4B74A 4JT4A 5FPHA 3SYNA 4F7WA 1NSFA 1M1YE 1IN6A 5EJEA 1XPRA 4QM7A 3TUZC 3TSOA 1DEKA 1M34E 4KYIB 2PEYA 4A8JA 3K70C 2YC2C 1K5DA 3ZZTA 1IY2A 1SVWA 2HF8A 2HV8A 4US2R 2QP9X 4KFSA 2VO1A 3HYRA 4LV5B 1BYIA 4ZO4A 2J0VA 3I72A 3SJZA 1I2MA 8OHMA 1M8PA 5CIWA 2DHRA 5L3SB 4HB4A 3UK6A 1X1RA 2GK7A 2ZREA 3IHLA 3X1XA 4C7OB 2W6IA 3ZVNA 2UKDA 4YMWA 2PMDA 3U7EB 4UNPA 3UMRA 3WHLA 1PLKA 1UFQA 2G6BA 3T5DA 1LFDB 3FMOB 3TVTA 3QVUA 2OG2A 1Y63A 1TQ6A 2D2FA 3LVRE 3U3KA 3GJ4A 1FOEB 5JRZA 2DCUA 1G3IA 1FMLA 1P5ZB 4CEIA 2ZJYA 1Q3HA 2NMVA 1YR9A 1KMHB 2J45A 2PH1A 2OHFA 5FUYA 5E95A 4BFXA 1R4AA 4V0MA 3K9GA 1P4SA 1GITA 3OEEA 5EUQB 2GXUA 4URXR 3U3RA 4LX0A 1II8B 3PXGA 4HUQA 4GDFA 1NVVR 1P9RA 1W4RA 3IBGA 2P6RA 4Q18A 3HDTA 1KDOA 1US8A 2CCKA 3DMNA 1UKZA 3P32A 4NYMQ 1S1CA 2L0XA 2ZR9A 3A4MA 4TLBA 3TR0A 4EPVA 1XF9A 4WA7A 5C18A 4G5QA 5HCIA 5JZVA 1KO8A 1ZU4A 1JBKA 3GFOA 2QAGA 2ZJ8A 4TMZA 2JLUA 1YZTA 5L3SA 2F9LA 1XBTA 4QC2A 2WWWA 1W2HA 4XD7D 2Q6TA 5G3ZA 1KI4A 1IY1A 4MDFA 1XZQA 1GL7A 4DCNA 3L2OB 1CU1A 3PITA 5FTJA 2C9YA 4MUAA 3BS4A 4NYMR 1XEWX 2CLSA 3U3OA 4KO8A 2IXEA 4Q7MB 3QVVA 4YDHB 1Z6YA 1BYUA 1ZNWA 5SZJA 5IHPA 5F9FA 3GEEA 1JJ7A 2J7PD 4KLZA 1Z8FA 4QGGA 3O8BA 2DFNA 4LSGA 1KMHA 1UBCA 4B3FX 3TVDA 5K8IA 1CF4A 2VP2A 2JATA 2WVJA 5KYKA 3IILA 3SNHA 3G82C 3T1QA 3ZH9B 4DSTA 4JVLA 3GJ5A 1JR3A 4IJMA 1ZW6A 1B23P 2BDTA 4XJXA 3CKLA 2UZ3A 3WNDA 1ZNXA 1XTRA 5D3MB 1WCV1 4UNNA 4C9BA 1XEWY 4L15A 1QG4A 5CM9C 4PZZA 5A0FA 2ONJA 4DDTA 1C1YA 1FP6A 2ZJ2A 4Q9IA 1M7HA 1DADA 2BM0A 2DWQA 4ZKDA 2ZRDA 1HT2E 1N6PA 1XU4A 3C14C 3RANA 1EFTA 5ANRB 2QUZA 3K0CC 1WRBA 4P4TA 1ZM7A 1FTSA 2HCBA 4XSHA 2CVFA 3OFND 4TYPA 2XNSA 4HB3A 3BH6A 4IHQA 5JECA 4DB4A 1J70A 3GFPA 2BKUA 4DC9A 1SVIA 2HDNB 1XD9A 2H17A 1MRNA 2ZU6A 5DE3A 4RFVA 5CIQA 2WWYA 1L8QA 5UKDA 3R7WA 4ASUA 4P0TA 1LNZA 4B6EA 3Q5EA 5G40A 4YDSA 1E9EA 1O3YA 4JKYA 1IAQA 5JWHA 4G5SA 3RS0A 2NTYC 1ZRHA 4F4JA 3AVXA 3CM0A 1WQ1R 2G83A 2P5SA 2ZU0C 4IKEA 3UXMA 4ABYA 3A1UA 4RKEA 2DFLA 2P3SA 4CZ2A 3T35A 1QG2A 5FL7D 1R8QA 4PQFA 3KQHA 3SFZA 1BKDR 2O8EA 4TLDA 3I62A 3TSZA 2ZUBA 4TL9A 4C0AC 2QN6A 4MKGA 2ATXA 1JEDA 1GKIA 2Z5FA 1AIPA 2V7QA 3GLHE 3LA6A 1G17A 1WMSA 3CRVA 2IWRA 2BIFA 4B43A 1WXQA 1LW7A 5EP3A 1PUIA 2WKPA 2IS1A 1G1MA 4HB0A 4XOIA 1LF0A 5JJKA 3AEZA 1MT0A 5LB4A 4C0KA 3NBZC 4O2RA 5KO2A 2BCGY 1IXZA 3QKTA 1DPFA 2RGNA 2N46A 3AV0B 4KSBA 4YMSA 3K1JA 4DVGA 5DI3B 4V02A 2ZSEA 3CF0A 1NJGA 1Q20A 4QGAA 1OHHA 3Q8XB 1HT1E 4KV9A 4TQ9A 5E7MA 2ASEA 4O25A 4PAQA 4LHZA 2O8BA 3EPLA 1MO5A 4ESVA 2C5LA 3B1XA 3QXCA 4URYR 3W6PA 2HF9A 3AF2A 2YV5A 3GLGE 3B1ZA 4IVQA 4EDHA 1E3MA 1CIPA 4W9MC 3QPUA 3DOFA 2ZR7A 2CVHA 2PL3A 3PUWA 4EFNA 3LW8A 4F4CA 4QM6A 4OI0A 4TTPA 3LBIA 1PLJA 3MWYW 3K9NA 2CE2X 5H68A 5KUTA 3EW9A 1IM2A 4ZDJA 4AYXA 5TB5A 5F98A 3HPQA 2ZETA 5EXPA 1G20E 2VHJA 4PSAA 3V00A 3GEIA 1DOAA 4LI0A 3FB4A 4DSOA 4JLPA 4PAMA 5KDOA 4EJSA 1D9ZA 4IXMA 4GMXA 3C5HA 4D2IA 3GCGA 1EWQA 2QMEA 3THOA 1OH7A 3QKSA 4EAQA 2ZQ5A 1JNYA 2ZE6A 4ZIRB 4D6PA 4FMBB 3ICQB 5KSZA 3V4RA 3CF2A 2J0SA 5LB2A 1HY3A 1TL7C 3KKOA 5DI3A 3GJ3A 3VTKA 3OZXA 1ESNA 1OW3B 1P7CA 3AVVA 1PZNA 2XITA 3FE2A 4QHYA 1R5BA 2HJVA 2XJ9A 2PCLA 5C4GB 5FH9A 2WOOA 1YJ5A 4Q1DA 1SGWA 3C41J 3GLGB 2FPKA 2JLXA 1KY2A 1E2NA 1E0AA 3THXA 4GI7A 3FFBA 1VECA 2J5XA 3GJ0A 5TVKA 1GL6A 4LJ8A 5CLLA 5FBRB 2VF7A 2Z0MA 2ZRPA 4JBWA 4MYTA 4B3CA 1LTQA 4W5WA 1N6IA 4LJ5A 3LLMA 3RDPA 2ZYWX 2X19A 5C46F 2F1IA 1FNNA 1F5NA 2ZRBA 3L8ZA 4TYYA 2HLDA 2XOKA 5JCZA 4HB2A 4Q9LA 1OH6A 2FGKA 3NXSA 1NNEA 3PJRA 2WWIA 2X2EA 4BE7B 1OFTA 4FI3C 4IVRA 3NKVA 2WJHA 3U7GA 2F9MA 4UNSA 2EFDB 5BN5A 5FTKA 4YXWD 2Q21A 2G0TA 5IK2D 3PUVA 1W2GA 2BVNA 3LX5A 3QKSB 3MG9A 4BFYA 5KOYA 2ANCA 4MKHA 2GJAA 2VP5A 4DWJA 1XXHE
chains in the Genus database with same CATH superfamily
4PG5A 5ALPA 2IHKA 10MHA 1NW8A 3E2PA 2UVPA 3RFVA 3PKZA 4PIPA 1L5GB 1W0KD 2I6UA 4OFXA 1UBJS 2XUZA 1H8EA 2C2YA 3ZWYA 1SVOA 4I7EA 5AUPB 1U0RA 4FYHA 5FP0A 5I9LA 3FHTA 3BWDD 1XRMA 4UARA 4DIMA 3BGIA 1QH0A 4DC1A 3CVXA 1AQJA 3NQ41 3EAGA 1RYFA 2ZJ6A 3LY9A 4IS2A 4OMUA 3FCCA 3MJHA 3C8MA 1C7IA 1Z5ZA 3L0YA 4L2IA 2JLVA 1IXRC 1W1IA 2PK3A 3G17A 1KR2A 3D4NA 3MLBA 4GYKA 1BE8A 5KSPA 3F9IA 3FKSD 4RY8A 1ZJJA 2Q2WA 2QSUA 3TDKA 4M8NE 2P9EA 2WKWA 4PLHA 4AF6A 3MFQA 4W82A 1THMA 1R12A 3MGBA 3QM1A 1PFWA 1TXGA 5F4BA 3EJ6A 3WDLA 4V1CA 1GSAA 5CB4F 2IPNA 3HBJA 1EJ0A 2R1TB 3RUHA 1KI9A 4ESHA 4GQBA 4AZTA 4BZPA 3Q5GA 4TRJA 3NT2A 1PKEA 5C1DA 1W49A 2AOTB 3REFA 2IYTA 4ONEA 2AFIB 3KUDA 1WW8A 2GNAA 3N3BC 3FMFA 3QXHA 4M9RA 2B0CA 1G21A 1ZYUA 1L1EA 2ETXA 1FS4A 3SBOA 3DMDA 3HSKA 4BNJA 3CRQA 1ND5A 221PA 4EB0A 2BKVA 3DVLA 3GEDA 3KAPA 4FYIA 2D62A 1Y9EA 1I4LD 1YAHA 3B7PA 3FHJA 1NRWA 3CGGA 1RQXA 2ERCA 5ESWA 3FR8A 5HCNA 3LHDA 2OXRA 3QI2A 1DDOA 1H8HA 1T4CB 1Y8QB 3E7PA 4CN8A 1OB5A 1LK7A 2FW1A 4MS3A 4HR7A 4JR0A 1RQGA 5B64A 3D7MA 1TAGA 1T0IA 2R60A 2Y1LA 3WRXC 2CL0X 4A6PA 1Y8ZA 3LSTA 5IC5A 4D26A 1RXVA 4WBNF 1LX7A 2KHZA 3HFJA 3ZI0A 3GLIE 3V1TC 4UHJA 2OESA 3HZOA 5DT9A 2AYZA 2JD1A 2LKDA 4ZD6A 4OM7A 5TY0A 2XWBF 2QRHA 2OG1A 3OEHD 2RDMA 4Q24A 1X2EA 1XJQA 3JWIA 4G89A 4PLGA 3SJBA 2CDBA 4N47A 4CM9D 5JATA 1IZ9A 5L6MB 4MUBA 1AVTA 3VTZA 4HADA 3PPVA 4QUBA 3ET5A 5KPJA 3WLAA 1NOJA 3HA5A 4V3CA 2DPMA 4M8LA 4P5DA 4YUVA 1N0HA 1RI4A 2I3AA 2YHBA 4RJ2A 1SVMA 2HA0A 3NG1A 5J4VA 3S28A 3X3HA 1AO3A 1NVUQ 1ZJZA 4I5FA 3X1MA 2AFIA 4I6JA 1E96A 4DMMA 3PHIA 4PYIA 3C70A 4P3NA 2BDUA 2CK3A 2O1WA 2O0HA 2QJWA 2WKQA 4KRGA 2AKAB 3NALA 4HQKA 4PX5A 2B2CA 4L95C 4TL8A 3OFVA 1DMRA 4MO2A 5CH8A 1J1ZA 4YGXB 5J5AA 1KRXA 2D5LA 1F8GA 2NQ2C 3DTYA 2YCBA 2AR9A 1FX0A 3SGLA 4GDMA 3MSCA 3DDNA 1CFJA 4N8EA 2W2MA 1FVHA 5KPDA 4MLCA 4GM4A 1KC1A 3RHFA 3UUWA 1KEKA 1YZVA 2ET6A 4CKYA 1U11A 1IQUA 1F8FA 4KKXB 4J3FA 5KWIA 1XF1A 2C0QA 5CLJA 2R2GA 4XVRA 3VOBA 1NX6A 3TPCA 5KNCD 3G2MA 1LBTA 3ILXA 2VJAA 3AUSA 4EJ0A 2AZDA 3Q7RA 2G1PA 3NDJA 2PL1A 1ORIA 2PANA 3FVQA 4MRAA 1R5NA 1UT8A 2H2IA 4PLVA 1FP7A 4R8RA 1KK0A 5EKUA 3UH0A 2FUCA 1WQ4A 4RFSB 1K0FA 1UEIA 1DQPA 3H9BA 2XGJA 3PTAA 4KOAA 1DTWA 1YQXA 3KLBA 1Q3KA 3SC4A 3WQBA 2O0LA 3K1TA 4YAEA 4DV4B 3WO1A 2EZ4A 1V8PA 2VPYA 3W7AA 2XCOA 4EGAA 4HEA1 1KAHA 1IN7A 1CETA 2WRZA 2ZYRA 1H2BA 3A4LA 4ZDWA 1HE4A 4ZYVA 1TYDE 1HDRA 2YIJA 3TQIA 4QVKA 4UTVA 4MI1A 3HWWA 2P5YA 5K2MA 5C5CA 4M87A 2FWIA 1XEFA 2HRQA 2JFBA 3I2JA 1KQ3A 4J4TA 4ZA2A 3GUUA 3N0XA 1D04A 4HEQA 5EHGA 4IL5A 2E9SA 1SXJD 2P77A 2NPIA 4LHEA 3RH0A 4UHHA 3H9JA 3BMNB 4NE2A 1DUVG 4N54A 3HXOA 4DADA 2RH4A 4BMZA 3JPWA 2PH3A 3ZWCA 3JQGB 4U7GA 3L6DA 8ATCA 1Q0LA 5JAUA 4YRTA 2Q5JA 1PFVA 4E1BA 5JS8A 1C0KA 4CG2A 5CNJA 3SHFA 4RK6A 2QN1A 2FCAA 4ODIA 5JPCA 2XVXA 2BSAA 1CPYA 2X8JA 5IJAA 1HOTA 2ZGVA 1M1XB 1Z45A 3K1ZA 1NSTA 3PZRA 4QBGB 3A9UA 4R7ZA 5IJ0A 2AVNA 2FEXA 4IZHA 1DC7A 1U81A 4BO7A 4OBEA 5KVSA 4XFKA 4DPLA 3IKJA 4J0IA 3WY9A 4JROA 1P29A 1W5EA 3CR7A 3SZLA 4BNZA 5L4LA 2JFHA 1IZ0A 1YFZA 3DZCA 3TMYA 1UR5A 3FPFA 4IHAA 2C2WA 4LC0A 5BYJA 1C0LA 1RCFA 3N59A 1WUKS 2XAUA 4OJMX 1K7YA 3NRBA 3T9AA 1DBSA 2R8YA 4PCVA 2O20A 3AP2A 1WBJB 3KJNA 3UHAA 2P8SA 3GOHA 3I8XA 3KXLA 3S7ZA 1R0RE 1QNLA 5EMJA 5FR1A 3VH4A 4E09A 3OP1A 2GEFA 3TZQA 4ARSA 2DLDA 2JLQA 3OX3A 3FSJX 1H9BA 1LK0A 3JQBA 4F60A 4TN5A 1P3Y1 3AHEA 1WXWA 2O48X 2ZBRA 3ASZA 2NTVA 3G5UA 5BV0A 4EFLA 3DKVA 1UBEA 4ZICA 2CJPA 2IEAA 2OL4A 1A9QA 1TI7A 4HEHA 4KI7A 4YONB 2XB8A 1PWZA 1PEYA 2ZWVA 1E18A 1RWOA 2JAXA 1IEVA 4ZI7F 2QDKA 4BQOA 4J2HA 1G7SA 1TVEA 1XQ6A 2ONZA 4O8CA 5CM8B 5IVDA 4QUEA 2V1UA 3FGNA 4URWR 1CEEA 4DB2A 1GNQA 2FN4A 2Q1WA 1I3CA 3UUEA 1S2MA 2JI4A 1VG8A 3VC2A 3ZDCA 2RBGA 5A5DA 3T9FA 4IVNA 1I7PA 3RGGA 3IAM1 4UCXA 4GWKA 2RAFA 4QJ5A 4MULA 1I01A 3O9VA 3OT1B 1AD2A 4YRIA 2CHQA 3CZ9A 4Z3KA 4JQCA 1P62B 2AEMA 1T5TA 1E61A 5JXGA 1UBHS 4W7HA 4FFRA 4YN3A 1D03A 1ZONA 1Y1PA 3CTMA 3U13A 2BGUA 3H7IA 3KXKA 4FS3A 3ZPXA 1V9LA 1OIWA 1U7TA 2X0IA 1JB1A 4QRIA 4TTSA 5EHNA 3TK1A 2ZDHA 2AKYA 4MRRA 3OCCA 4LZJA 3WLLA 2V7GA 4RSGA 4MNTA 1T25A 5F21A 4FLMA 1JA9A 2IYQA 1AF7A 3ICCA 3LQKA 3B70A 1RYDA 3KFXA 4OHMA 1OT3A 1HDEA 1P4JA 3NXKA 1UFVA 1YZ3A 4G0QA 3VKUA 1W36B 1QV7A 2IZZA 1LSSA 3H2KA 2BI7A 3I76A 3R8XA 2JFXA 3P9NA 4R4JA 2JARA 4V38A 2H1OA 1KRHA 2CXNA 3U7FB 4P5EA 3RG2A 2YWHA 3A10A 1GRVA 4WXRA 3HMKA 1U90A 3PC8A 3FCYA 1E9DA 1IOWA 5FLKA 4CL2A 4BJ1A 2WUWE 3W2TA 2VA8A 3H8VA 2AR7A 3GPIA 4QUJA 1AT1A 4TMFA 3JCZA 1SUIA 3DB2A 1SU6A 3ELUA 3DBLA 3TOSA 3H1TA 2F1RA 3WK5A 1SHKA 1ZUHA 3DS8A 2QZZA 1QKKA 1B0ZA 4D25A 1OBCA 1N2IA 3MT8A 3W3AH 3ZHOA 4F46A 1P4GA 4TRNA 3IL2A 2X8WA 4Q39A 4UAUA 2H00A 3FCSB 1H1TA 3K0FB 5C1OA 3VYUB 3C7AA 5LR6A 4I1PA 2HHJA 1WMAA 1E2QA 1G8YA 2OEPA 2WF9A 3ETHA 3GAFA 3OECA 4HWKA 3EIOA 4Y1FA 1Z07A 4DLTA 1JJAA 1HNNA 1PE0A 3CEJA 2PKEA 2Q2QA 4KHZA 5JHHB 4FEYA 1DQRA 2BH2A 3DBIA 3EYWA 3QWAA 4HAOA 2H2DA 1JKFA 3R23A 2RJ3A 3GZJA 1IRIA 1RJ9A 1G42A 1UZMA 4YR7A 3RC2A 1T36A 1YRBA 3H1BA 4RNDB 4BNKA 1A9YA 1KGSA 2W22A 4BQQA 3PEWA 2B5WA 2P4HX 3PE4A 4D8WA 5TMBA 4DJEC 1XMQB 1NFRA 1I1QB 2QVZX 1IBSA 2F3PA 3A26A 4Y2QA 3SDSA 1F4LA 2PMBA 1X9GA 1KO4A 1ISMA 1EFCA 4Z99A 2JA1A 4P4SB 2X0EA 1QZXA 2HLNA 3ZGNA 1NQ5A 4Q4HA 1NQOA 4QUIA 2HN9A 2A1TS 2J6HA 3TTSA 2HL6A 1Z7GA 3IV7A 1C2YA 1EFRA 1W5BA 4FT4A 4M1OA 5K3EA 4CQMD 2H9AA 1OX6A 1N2CE 4MGHA 3CCBA 4EO7A 2IHYA 5A7HA 4BEJA 5TF4A 3SCZA 4EP1A 3A4IA 3E1KA 3R5KA 3ICEA 5HRUA 3CYFA 1GG2A 4N0PA 2FP3A 1QF9A 3BD7A 3L0ZA 1UC5B 3GGCA 3PHGA 3RKUA 3VR6D 4AQDA 1PVOA 4CM4B 3D7SA 1F0PA 3D6MA 4MVJI 5D84A 4OHZA 4PPFA 1NXSA 4L1KA 3IAS1 4GXQA 3A4YA 5EGSA 3W5SA 4DGQA 4HVLA 2JC3A 2GN4A 1M6NA 2PBRA 3DL0A 5JCXA 5KTNA 1XNQB 1O9GA 3ZWMA 1NF2A 2WG0A 3IBCA 1Z18A 5LN1A 2X77A 1GXSA 5F23A 4UU8A 2O0MA 3QE9Y 2I4TA 2O0JA 1WVIA 2NG1A 1EVKA 1GARA 2D0IA 2QD3A 1NATA 4GOMD 4TMTA 3GLIA 4RGQA 2QTVB 4NMMA 1QWSA 4WOKA 4LV6A 3TH5A 3GOQA 2E4UA 3HWRA 1LQTA 2HQRA 4IDQA 4BLOA 3GEGA 1WHTA 4O59O 1T4DA 4WCDA 3OUUA 2R6HA 2QVYX 1EK2A 3S0JA 4DLUA 4O3FA 3IXMA 3SU8A 5DN9A 4OO3A 4ZT2A 3WFIA 3N0RA 3K9FC 3MMNA 1MRZA 1MDBA 4E12A 4IDFA 3HUUA 4EZBA 4K1LA 1U8UA 3O31A 5K09A 4O4JA 2D74A 1WM1A 2PPLA 5GONB 1NTRA 1ONPA 4DIOA 5E3JA 4X60A 5KIAA 3KE8A 1XEXA 3ASYA 4CCSA 3DGFC 4AJEA 1J2YA 2Q6IA 5ENDA 5KHLB 4IXDA 4C43A 4CDNA 3USZA 5CDGA 3OMWA 3H0KA 4PYMA 2I66A 4PPGA 1QBKC 4BU1A 2C57A 1IOVA 4U2DA 4YAJA 2G7MC 2ZBEA 3EWSA 3VR6H 5D1NA 4C29A 1DWPA 4TM7A 5AKGA 4DAEA 1VE9A 2HBYA 4F1JA 3IVMA 1UOPA 5CDSA 5CM2Z 4R69A 1HZZC 2YWRA 5HWSA 1DIHA 1JHMA 1GG9A 1Q1GA 4RDHA 3A28A 3K71B 5ALVA 2I8CA 2RGUA 3AV3A 4I6GA 1L5YA 4I2VA 4BBZA 1PTKA 2IXTA 4C3OB 4CQLB 2F67A 1Y4SA 2ID8A 4F6CA 2OZLA 3VC1A 3GFFA 1SCDA 3PBKA 4YMUA 2P5UA 4L6AA 1DTSA 4EI8A 3I09A 4YAIA 1MTOA 2GBFA 5CX1B 3E0QA 5E6RB 2R8RA 1U0FA 2KI5A 2VDRB 3NEPX 4M54A 3U9TA 2GEJA 2H4WA 3BKXA 1GN9A 4YLGA 4C87A 4BMNA 1VIAA 2EXXA 1NXTA 2VK4A 3F3KA 1DAMA 1L5SA 1UXGA 3QWFA 4JNKA 2OO5C 5LZ5A 1N5LA 1HDXA 1Y33E 3RUAA 1SVSA 4OXIA 3QY0A 1XEXB 3I4LA 4QU9A 4Q1VA 1U3FA 2WT4A 4KQWA 4V03A 4RH1A 1WSDA 5DIFA 2OCYC 1JSXA 5EMMA 3WSVA 4IZ6A 4K26A 4PBTA 3ZV6A 1I5EA 2QLJA 1JFVA 2ADFA 1N2EA 5LNK1 3DDWA 4HWTA 5TGTA 3FJ1A 3PG5A 4PC6A 4C7VA 4FHCA 3DM9B 1XD2A 1XVVA 4L50A 2REBA 3U48A 4YUWA 5K6AC 2QIOA 2Z08A 3GVPA 4K9MA 3TSAA 4IF6A 3IEUA 1KRWA 2GN1A 3WO0A 1SRRA 4OIFA 2VH2A 4ZODA 5KYXB 1YB4A 4A91A 1G66A 1TKRA 3CU5A 1OF1A 1TUIA 3CA8A 4MGIR 3R9XA 3NIDB 5KS2A 1QHEA 3E9YA 3ORHA 5FOSA 3BTSA 1YBMA 1XZLA 3BFKA 3CPEA 4PYOA 5ALJA 3E9RA 5AKYA 5KKCA 4J7AA 1S7CA 3KZKA 5CG2A 2BEWB 3DOOA 3W5VA 4B3TB 2VEDA 1CZNA 3TB4A 4R6WA 2Q5HA 3O8RA 4HGNA 3L49A 3UCFA 4G01B 5FUXA 2YWJA 4F2PA 4WZAA 3VKWA 4HNAB 1FMJA 2AOWA 4R9RA 1FA9A 1GNRA 2C9MA 2RC6A 3NJRA 1RRKA 1JPJA 4Q9DA 5DGXA 1PAUA 3C5CA 4IJUA 1T8SA 1THGA 2R6FA 1R16A 1Z7BA 2EKBA 1QGYA 2GSDA 3SFTA 1KFJB 1KIFA 4L5BA 4WVLA 2Y9PB 4MW2A 3W06A 1EGHA 1HYBA 3FPGA 1N57A 1PQYA 1QFYA 5KTSA 3SOPA 4O4LB 3H5WA 3TAXA 1Z6XA 3LRTA 4QG3A 1AZTA 5C9ZA 4IXWA 4PZ9A 3K70D 3C8DA 3FUUA 4R3NA 3SX2A 3THXB 1ZVVA 2BKAA 3U81A 3UAZA 1CD5A 4N6NA 2VOEA 5D5PA 5TT0A 2R5WA 2CEKA 1JXOA 2VDQB 4KCGA 3OFSA 1ZMBA 3R09A 1FPMA 2DUWA 1N0IA 4BO6A 4BJHB 4OREX 3ONFA 3E82A 2TSYB 3SQXA 4I81A 4IFBA 3B5JA 4OHUA 4C0HA 2HUPA 2QDXA 5FADA 3GLGA 1S3SA 4NU8X 1O96A 1PT6A 2P67A 4K0KB 5AKIA 2ZJBA 4TQAA 2X7HA 4YLEA 1KO5A 3VO8A 5GMOA 4DLZA 3P0EA 4MCHA 5GJCA 3NT4A 3GGPA 2G08A 1JYFA 4GNKA 4HO1X 1PK7A 2VDNB 1YRLA 2A4MA 2AYXA 2DPLA 5ALWA 2DJ5A 4IV0A 3IYLW 2B8WA 1EJ2A 5B2ZA 5JO0A 2YOHA 3C45A 5AKKA 4RTRA 3ZV7A 5JNVA 1QJCA 3TNDA 4PNEA 4JYMA 1H2FA 4PHTA 4BGEA 3KO8A 1SKUA 3MWEB 2HZBA 1JILA 4EJ6A 4EKEA 5BVHA 2CNBA 2KQUA 3BDAA 2GF0A 1G8KA 1UBSB 3FHLA 1Z7EA 2ZRQA 4UM8B 3QFFA 4ZREA 1XTSA 5CNKA 1KEWA 2PLFA 5JYEA 1YB1A 3C7TA 2NZVG 4C22A 5FJJA 2ZVPX 4IKPA 2Z58A 4U7WA 5GM2A 3K15A 4I4TB 4DIDA 4RD0A 4DQUA 3A9RA 5DBIA 1AURA 4TWRA 1A2KC 4J4HA 2QT9A 3D02A 4QDUA 1K7FB 4Q9KA 3GROA 1JEYA 3JQAA 2IEBA 4JJKA 1P7ZA 1PJQA 3DC7A 4IDCA 4YRMA 1ESCA 4GMKA 1X1QA 4IIJA 3ZZ1A 5COAA 1XLWA 5FTNA 1YCGA 1ZK2A 1ZWKA 3O4HA 3ODGA 4MB2A 1IXYA 2ZUWA 3H5VA 3OICA 2IUUA 3UGJA 5EP2A 2EW8A 4JQOA 4K1XA 5LUBA 3T7DA 5EYPB 1E1MA 2C3UA 2ZI4A 4YRCA 3I6IA 1T5SA 2KE5A 4QRHA 1HKHA 4U7FA 3LCRA 1DKLA 1P5HA 2EYUA 4H08A 1MRSA 2VL7A 1MVLA 1F20A 1ZJWA 1P1BA 1I10A 3LC0A 3PKJA 4XLTA 1U2PA 4WCVA 2NYRA 4YY3B 1V7ZA 4J0JA 3SC2A 1JE0A 4EG0A 1OX4A 3QENA 3GA5A 4I1YA 4MV6A 4WK4B 4ER6A 2H31A 1JIUA 1R9JA 3KJGA 3ZN2A 2R0QC 2CLDX 2D4AA 2PSJA 4DBZA 5BVHB 2IP1A 2BHRA 3AP1A 1LQUA 3DDUA 3LQ2A 1FYXA 1WF6A 3EXIA 4CTOA 2VTBB 2UUOA 1SOWA 2OYSA 4B75A 2CYAA 2J46A 4B7CA 5BRNA 1TNDA 2XT0A 4PFQA 4ZCSA 2FPPA 2PA3A 4LHXA 4BNHA 1TU3A 2WZCA 3P45A 1L8XA 2F62A 3IRVA 2HO4A 2OXFA 4HNUA 2O8CA 5U4XA 3UMJA 1SIWA 4C7BA 3T1TA 3MSXA 2VQ3A 4WLFA 3JQAB 2AG8A 1JEYB 1PFKA 2Q5IA 3JQCA 1B6RA 1XZ8A 1T3SA 3UHFA 1OTXA 2X4IA 4B3DA 5J43A 2JHFA 3CN7A 2E37A 1Z6ZA 4Z9FA 1SC4A 1DWOA 3FMVA 3LP8A 5ICCA 2UUCB 3ONDA 4OQLA 1JMVA 1KI7A 1XCPA 4QPNA 3BWVA 1PJLA 1NF8A 5ELMA 2V4ZA 4M60A 2H57A 2FETA 3ESQA 3NV7A 1VDMA 4MUKA 4K3UA 1RRGA 1UOQA 5FBLB 4FEGA 4O4IF 1OBOA 2YJTD 4GSYA 4NJOA 2IUEA 1PT5A 2KMLA 1IEQA 1Z2AA 3RYFA 4MWOA 1KBZA 5ITWA 1AKRA 1PFUA 1T5DX 1VL2A 2L17A 2WMOB 4KXUA 4M0EA 2ZRGA 3O94A 4NP6A 4C4ZA 1I3LA 4RHXA 1DS6A 1JPUA 1V26A 3T61A 3IPCA 3UPTA 3ZUPA 3U4QB 2WWGA 2G06A 1F6BA 3H04A 4NF2A 3I9OA 4OP1A 1KWKA 4CHTA 4XEUA 1YHYA 2BEKA 1Q7CA 3WRYA 4GI5A 2PT6A 5BSKA 4DANA 4I8XA 2A0UA 2XWJI 5L4SA 3GRYA 1P0CA 5TPWB 4BNFA 1R3UA 2EP7A 3RTDA 2Q3LA 3KPVA 3S2UA 3W34A 1Z4LA 1ZH8A 4N7MA 3RFXA 4YRSA 5IT5A 1A0OA 2ZS8A 3HKEA 5B3KA 4OGLA 1DZIA 1E69A 3WL6A 3EQ2A 4FOLA 2C97A 1TF5A 2C61A 2EW1A 3I28A 4BX8A 5KTRA 4M1SA 4X8OA 4HFJA 2B94A 5ALLA 4YHBA 1K0UA 3V4FA 1KC3A 4DQLA 1XZEA 3NJ8A 2ZUTA 4JLUA 3FFWA 1RYZA 2WNHA 4UU7A 4L5YA 5CFMA 2DY0A 3E7XA 4BRUA 1T91A 5JQGB 5A4JA 3TLMA 5AUNB 2QX9A 2BPOA 4P22A 1DBWA 4XLLA 1ILEA 1NLFA 3RBVA 4B9EA 3GWZA 3RYFB 2JF0A 2PGJA 1ZKMA 3ND7A 5AJUA 3OTGA 4N0EA 4YRZA 4Y3UA 2JDIA 1DX9A 1KYTA 1JAIA 1X7WA 4A0SA 2XZPA 4MCAA 1N2CB 2VXBA 3AY3A 1T1GA 1IATA 2VQ6A 2REOA 3DWEX 3U4QA 1XKTA 3G0IA 3EMVA 2COEA 3RVOA 1JB9A 4HRYA 3TTXA 5IHXA 1RM3A 2NXJA 1V1MB 4ZVUA 2WAYA 4F92B 1NIPA 3LPCA 3N39C 4CCWA 1VCMA 5I8WA 3FH0A 3ESXA 1L2TA 1VSQA 3RS2A 3MLEA 5FAKA 3PPYA 3GI1A 2XOEA 2P65A 3LPNA 1ZD1A 1J25A 4O4LF 3SIPA 3AEUA 3AR2A 5JNLA 3B78A 4Q12A 2CSXA 2KPOA 2REXB 2BSXA 5ALZA 2ILVA 3SYLA 1C7EA 4B40A 1HEYA 3KFVA 5AKHA 3HV0A 2Q62A 2Q7DA 5DLQC 4QUGA 1MAHA 3AI7A 1KEUA 1PJCA 3LWDA 4V39A 4DDHA 3NTRA 3JALA 1V1RB 1R6VA 2EZ9A 2SKCA 4KX3A 4PLPA 4KO1S 1R7RA 1UWVA 4ZQBA 3CXUA 2L18A 1T9GS 1Z38A 5IZCC 2RHWA 3ABIA 2ZUEA 1CNFA 3AYZB 3PDCA 2NU6A 4AZ0A 4HZIA 1LDYA 4QUAA 2YRWA 4TOIA 1Q7GA 3ZBPA 3FLAA 3N2KA 3U4IA 2XXAB 5JQGA 1EPUA 2O50A 5FI3A 4E0BA 1SWWA 2YZ2A 1PV4A 4LJ9A 4GYWA 1MC5A 3WWCA 1U7PA 3ER6A 3W5IA 1ECCA 1Y3HA 3N2EA 4LC9A 3ZIAD 5CB6A 4R05A 1LC0A 1GAJA 1HM5A 1RMTA 2VPIA 3NH9A 4JEUA 4PZLA 3AT1A 3T1NA 5F3WB 4XW2A 3E23A 1NONA 4CR7A 1QVWA 2AG6A 4N65A 3F49S 3O1JC 3RC9A 5E38A 4GLFA 4F2GA 1ZI9A 1UK9A 2GN6A 1GZDA 1QG0A 3FWKA 3RU9A 4BNXA 5I4KA 2OV4A 3BK2A 4YRQA 2Q3MA 3QVXA 1GN8A 3KKPA 1UDRA 3LQQA 4IGEA 3F47A 4RY9A 5DTIA 1Y3AA 5C7LO 2YHSA 2ZIZA 3QZUA 1G8MA 4YJ3B 4DREA 3PX2A 4GLBA 2GJSA 3W8DA 1U8XX 4RVOA 5KX5B 3B7WA 2IHBA 3GL9A 2AXNA 5CA0F 4FINA 1KGDA 3VGPA 5BWCA 3GX1A 2HQOA 1ZJ5A 4Q9JA 4EQ6A 1S4MA 3MB8A 2AMYA 1O8BA 3E9ZA 5AI5A 2GF2A 4QTYA 2UU9B 5IKEA 2GF9A 2XUKA 2ZJ3A 1E1KA 1NUUA 1PQ4A 3D1VA 3IELA 3O3CA 4PICA 3UJPA 4E31A 2XZOA 5LZ4A 4O3MA 3X1YA 1OWLA 2IEDA 2XYHA 1HMYA 3VAAA 2GERA 5A2GA 3FXAA 1W4BA 2VWPA 4K86A 4X92A 3VMFA 4CLEA 3UMCA 1QX3A 3I04M 2WT8A 2NV2B 4JODA 2Z4RA 1BJKA 2QD4A 2PUBA 1VP9A 4UMDA 5AHOA 2IL1A 4CFZA 2YWCA 1LDGA 1TKBA 1B2RA 2GAIA 3I6MA 5KTMA 1XL0A 5JBQA 3KXIA 2QR2A 1HT3A 3F90A 4AJJA 4INPA 1FS6A 4O02B 4XM2A 5JALA 2XVAA 2BGWA 2WNSA 3OZCA 3G13A 2D3WA 1C8BA 1KBOA 3HLTA 4FIDA 3V6LA 2ZE8A 4AO6A 1GPNA 3BL8A 2QRVA 4CT0A 5B36A 3NYIA 3U7QB 1IPEA 2E5WA 4G1BA 4KSYA 4Q66C 3SM9A 2VUSA 4B3HA 4E5KA 1NBAA 1M83A 3NC1C 3ZNNA 1FDWA 2RIPA 1I0IA 1LC3A 2X5XA 3FYHA 3B3QA 2GS9A 3TSWA 4Z7NB 4TT8A 1E32A 1JI3A 2D5IA 3B20A 4TMVA 5IBPA 4QZVA 3EUFA 1JZSA 3DEKA 3LY5A 5FI0B 3TGPA 1RLTA 4L08A 4KRYA 2ZRCA 5TXGA 3T1VA 1P0FA 1OLSA 1RKQA 2GH1A 5JXWA 2HT1A 3I37X 4AG6A 1OFIA 2Q1TA 5B2FA 5G3YA 2ZUCA 1Q15A 3G5LA 2FZKA 3O0TA 2V7EA 4JLAA 2FJ0A 2ZSKA 4M7WA 3GFVA 5KYUB 2NXCA 5K0LA 4NYJR 2O8FB 1WPQA 4CV0A 4WEQA 1KKUA 3KTDA 5A5GA 1WZUA 3GJRA 4A8PA 4B47A 5JEDA 4OKIA 4ENQA 3EG9B 1KJWA 3HEAA 4LHVA 4JZKA 5EWLB 3FM9A 1ZESA 4BNDB 4E4RA 4FFBA 4M98A 1DUSA 2PG3A 1MC1A 2VT2A 5G1OA 3C1UA 1CXZA 3TXXA 3AIKA 2ZIGA 4YO7A 1E89A 3U16A 1CUUA 5CCEA 2P9JA 3VH3A 5FNZA 5KJ6A 3NNSA 5E6UB 4Y7DA 3WI7A 4EEZA 3VR6A 4KFCA 5CA0A 1DZ3A 2XYRA 3LVQE 4QDTA 4ZRNA 3U7QA 5F5NA 1UK7A 5HM6A 3WX0A 2OAP1 3KKLA 1Y4ZA 2C4MA 3P4UA 1NLZA 3ZQ4A 3IT0A 3FMGA 1HO3A 1B41A 1ZISA 4L0MA 4Y6QA 5CTAA 3EMBA 1L4YA 4M36A 3TECE 1LFAA 4UQOA 2V7VA 3LT1A 4KQ9A 1PWEA 2WAOA 2Q9CA 3N87A 1HLFA 4LWOA 3EIXA 1E4VA 3VNSA 3EBLA 4RL6A 1KFEB 1PSZA 2IT1A 4WPGA 2PXAA 5BSWA 1PGNA 1LV8A 4NYIQ 4RIEA 2BC9A 3G0BA 3TIVA 1ADYA 3ZDEA 4KHPB 1XAIA 1OLSB 1PW5A 2QN2A 2VCEA 3LNTA 4KQ2A 4R81A 4XUGB 3RS4A 2NZWA 4B2IA 2OCXA 3FFTA 2GWHA 4KN6A 1NRJB 1W581 1M6VB 4LK2A 5JH7A 4NFYA 4GZMA 1CUJA 1MC8A 1ZVQA 4ID9A 2MSCB 3DZ8A 3UMFA 1EVJA 2EC5A 3IUMA 5GTDA 3V9PA 3EG9A 4PYRA 1KJ8A 2J5KA 3UIEA 3U44A 3SYRA 3DHEA 1QYDA 4YMHA 1KJQA 4INAA 3IP6A 5C4MA 2HYIC 1LCIA 1TW3A 2AJ8A 4YRRA 2JVKA 5DTMA 3MJDA 2JCSA 3IA2A 1XELA 3S5JA 3D6HA 3L7BA 1NC1A 3IMCA 3B2NA 4I9HA 1VL8A 4RD1A 4B84A 3OLYA 4P81A 1S3IA 1P17A 5BSUA 1MVNA 1J09A 5E6UA 4B6SA 3JWJA 2GK4A 4UJ3A 2ZAOA 1NZJA 5GY7A 3T5TA 1KMCA 1NASA 3G5TA 2JAQA 3EIEA 3OM8A 4GPZA 1K27A 4WXMA 4XPIA 4F4HA 5J58A 2BGTA 4LNUA 4PLWA 3ICOA 4QUDA 3TWOA 5EZ5A 5KTTA 2ETVA 1DC8A 4OI4A 4BLQA 1NA5A 3D2AA 4WY5A 4BX2A 1Y5NA 4IH1A 1I2DA 2XPCA 4CV3A 2P6PA 3E4DA 4RV5A 1G7RA 2I6SA 1XHFA 2IVZA 4D9KA 2IS6A 4Z7OB 4AP5A 3ESBA 1NJ6A 5JJCA 4FD2A 2SNIE 2JGJA 5DGTA 2Q3BA 3PD0A 3E18A 3HYTA 4J94A 5F51A 1MLDA 2VZEA 4X90A 1PX2A 3MCAA 3L7OA 1ZJ6A 2ZTUA 1G2QA 2YYAA 4IW3B 3L1HA 3BCHA 3L04A 3WWDA 3DXYA 4J7XA 3OF2A 1T6ZA 1ORVA 2GLUA 1UT5A 3KJXA 3W9BA 3FYTA 2ORWA 3GZNB 4CKWB 2JPDA 1U5AA 5IKPA 3BD6A 3LLUA 4YJGB 4RHFA 4W5JA 3W5AA 1G20A 3S8EA 1REQA 3STXA 4AY5A 3GRKA 2FSFA 1LS1A 1EM8A 2C5BA 2X7XA 2ECQA 1OZAA 1V2GA 3B51X 3HPRA 5M34A 3U6KA 4E33A 3KQSA 2RHHA 3IQXA 1MAUA 4MO9A 5A9RA 1KKMA 1M2WA 3I92A 4CU2A 3IERA 1A9PA 4OLJA 4JEIA 3CLRD 2FQ1A 2W6PA 3LC1O 4YPFA 2P2NA 3UFXB 3URMA 2A7QA 3FKJA 3P9QA 1ARZA 3G8AA 2CJFA 5BN3A 3KYCA 3RODA 3PEYA 1OLUA 4HGOA 3AOGA 5CEJA 3SXUA 1SG0A 3NBQA 4H4EA 3FCAA 5FNVF 3BXZA 4M9ZA 4DUYB 4EK9A 5EESA 1SCJA 5KNCA 4ND1A 1D1QA 1X92A 5DN6A 2HA6A 4ITVA 3S4YA 3KTAB 3WMFA 1N5MA 1IJKA 1B16A 3LI2A 3DMTA 3AUKA 3FAZA 3QVKA 1QIMA 4XXHA 3ROFA 4AJ2A 1ZW1A 4ZCRA 1Z3IX 4MGKR 5H83A 4R0VA 4G2TA 3G9ZA 4ZYXA 1ZCBA 1KK2A 3EDRA 3LTEA 3UOAB 3LV8A 4ISCA 5DWDA 4K28A 1L6IA 5D5QA 2XUJA 1KIAA 2BGLA 2FZLA 2QROA 3VI4B 4ASUD 5A6VA 1IVNA 5AW3A 1L4MA 2CUTA 1DP4A 3MS4A 3VR5H 1J2EA 3O3NB 5KJFA 2IY8A 4OCZA 4UQLA 4EX7A 1AUXA 2EP8A 3EFHA 3K16A 1AHIA 3PPXA 1U7UA 3CG0A 3ZGXA 4BVKA 1UXHA 5AI6A 1ISSA 3I2GA 1QKIA 2A0FA 2PTGA 2XNDA 3GGDA 3NBMA 1XHLA 1KQGA 3K92A 2PVSA 3NANA 3S1SA 3HCNA 3MJCA 1UOOA 3WKEA 1KA9H 1RYNA 2G8NA 5JD5A 2J1LA 4Q1FA 4KPEC 1YJBA 2X8AA 5JNUA 4BXOA 1DTEA 3Q0TA 4ZMSA 2VUUA 4ZCQA 3CUKA 2PNJA 5JXHA 2A5DA 5JE8A 3DEFA 3OEHA 1DX4A 4TV9F 3P97A 2BF4A 3AC0A 4R1MA 3FFXA 2R6CA 4G5HA 3L4KA 2WUGA 2FWPA 2J5QA 2GBLA 5E4FA 4IIBA 3EXEA 4WXPA 3BULA 4INZA 2RBEA 1A96A 2H18A 2RH9B 3BIFA 4XFDA 3ZZNA 4ENUA 2C84A 4LXQA 2B4QA 1YK0A 1G3MA 4LJ4A 4E5NA 1XFAA 1FRQA 1Q0SA 5D6OA 1BN7A 4MUIA 5DT2A 2RI1A 4KYVA 4XWAA 3QJGA 5IABA 1D2RA 1DAIA 1GKUB 2JIOA 3G79A 1LNQA 4BKQA 1GOTA 2Z1NA 3E53A 4W63A 4NL4H 4C14A 1JQDA 3VTFA 1W25A 5ADVA 1E2JA 4Q3KA 1Q1NA 1XA0A 2QKYA 3DZKA 3JQPA 1Z08A 1N6OA 3HABA 2KM1A 3GYGA 3GDWA 4IEIA 4BFWA 2YY6A 2I2FA 4FS8A 3JD4A 3FUTA 3L77A 1K68A 1J20A 1XJWA 5K3CA 2PLNA 3LJKA 2IV7A 3TI9A 4DJJA 2W98A 2XDAA 5KWVA 2BGGA 4OYYA 2JFFA 4FQ5A 3EVDA 4PYNA 1HURA 1QHNA 5TQ2A 2PBZA 2BN4A 1AOXA 2QBYA 5EIEA 3A27A 4BXOB 4GEGA 3SVZA 4NZPA 3LP5A 3GA0A 2J5BA 2RHLA 2EQAA 3A31A 1IE3A 3QTLA 4B0PA 5K6TA 1DG3A 4B2YA 4YMVA 4OKNA 4XM0A 3VU3A 3LP6A 3GO4A 3SZMA 1T3TA 2P7IA 4ZVQA 1HDGO 2DF8A 1VE1A 4JD5A 1O95D 4CTNA 2YS7A 1RE0A 4YCBA 4OB7A 3VU8A 1W93A 3QEMA 5J2TB 1H1LA 2QP4A 4MRMB 3BB3A 2IU3A 4TRMA 1PO7A 3IKVA 1FQJA 1FTGA 2G1JA 4GGMX 3WLFA 2IZ0A 3GELA 4EI7A 3KBBA 1TUGA 3IB3A 1ZA2A 5CGQB 1G6Q1 1ZU5A 3W9YA 3PX3A 2M98A 3DCIA 3QWIA 4BFVA 5EAIA 4X1YB 4C7OA 2CDAA 4F1WA 3OQNA 1JH8A 3EGDA 5KHAA 2I4OA 3DEAA 3PWZA 1MABA 2XGSA 4GC9A 4LMRA 3MGKA 5LPNA 5P8WA 3NATA 5ELLA 2CK3D 4OU4A 3TSYA 1BA3A 1QAOA 4QWMA 5CU7A 2WFZA 1A98A 2GZMA 4FSDA 2GM4A 3JZMA 1ZIPA 1K2WA 2GD1O 4KWEA 4RQTA 3I01A 3O47A 3ODPA 3DV9A 3SJCA 2NUPB 3WBBA 1VPVA 2BP7B 3WB2A 2AVDA 2X8L