3BE4A

Crystal structure of cryptosporidium parvum adenylate kinase cgd5_3360
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
215
Chain Sequence
GNSKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLREAIKNGIGLEAKSIIESGNFVGDEIVLGLVKEKFDLGVCVNGFVLDGFPRTIPQAEGLAKILSEIGDSLTSVIYFEIDDSEIIERISGRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRLDVFHKQTAPLVKFYEDLGILKRVNAKLPPKEVTEQIKKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Crystal structure of Cryptosporidium parvum adenylate kinase cgd5_3360.
rcsb
source organism Cryptosporidium parvum iowa ii
molecule tags Transferase
total genus 79
structure length 215
sequence length 217
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3be4A00
5G53C 5KSYA 1A82A 1ZM4A 2O8DB 2EYQA 2VPPA 3RRZA 4HSEA 3PITA 1Z0KA 3D7MA 2IYQA 4JSTA 4M2LA 1KMQA 1RKBA 5HCIA 4N1AA 4A0GA 3K0FB 4GI7A 1FUUA 2AWOA 4I1OA 3KB1A 4KBFA 4TT3D 1AZTA 2D3WA 3MG9A 2JGNA 2IS2A 2ZR7A 3KKNA 2W6IA 4LHVA 1XD2A 1JPNA 2FFQA 2WSSD 4G5SA 5H68A 5FH9A 4I81A 2ZAOA 5JHGB 2JLXA 1J8YF 2GTPA 1CEEA 4ABYA 1JI0A 5CYOA 5IDVA 3NXSA 2IA5A 2C03A 2PMKA 2QMHA 3QJYA 4ZKEA 3LVRE 3SS8A 3NH9A 4P4TA 4D82A 3U3RA 4ZI2A 1MO3A 3TRFA 3GLIA 3VR4A 2JCSA 3C16C 1D6JA 3GJ4A 4IDNA 3B85A 5UKDA 1GL9B 3EWAA 2ZJ2A 3K9GA 3Q9LA 2G77B 1X6VA 4CEJB 2AWNA 2QA5A 3DO6A 2HF8A 1BIFA 1DAKA 1Q1QA 1NSFA 3T5GA 4CZ2A 5LBIA 2B21A 1F2UA 3TAHA 2YWFA 4JIMA 2BDTA 1J7KA 2IF2A 2CVHA 1SVKA 2A5FA 4AY2A 1E2NA 4PFSA 3AKEA 3LY5A 5DISB 2JIZD 2I1VB 4UNPA 1S4QA 3EW9A 3ND9A 4M4SA 3OE7A 2OLJA 1II9A 2EFCB 4TMTA 1QHHB 3GJ7A 3RS2A 1GNPA 3X1DA 4DXAA 1ZNWA 2B8TA 1ZP6A 5EXTA 1ZNYA 2OAQ1 1WQ1R 2QM7A 1QG4A 5EE9A 4PC2A 4AWXA 2JJ8A 4TL6A 1XZPA 1UBEA 2QE7D 1SVMA 1BYUA 3EZ7A 2K5UA 2FU5C 1Z83A 4PPFA 4R7ZA 2FF7A 3A6PC 5KYKA 2XX3A 4MKGA 3WBKA 3N2IA 1YRAA 4US0R 1P2SA 1GNRA 4IFEA 1G291 2IYXA 4L15A 2QAGB 4LJ6A 2P5SA 4KVAA 1YR8A 2ZRDA 1VCMA 2NPIA 1Q44A 3I3SR 1SZPA 2OFWA 2Z5FA 2QGNA 2RB4A 4RD6A 1NF3A 1TUIA 2REXB 3PJRA 4JVMA 2ZR9A 2PZGA 2YZ2A 3QKRA 2HYDA 2BCJQ 1ZBDA 2ORVA 4MRNA 5A5GA 1S9HA 1QVRA 3I32A 3FFAA 3SN6A 4AKIA 3U3KA 3KXKA 2ZETA 4OHXA 1JB1A 4TYQA 1AM4D 1E9FA 4F93B 3DHWC 4B74A 4O3MA 4B33A 2BMJA 1WE2A 3P26A 1WP9A 2ZE5A 3EZ6A 1T4GA 2MMGA 4PHTA 4LJ5A 1KMHB 3CRQA 4JKYA 4NKRA 3NTUA 1Q21A 1SHZA 2HJVA 4P31A 4M22A 4WZAE 4MYHA 1Q57A 4JLBA 2AFHE 3FMPB 2V7QD 4II7A 2X1VA 4UXHA 4HUTA 3K70C 4TTRA 1JXMA 4OHVA 1E2JA 3LWNA 4XD7D 1HH4A 2WVJA 4Q4AA 1U0LA 3KB2A 3TLXA 4QHSA 2IEYA 1ZUIA 2CLSA 4R71A 2IS1A 1S3GA 3I8SA 2AXNA 2DFTA 2BMDA 1CJMA 2OE2A 4XWAA 3KKMA 3LBIA 1G3IA 1KSJA 2CHQA 1KIMA 1M74A 5H70A 3ZZ0A 1E2IA 1S3SA 1W4BA 3MCAA 1CRPA 1OE0A 2OAP1 1LV7A 1ONBA 1NBMD 2D74A 2W58A 4WBSA 2ZREA 1KDPA 4FMDF 4JLOA 2Q21A 3T1OA 3W3ZB 2KWIA 2V6JA 4QKQA 4DVGA 1G3RA 1W2HA 5HPYB 5JFGA 2ODEA 1S2MA 4RFSA 1G1MA 4HUQB 3LBNA 4A0FA 4TQ9A 1XPUA 2WJVA 3I73A 2VP0A 4K81B 4ZIRB 2RH5A 2VIIA 3GFPA 4LK2A 4MKIA 3AQ4A 4RZ2A 5DE3A 1OH6A 4UNNA 3GJ0A 3TR5A 5L3SA 4PAMA 3U2QA 4WZBE 1FP7A 4B6EA 5KUTA 2A5GA 4XTCS 3OEHD 2GCPA 2JLSA 4YXWA 2C9OA 2OCBA 3MMPA 4G5OA 4LUCA 2BM1A 2JLZA 2WKQA 1RRFA 2IT1A 4KLZA 5SZIA 1E9CA 2ORWA 1ZIPA 3NHBA 1LVGA 1E94E 5JJKA 3WP1B 1QHYA 1OFTA 2DR3A 1CBUA 3GQBA 2HUPA 3QVUA 3L43A 3CZPA 1OXTA 4DLWA 3CPEA 1CJUC 3QIAA 2V4ZA 3CF2A 4JT4A 2XNDA 3ZGXA 3KQNA 1KYIA 4A92A 4B44A 3FVQA 2XTNA 1CS4C 4NCKA 1G16A 3FKSA 1W7AA 1ZM2A 4G5QA 4JLMA 4LV8B 2FH5B 1QG2A 3L0IB 3WYAA 1G8YA 1OB2A 1XJ0A 3LQRA 2D62A 1T5IA 2YWEA 1OB5A 4IW3B 3H0KA 1WCV1 1DG3A 2CNWA 3CF0A 3OFNA 3QF4A 4P4SA 2CE2X 2DFNA 1RJ9A 2JA1A 3W90A 2F6RA 4TT3A 3RANA 4V03A 2C8VA 1NG1A 1KI3A 4LRWA 1IN6A 3FHCB 3CB4A 4NHOA 5LD2B 4JL5A 2XNSA 3GLIE 4KJZA 4XVRA 2QI9C 3T1VA 2GEVA 3THYB 2X2FA 1S1CA 5FBRB 1DADA 1SKYB 2ZRMA 2IUUA 3IQXA 2WJJA 4MUAA 1JXOA 4Q9IA 4C9BA 3PV0A 3SQWA 1EX7A 2ZJOA 1PLJA 2RCNA 4JLNA 4RD2A 2OBLA 3A1SA 3LV8A 2O8FA 2WWWA 3BIFA 2VYFA 3R8CA 3REGA 3TR0A 1DBSA 4EFNA 4DB2A 2R62A 2CHGA 4QBHA 1OXUA 1R0XA 5J4KA 1R0YA 1OSNA 2FZLA 4UQOA 2KBFA 2GK7A 4A0RA 3BJIC 4DT1B 2HT1A 1KDTA 2VH5R 3AF0A 1AS3A 1VG8A 1E2QA 2ZVPX 1L7VC 1Z6GA 4PQFA 3A37A 2OXRA 4JBWA 3PUZA 2WMNB 4I1UA 5JECA 2HT6A 5P21A 2GXUA 2WOOA 2X19A 4WW0A 2O8DA 1OV4A 1PVOA 1FZQA 1RE0A 3SYLA 4URUR 1ZM7A 2AKAB 4DEYA 1W36C 1XEWX 4PHFA 4FCVA 2DPXA 2GILA 5FL7A 5J40A 2QORA 1U81A 2JDID 1NRJB 1G7CA 3U6BA 2ZU6A 5IK2A 5FBWB 1XF9A 2H92A 2C98A 3CNNA 4GZLA 3EPKA 5BN3A 1KK0A 4IRUB 1X8JA 2CVFA 2WSMA 5JEDA 5L3VA 1SXJD 1LS1A 4DLRA 3MJHA 5EE1A 2OCAA 3GJXC 1VHTA 2C96A 3PG5A 5DI9A 1Z2CA 3CRVA 2R6FA 3PIRA 2ZUCA 4NCJA 4Q9JA 4BLSA 3F8TA 4DWJA 3CKLA 3DZDA 2JLVA 1F6BA 4M9QA 2BKUA 4C4PA 2QT0A 3IIMA 1KO8A 4WZ6A 4HB3A 1N6LA 3P32A 5EE5B 4MKHA 1JBKA 2GDJA 4AYTA 3SE0A 4IFBA 3ZZTA 4RY2A 2ZEJA 1E99A 3JZAA 4ZPXA 3IILA 4CVNA 5TV2A 5JBQA 1IQPA 2YHSA 1B0UA 1FNMA 5FOXA 1HA3A 2DCUA 3X1ZA 1E79A 2IXGA 1E0KA 1L8QA 5J4HA 1HQCA 1EWQA 2ZYVX 4IEIA 4M8NE 2Q9BA 4KCGA 4Q4AB 1ZRHA 3WYFA 2J41A 1DAIA 1NJFA 3T1QA 5JMTA 4D26A 2R6AA 2VF8A 2IXFA 5KNCA 3AB3A 4Q7LA 4ARZA 1M7HA 2W6ID 4KYIB 2EWWA 2OUKA 2ZANA 3QEJA 3R9IA 4PO1A 4LJAA 2N1BA 3AGPA 1R5NA 1E0JA 2NO6A 1KO4A 1G8PA 1YR7A 1U9IA 1P60A 1EFUA 4EPWA 4KFUA 5FL3A 2CCJA 2C78A 3W8RA 3HU1A 1KK2A 1NP6A 1VG1A 2JJ1A 1YU9A 2J3EA 2ZYUX 3GJ3A 3CZQA 3U7HB 3ZIAA 4BFWA 5B58C 4OHYA 4U00A 3AKCA 4KXFB 2F3RA 1Z2AA 1VIYA 4JJKA 1DOAA 1PLLA 3OIYA 2WBLC 3QUSA 4LC0A 3IEUA 2AL7A 2BBSA 1P62B 1ZM3A 3DDCA 2FX3A 1Q22A 3MWYW 2GETA 3IHLA 3QOFA 4A6XA 3G82C 4TTQA 2JEOA 2YC2C 1KI8A 1QBKC 1QVAA 4MRPA 2A78A 4DUGA 1W5TA 4GT1A 1HURA 2R6GA 4JSYA 421PA 5HZHA 2BMEA 3WY9A 3N2EA 3UPUA 4G1UC 2ZVQX 1N6KA 1J2JA 2RHDA 5FI1B 4CT5A 2W2XA 3EXAA 4OI2A 4DIDA 3DOEA 4YC7A 1KK3A 2IHBA 1AS2A 3A1WA 3UANA 4DBLC 3CONA 4TMKA 2H57A 1JR6A 1CP2A 1GWNA 4NMMA 3ZVLA 4Q4JB 3TVTA 1II8A 2VLIA 3GEIA 3ZZUA 3QE0A 3BERA 1G17A 5LB4A 3CPHA 4DCNA 1CJKC 2HV8A 2W83A 1SVIA 4C0HA 4D4MA 3MSXA 3VFDA 3CBQA 3K9HA 5HZKA 1EX6A 2IYWA 5EP4A 1B23P 2QM8A 1C4OA 1A4RA 1N0WA 4JJZA 1KSFX 2J5XA 1QRAA 5GJBA 4LYJA 1N2CE 2FPKA 1VCNA 4V0OA 4B3FX 2B92A 4J0QA 3U60B 4ZO4A 5DN6D 1Q3TA 2QPAA 1VMAA 4JVNA 4Q18A 2NO7A 1IN8A 4MQBA 4CGZA 2QAJA 1YVDA 4KFRA 2ZM5A 3RVBA 4N0EA 2EW1A 2ZTSA 1UEIA 2QTHA 2Z4RA 1EFRA 3U5ZB 2PX3A 1ZU4A 4JBYA 1TQ4A 3MWJA 1TAGA 1GL7A 2B7BA 4HUQA 1P75A 2ZS8A 4M1TA 2LWIA 4LBVA 3EZ2A 4QGHA 5HCNA 4D80A 3AF1A 1Q3HA 1UKVY 1V43A 4L8GA 5KSZA 3AUXA 1CR0A 4NCNA 4RD4A 5SZJA 4OQMA 5CYPA 1U8AA 2XSZD 4M9XA 4MH0R 1IONA 1MO4A 2GAOA 5BYJA 3QVVA 2DBYA 5CM9C 3PUWA 1G5PA 2IYZA 2NPFA 1G20E 2CLDX 4CEJA 5KNBA 1NN0A 3THWA 3KUCA 1UJ2A 4O2LA 2F1HA 1NVVR 2J45A 3KJHA 1AIPA 1FP6A 4GSYA 1LF0A 4LHWA 3TUIC 4CEIB 1EG7A 3QKRB 2F7SA 1GNQA 3QSYA 1XBTA 4MYUA 4XWOA 4EPYA 3O8CA 4OHZA 5BN5A 3BE4A 5J4LA 4PQRA 4PPNA 2UZ3A 1RC8A 4Q9HA 4URXR 1M34E 1Z0JA 3H86A 4Q7JB 1KSGA 5BXQC 2YV5A 1EWRA 1KDOA 3CR8A 1G6OA 1XRJA 3TMKA 1D9ZA 1RRGA 4FI3C 4OHWA 4TSFA 5E95A 3SJZA 4A6PA 3NEJA 2QP3A 1KI6B 1WXQA 3MAAC 1NLFA 2IUSA 2YNMA 1TQ6A 5JSZB 1KY3A 2GZHA 3IUYA 5G3YA 4B48A 2HXYA 4RKFA 3DZ8A 2IL1A 3QG5A 4H1VA 4A1FA 1BMFA 4DCSA 5BWMA 2QTFA 3K70D 1JPJA 2JJ1D 3K8YA 1A1VA 2R6CA 3OE7D 4TLBA 3T06B 3KXIA 1XEXA 4KO8A 5JJLA 1FTNA 2FPMA 4IJMA 1WF3A 3T15A 5AUNB 3KQUA 3QXSA 1WDTA 3SHFA 4WXRA 4F4JA 5DSZA 2AD5A 4QHYA 1MO5A 1KMHA 1G3QA 1OHHA 2P6UA 1GKUB 2W6JD 3M0EA 3AVYA 1YR6A 1SVWA 2C04A 3IEVA 1MRNA 3LXXA 4TLCA 4TN1A 1FQJA 3BFKA 3RRNA 1GRNA 4JVSB 3Q7QA 1GKIA 2GJKA 4PR0A 4RKEA 4DT1A 2QP4A 2ZJ8A 4A0HA 1TU4A 2IF0A 2RAPA 3E5HA 2VP6A 4PC1A 2ZSDA 1RW4A 1W36B 2BOVA 4RZXA 2FFAA 4Q5IA 1JQLB 1H8HA 4EQ6B 2ZROA 3GCGA 3LXRA 4QHTA 4A8JB 1QHSA 2Z43A 2XXAB 1CR4A 3MLEA 1KJYA 3PEWA 3K9NA 4BLPA 1W0KA 4TLAA 3GP8A 2J46A 2OO7A 4BZQA 2W00A 4D25A 1XD2B 3IO3A 3LLUA 2XB2A 1TEVA 4LPKA 1CULC 1KZGB 3RAPR 1HYQA 1VPLA 3Q5EA 1P5ZB 2WIBA 4DLTA 1U8ZA 1NBME 5FL7D 1XTKA 1IOZA 2H1LA 2J7PD 2FV8A 4CEHB 1LY1A 4RD3A 3H4MA 2F9MA 3A1UA 3VKHA 4Y0AA 2E9SA 1E1RA 2PLFA 2J0VA 2Q3MA 2TMKA 5EE0A 5HKKA 2WAXA 1LF5A 3PEVA 1Z28A 5AJWA 2RGAA 3ZDQA 2JATA 1JAHA 1IJFA 2O0JA 4UJ5A 1EGAA 2JIZA 1N0VC 1N25A 2HLDA 2VO1A 2FFBA 2ZSFA 1YE8A 5C1BA 3BGWA 3DKVA 3LAWA 4FMCF 4JLKA 4EJSC 3W9YA 4RZUA 5E7IA 4EJSA 1BYIA 2R6DA 3I8XA 4W7SA 3M1IA 5AJYA 3TAUA 4EFMA 4GDFA 4B3CA 5C4MA 2PX0A 2J7PA 2QMEA 2XEXA 1XPOA 3A58B 2E87A 2ZAMA 2FEOA 2QY9A 1JALA 1PJRA 3PFIA 1GTVA 1Z6TA 1GITA 3CF6R 1T3SA 5DHFA 2FG5A 1EFCA 2O52A 5JCPA 2A5DA 3HWSA 2PCJA 3DEFA 4Z1MD 2XZOA 2A3RA 4M1OA 1Z3IX 1YJ5A 2ONJA 4OK3A 1SHKA 1R10A 2C99A 2Q0HA 1G5TA 2UKDA 5DYGA 4DKXA 4PC7A 5TXGA 4HLQB 4NCIA 4ZI3A 1MT0A 1MH1A 5KNDA 1VYTA 2BJWA 1TF2A 1DAEA 1P9RA 5DHAA 3ZS9A 3U3JA 3HU3A 2AN9A 4LJ8A 3I5YA 3OEED 4N0DA 1WRBA 1KI4A 4QJ5A 5GJVC 3KL4A 2FGJA 2GCNA 2OFOA 2WJGA 4P0TA 4DJTA 3THXA 1OH8A 2ZRFA 5HE9A 3H1TA 2GVDC 2ZSAA 1FW6A 1JEEA 2ZRNA 3IKJA 4US1R 4D0NA 4U7DA 5SZHB 1G64A 3P20A 4V0MA 3K0FA 1KI2A 2RGGA 1OHHD 5FFMA 2OESA 2Z6VA 3B9PA 3BB3A 1K8RA 4D0GA 5JSZA 3GJ8A 3UWKA 2VL7A 3B7GA 2KJQA 4BE7B 1PV4A 4C0AC 3I61A 4AKEA 3AV0B 2QQEA 2HYIC 5E3HA 3QEOA 5GJCA 3EA0A 1OIWA 5IK2D 1J90A 4CW7A 3ZLJA 3WHLA 2NGRA 4EIWA 3RWMB 3W5JA 1MR3F 3U7GA 1QZXA 2P0EA 1GG2A 2AR7A 3AKYA 1QHIA 3Q5DA 1RYFA 4MYTA 4YMSA 2AK3A 4TMWA 1VYVA 5F2EA 4B43A 2VP2A 2ORIA 3WXMA 1KKLA 3EZ9A 1SVOA 2ODWA 3BFVA 3ZD6A 2HLDD 2OEPA 4LJ9A 3UMSA 3EIQA 1W4RA 1W5SA 1T6NA 2YKGA 2O8CB 4LBZA 2E1RA 3EZFA 2I4IA 2WM9B 3EIHA 4IVRA 2DY1A 1PUIA 2VP5A 4YXWD 2FE4A 1O3YA 3CIOA 4QOSA 3ADBA 1XMJA 2NZ8A 3HU2A 1XEWY 2VRWA 2CL0X 1IXRC 3RDPA 2VF7A 2ZSBA 1KZ7B 1NI3A 5D3MA 2FMXA 2F55A 3KXLA 1OYWA 2XOKA 1AQYA 2ZQ5A 2H5EA 4QGFA 1VTKA 2DYKA 3NEYA 4N3NA 1LS6A 4DHEA 1TQ2A 3C41J 1OFIA 2A2ZA 3AUYA 5EUQB 3CWQA 3L2OB 2WWFA 2EYUA 3VU9B 2A30A 3VR6A 1KY2A 3O8RA 2QROA 3NBZC 1X1RA 4HAYA 4JBXA 4QM7A 1KJZA 2VHCA 3L8ZA 1G18A 3A1TA 4Q03A 4Z8XA 2VBCA 1W46A 2WV9A 4IVPA 1X86B 4GOXA 4KLNA 2P2LA 4DUGD 3SQXA 4UNRA 4TMXA 1N5LA 2Q9AA 1RYHA 5FUYA 4BECA 3NG1A 1G7TA 4D6PA 4O0MA 1NVXQ 2CNWD 4B3BA 3GEEA 1KOFA 1OH7A 4BASA 221PA 3TNFA 4HAXA 3G5UA 3AVVA 2O0KA 3W6PA 1W4AA 4AG5A 5TMPA 4MUBA 3HP1A 4URZR 2CMKA 2ZIAA 3DL0A 2XNDD 5C46F 3U3MA 2DHRA 1OFHA 3QPWA 2BIFA 3IBYA 3QQ5A 2V1XA 3HJNA 4Q19A 4BFSA 4QGGA 4C0KA 4HAZA 4AG6A 1ZIOA 2NOAA 1CJTC 1XU4A 521PA 2WZQA 1JJVA 4Q1AA 1E9EA 4HAUA 3RLFA 3BH7A 1UFQA 4EAQA 1G4UR 3AP2A 1Z47A 1GZSA 2CDNA 4LGMA 4Q9LA 4HZUB 1NKTA 1TEXA 2J7KA 3VKWA 4HLUC 3PXGA 1Q20A 1F2TA 5JI2E 3CWZA 4XVQA 4PZZA 4AKGA 4D4JA 3THXB 5FBLB 1U0JA 5L8VA 3BC1A 2ECKA 1XMIA 2BEJA 2PMDA 1N5IA 1YZUA 3FE2A 3KFXA 1Y3AA 1Z0DA 1MOZA 1X3SA 2QNRA 1GUAA 3KFVA 4BQSA 4XVUA 4JMPA 5KO2A 4DLXA 4A15A 2ZITA 3ZVNA 2QT1A 3RS7A 5BW8A 2RGNA 3L0SA 5KPDA 3WRXC 4FCTA 5JS7A 5EZ5A 3HR7A 3SNHA 4YMTA 2VHUA 2F3TA 3P4YA 1XXHE 4JVLA 4NPHA 4ZCIA 4BRWA 2GCOB 3P27A 1HV8A 4OL0A 2RMKA 1NBMA 2CJWB 2YOHA 4TL7A 1MRSA 4H9GA 2Q9CA 3QPUA 1DVRA 3B1ZA 2RGEA 1UM8A 2QE7A 3TBKA 4OI4A 2BWJA 5E4FA 5FUVA 4XSHA 5HTKA 2D4HA 2LCFA 3NKVA 3U44A 4OK6A 1OXSC 2GK6A 3QKUA 5IF9A 1E69A 2QPOA 2QMUA 3VR2A 2ASEA 4BFYA 2H18A 3U6KA 4QGAA 3R9WA 4HEJA 4OI0A 2GJAA 3DPUA 1E9AA 1KAGA 3RSLA 3TSZA 1WBDA 3O8DA 3FFBA 5J4YA 2Q3FA 3ZVRA 2A5JA 3LFUA 1GOTA 3QBVA 4LJ4A 2V6IA 2VHQA 1KHTA 2CBZA 1AZSC 2GEUA 2XZPA 5FBQB 2C9YA 4RZ3A 4C0QC 2GF0A 2IS4A 3ETLA 1A5TA 3TKLA 4DIEA 5EXXA 3GLGE 1Y63A 4LZZA 2UZIR 1QF9A 2ZUDA 1Z0AA 1R2QA 1JQJC 4KVGA 3NHAA 1M7GA 4B2LA 2LKCA 1X1SA 2BHRA 4L16A 4AURA 2HDNB 1NJGA 2N46A 2X2EA 4JL6A 4EQ6A 1F5NA 3EA5A 4UNSA 3MWKA 1ZVQA 1R0ZA 1AS0A 4D2IA 2XOKD 2O8BB 1RJ9B 1FFHA 1DAFA 3L82B 4MYCA 5FTJA 2G9NA 3S1AA 3ICEA 3VQTA 3SR0A 3BWDD 2OM2A 3AVPA 1E9SA 1XTRA 2NO0A 3RS4A 4V0ME 2GZAA 1EFHA 5E7MA 4GL2A 1CKEA 4E22A 2L0XA 1IY0A 5FOSA 1NN1A 5JRJA 2XGJA 1XJCA 5AUOB 1E4YA 1U2RA 4B3DA 4MGIR 2AHOA 4E07A 4FIDA 1E2DA 2IWRA 1A2KC 4M1SA 2KSQA 2IHYA 2F1JA 3ZVMA 2OILA 4HAWA 1HT2E 1MABB 5B2ZA 1UAAA 3GJ5A 1NL3A 1XCPA 4JLAA 3EG5A 3Q72A 4NZYA 1DELA 3AVQA 4LDJA 5J5CA 3PUXA 3X2SA 3AF3A 1MO6A 4ERNA 2PT5A 2ZE7A 5GVSA 4GNKA 2PLRA 4M9SA 2QN6A 2QBYB 1CRQA 3HDTA 4UJ3A 3VU9A 4OQLA 4G0NA 2IYVA 1OT3A 3GLHE 5KDOA 1UDWA 1D2NA 4QG7A 1T91A 2F43A 4X8HA 4ACAA 3LD9A 3I5XA 4PQYA 1UKZA 4KU4A 4PHHA 5KOYA 2BCGY 4LHXA 3GPLA 3L0PA 1G8FA 1RPZA 4EPXA 3ZJYA 2ANCA 5CLQA 4CRWB 3EPHA 1IBRA 4PANA 2NZJA 1TL7C 4BZPA 3SOPA 4D81A 1TADA 4P4SB 1UBGA 1Z07A 2WKRA 2IYUA 3Q8XB 1NKSA 2G0TA 4Z1MA 4JT2A 2ZRCA 2BBOA 4HLUA 1RFLA 1VG9B 5FTMA 1BKDR 4TTPA 2YJTD 3SC3A 1YQTA 1W48A 1XMVA 4IOJA 3WYGA 5E7JA 1E2EA 1AN0A 1FTSA 1ANKA 3FKSD 4IDHA 4QNRA 5A0FA 5B30A 3RABA 2P6NA 2PEZA 3AH8A 3B1VA 3LVQE 1CU1A 2WPDA 4RVCA 3TSWA 2ONKA 3DM5A 4ARZB 3RC8A 4E09A 4W9MC 1N6OA 4PPQA 1XEFA 4WIAA 1DE0A 2UVQA 3OFND 2CCGA 1XPRA 2FSIA 4TQUS 3AF2A 5L3SB 1Z0IA 1OKKD 2A7QA 2ZYTX 4DDWA 5J47A 5HKKD 2QRNA 4I1SA 5C18A 1DAHA 1W47A 3GLHA 4V02A 1KKMA 3IHWA 3TW4A 4OJQA 3FMFA 5DI3A 5JHHB 1Q1EA 2REBA 3A1VA 4PC3A 1YHNA 2FSGA 1WBBA 1RZ3A 4GOJA 3DMDA 3SYNA 5F98A 2MSDB 2P3SA 4BLTA 3W5IA 3I4LA 3FWYA 5F9HA 3VNUA 2ZXUA 2GESA 3SEAA 1TQDA 1E1QA 1E9RA 1HEIA 3QXHA 4NH0A 2XB4A 1I4DD 1ZCBA 2WIAA 1Z6AA 1BOFA 3NC1C 3LQQA 3GLHB 2VEDA 3BD9A 2V1UA 3QKTA 2WOJA 1SULA 1II0A 5JZVA 4MRVA 1I2MA 3KX2A 3GFOA 2D2EA 1LB1B 2JJ2D 3GD7A 2G3YA 4Q66C 1COWD 3SHWA 4E5UA 4BGDA 4W5WA 2YINC 4QM6A 4L9WA 2H7VA 3CPJB 2VSFA 3CX6A 1Q12A 4HI0E 1WB9A 1GVNB 3OIVA 1Z08A 1IY1A 4B3XA 3I62A 2HCJB 4PHGA 4XD7A 4C2UA 3V4RA 4KV9A 4C0BA 3EC2A 3RHFA 1T5LA 4AI6A 3NBXX 1KSHA 4TZ6A 2MSEB 2V7QA 2QZ4A 3LX5A 2B6HA 2REOA 1JEDA 3LNCA 1R0WA 3K09A 3B60A 4ASUD 4GOKA 4IOKA 3TIFA 1KNXA 3A4MA 2P67A 2O8CA 3WNDA 1XZQA 3JVUA 3PR1A 4UKDA 4Z51A 4K8OA 3S1AB 4OYHA 4CYMA 2V3CC 3ZYCA 1OW3B 3WNBA 2JLWA 5L3RA 1KO1A 3T35A 2FFHA 4C2TA 5AK0A 1W4CA 1RIFA 3M6AA 3MJRA 3PENA 4NYIQ 1W36D 2ZJYA 2NO1A 4A2WA 4X8MA 3WRYC 1ZD9A 1AJEA 3K0SA 2SHKA 2YVUA 1QHGA 2FSFA 2QPTA 1P3JA 3SYKA 1KTVA 2FSHA 4FD2A 1A2BA 4LI0A 2WAYA 3ADCA 2H16A 2RGNC 2ZRPA 2GAAA 2MSCB 4F4CA 3CRMA 3LLMA 4OJKA 1F2TB 1YZLA 1AGPA 4I4LA 3WNCA 1GFIA 1YZKA 5KTYA 3R9XA 1SKYE 1YKSA 1UBCA 4PSAA 3OEHA 2I1QA 5AJVB 4LBYA 4POAA 4A82A 4TYWA 1E2KA 3EAQA 2QRZA 2PZEA 4XJXA 5BQ5A 3SJAA 2ZUBA 4DC9A 1IXSB 2QUZA 2ZRAA 5EJEA 2CL7X 2X77A 2ZS9A 1HQYE 5FR2A 1G19A 3AVXA 3G0HA 3JZMA 4DZZA 1G41A 3LX8A 4IHQA 4FXPA 3IO5A 2Q3HA 1UEJA 3NIBA 3B6EA 1CIPA 5FTLA 3HYRA 4Q1FA 2B8WA 4TSFD 4FWIB 4W5JA 1O87A 4BEJA 1XB2A 4UXIA 3TUZC 1Z29A 4O2RA 2YC4C 3CLVA 4TL9A 1Z06A 2ATXA 2V9PA 3DMNA 4PTLA 3OZXA 3QF4B 2JLUA 2DFLA 2H8KA 2NG1A 3TE6A 3EASA 4YONB 2JLQA 3BK7A 3NDPA 4GRAA 1HE1C 5KDDA 2ZRLA 4HLCA 4QBFA 4XTRA 3ADDA 4IDPA 4U5XA 1U94A 4EPVA 2O0HA 2HJGA 1JAIA 2NTYC 4BLRA 2C95A 5K8UA 1NVUQ 1IY2A 1YZQA 4JKIA 3HPQA 1DEKA 3ICQB 1NN3A 1Z5ZA 5H8WA 2NMVA 3KJIA 1VYUA 4PO9A 1ZW6A 4Q1BA 3U44B 5FUWA 4JZKA 4BPBA 2ANBA 3GFTA 4NP6A 4AC9A 1FX0A 2GA8A 3NH6A 1N0UA 1XTQA 3BOSA 3K9LA 3WP0A 4BFZA 4PC6A 4EDHA 2XTMA 2CHVA 5G3ZA 3RRYA 4US2R 4CEIA 2AD1A 821PA 1KO7A 1Q1ZA 2IX3A 1MKYA 4G3XA 3U61B 4D0LB 3H84A 1UPTA 3U4QB 1FUKA 2ZRJA 3HR8A 3VHXA 3RS5A 3VKGA 4ZDIA 4CDGA 2W2VA 1P9NA 1KI6A 4LX0A 4HLDA 1LFDB 3KUDA 4F4IA 2WTUA 4B2PA 1HE8B 2NQ2C 4DSNA 3EIEA 4LCBA 4NYJR 4NDZA 4DSTA 3SI7A 3T1TA 3QI2A 4RFSB 4NYIR 1E0SA 1DG1G 2WJIA 4LY6A 4OKSA 3RWOA 4DDTA 1OJLA 1Q1BA 1ELOA 1X8LA 2Q6TA 2RKOA 4Q02A 3IIJA 1K5DA 3C14C 4YDHB 5EQTA 1NLYA 4A8JC 3KQKA 3B8HA 1E9DA 2CXXA 1N5KA 1IXZA 4NYJQ 2FDCA 3AVWA 3RC3A 3R7WA 4MRSA 4HZIA 1NNEA 1IN4A 2XZLA 5F9FA 3MRSA 2WWIA 1EFTA 4NL4H 3R20A 3VNVA 2VHTA 2XAUA 1P2UA 2ZI4A 2CCKA 2CL6X 4Q7MB 4HDCA 3IPYA 5KPJA 1BH2A 2JJ2A 1KJWA 1LNZA 3NDBB 1M2OB 2QG6A 1GRRA 4Q9KA 1XP8A 1E2FA 3UG6A 2V54A 3ND8A 1M8PA 3IPXA 5CK5A 1CF4A 1QHHA 2IK8A 2VSXA 3QY0A 5KDLA 2MMCA 5LDDC 1XCGB 4WVFA 2IYLD 1XXHA 5IRCD 2ZRHA 5FR1A 3ZH9B 2EFHB 2QQ0A 1R5BA 2BMFA 2F43B 4ITRC 3CNLA 1SKQA 2J0UA 4A2PA 2O8EA 3CX8A 3C4JA 3FHOA 3OIWA 3OAAD 5K8IA 2FZ4A 5FOWA 3QKSB 4M1KA 3Q3JB 4B75A 2WKPA 4AIIA 1ZC4A 3FKQA 1L4YA 3RYTC 4GP7A 3ZIAD 4BWYA 1E2LA 1NMZA 5DIFA 4NCHA 3B2EA 2GBLC 4Q4HA 1WA5A 2ZJ5A 1XTSA 3ECCA 3KDSE 4MRRA 1U0HC 3FHTA 3BBPA 4E03A 1Z8FA 2FWRA 2PH1A 1H8HD 3BH6A 2N42A 1VG0B 2WHXA 1OF1A 1FPMA 1ESMA 1P4SA 1ZD1A 4DLUA 4Q4LA 4WA7A 4IKEA 3TGPA 4P33A 5JWHA 5KSPA 1II8B 2D2FA 1QHXA 1K6MA 1W0KD 4Z8YA 3UWOA 4HB2A 2W2TA 1H8ED 1CLUA 2BC9A 4DSOA 1DTSA 5EXPA 4GBMA 1WMSA 3UXMA 3AVUA 1G3UA 2HCBA 4P4UA 4JLPA 4DB4A 2OFXA 1V5WA 4XIGS 3UKDA 4HDOB 1SXJA 2OLKA 3ONWA 1DPFA 3BRWD 3V00A 3V9PA 3VR1A 4EKDA 4ESHA 1GAJA 4PZLA 2ZI5A 2WMOB 3AVOA 3QNUA 4M1WA 2ODBA 2BV3A 4B32A 2IYRA 2GZDA 3SJCA 4KI0A 2BBTA 3W8NA 2DWQA 3D3QA 5JCZA 2WPDD 2EVWX 1YZNA 2OV2A 2JDIA 1S1MA 4M1YA 3CX7A 4ZCLA 5DGXA 4JLVA 1P61B 3PUYA 2QSYA 1M7BA 2EU8A 2ZU0C 1LW7A 1H8EA 4LOAA 4GPTA 1C1YA 2AX4A 2GRJA 1E98A 4IOLA 5D3QA 5LD2C 4QFMA 4URVR 2QBYA 1FMJA 3NVAA 2XXAA 2VP9A 1TF5A 2GXQA 4V0LA 5CJ2A 2KBEA 2IYYA 1W1WA 5AJZA 5DYIA 1F60A 4TYPA 1OXVA 4PPGA 4TL8A 3TH5A 4HDQB 4BLOA 4ZKDA 1TUEA 3ADKA 3H2YA 4RD0A 1S9DA 5L3QA 4C7OB 1T0JB 1BO6A 5CDFA 3I92A 1PLKA 5BN4A 2GKSA 3RSOA 3UMFA 3BAFA 3GLIB 4KYUA 3C7KA 5K8LA 3REFA 3THOA 4G5GA 1UKEA 3NBYC 4A9AA 1L2TA 1NIPA 2ZSEA 2OCYC 2X8AA 3CH4B 3QF7A 4BFUA 3IQWA 1COWA 2HXSA 4Q1CA 4LJYA 4Q4JA 5FPSA 1G4AE 1ZYUA 2QAGA 3NC0C 3DM9B 2VA8A 5G40A 1BS1A 1W2GA 4Q47A 4TLEA 5LPNA 3B1WA 3BS4A 3A4LA 5GADl 2QENA 3K09C 4PSKA 2DWOA 4KAXA 2D7CA 3PEYA 4PZYA 3MGCA 2BVNA 1NG9A 1HY3A 1IN5A 2CJWA 4I1VA 5CLLA 4B34A 3R7WB 3L0OA 4F91B 4HYYA 2PBRA 1CXZA 3KKPA 4DLVA 3D8BA 4KHZA 1ZJ6A 4G01B 2YOGA 2NO9A 5JEEA 1E2MA 3AM1A 3W3AA 2QGZA 1JR3D 2IC5A 1FX0B 3NWJA 2GHIA 4QXAA 4ZDWA 1VCIA 5DNYB 2OSBA 2P65A 2XSZA 3BB4A 3A4NA 4D4KA 1F48A 2AK2A 3SFZA 4LC1A 3WHKA 2J1LA 4TZ0A 3FB4A 4ZDKA 3MWLA 2XITA 1NY6A 2FJUA 3B9QA 4ACBA 3LW7A 1U99A 2EWVA 1AKYA 4DCUA 2QP9X 2OHFA 1IHUA 4GP6A 4FW9A 1XTIA 2CEAA 1NVWQ 1J70A 3B1YA 2O5VA 4H1UA 3SBDA 4IEEA 4BFTA 3JVVA 1Z6YA 2VTKA 2PL3A 1QDEA 4W5HA 4RCZA 4AYXA 3SU8A 2VSOA 2EFDB 1UF9A 5EP1A 3K0EA 4TMZA 4QBGB 3IGFA 2A9KA 4HATA 5AJXA 1OYYA 5KSOA 3LDAA 5FOTA 1GRQA 3THYA 3B5JA 4JLJA 4M9ZA 3ZQJA 1FNNA 121PA 2GWHA 3TK1A 4LBWA 1XJQA 3U3OA 4DLSA 2GF9A 4OQFA 3OIUA 4M1MA 4Q48A 1GIAA 2YYZA 3AGQA 4BLQA 1P73A 4NYMQ 3B13B 5EP2A 3WBJA 2RGXA 4ASUA 5L3QB 4C7OA 3FTQA 5B64A 1TTTA 2QU8A 4NU0A 4B47A 3C15C 1YZTA 4HB4A 2HF9A 3UK6A 4NONA 3WMFA 5TDHA 2PEYA 4YDSA 4A36A 1R6BX 3GMTA 1US8A 3C8UA 5TVKA 3CH5A 2IWHA 1ZD8A 2YWHA 3O8BA 3PVSA 4UNQA 3L8YA 2JLYA 2OBMA 4MITA 3TSOA 4QL3A 1N6HA 3IBGA 3IDQA 3PQCA 1T9HA 2C2HA 3I72A 1KI9A 5TY0A 1T8UA 3B1XA 2ZI9A 3RS3A 2OZEA 1ODFA 4AK9A 5K8TA 4V0KA 1C9KA 1KI7A 1NVVQ 1S8FA 1XWIA 3VTKA 5DI3B 1N6IA 4JYBA 1UADA 2WWHA 4KFSA 5FBVB 2FN4A 2OT3B 2ZRGA 4Q4HB 1AKEA 4Q1DA 1P6XA 2CE7A 2G1KA 1PUJA 3K0AA 3U7FB 1SXJC 1QHNA 2IEZA 3KZ1E 4L9SA 4RSGA 2XJ9A 5JWOA 2ZE8A 1W0JA 5CM8B 3QKSA 3U4QA 4R2IA 3K0CC 1CTQA 1XTJA 3KQLA 3K0CA 1KDRA 1DO2A 3FYHA 1CJVC 5FUXA 1E2PA 2ZI6A 1A7JA 3EPJA 1M1YE 2A5YB 4IDOA 4DDUA 3LRPA 2R9VA 1G3MA 1OIVA 5FPYA 1UDXA 1CR2A 1XEXB 3N70A 3W6NA 4C3ZA 2XJ4A 1E96A 1EK0A 3QXXA 4QJ3A 4MKFA 4G5RA 3TQCA 3ZD7A 3LO5A 1SQ5A 1RRCA 4TWZA 2GJ9A 5F3WB 1NN5A 5FTNA 3FPAA 4M0LA 3AP3A 3M4YA 2PJZA 3Q7PA 4FMBB 5BYKA 3J81k 4HB0A 3DVLA 5C2JB 4JS0A 5FI0B 4LYFA 3T12A 4LV5B 4DCVA 2DFKB 3QXJA 2JASA 4LYHA 3K53A 1XFAA 1ZUHA 3ASYA 1XD9A 4NTZA 3TQFA 1TNDA 4AD8A 3VHLB 4DEXA 1IAQA 2AKYA 1H65A 1FL9A 5M04A 4PAQA 1XXHB 1YR9A 2ZI7A 4DCTA 1GSIA 3EC1A 2JLRA 3OESA 1VECA 4EPTA 3GLGA 4LYAA 3FDIA 3FGNA 1HTWA 4Y0VA 4LSGA 3SBEA 4DLYA 3SJBA 4DDVA 2CLCX 1GP2A 1ZINA 1N5JA 1R8QA 2JAQA 4B3GA 1D9XA 3E1SA 2QSZA 1E1RD 2EFEB 1OIXA 1W44A 1UKYA 1YRBA 4TMVA 2ZJBA 3SFVA 3BB1A 2FGKA 1U98A 1MABA 5B57C 3VX3A 1KK1A 5DO9A 4R98A 2VQSA 1VDZA 1ESNA 3KJEA 4ZV4A 1R4AA 4MGKR 4C30A 1CR1A 1E3MA 2Z0MA 3QPVA 1E2GA 1XD8A 2EQBA 3RS0A 1W0JD 5ELXA 3LA6A 3OF5A 3AP1A 4RD1A 4TLDA 1AGRA 2ZI3A 1E1QD 2Y8EA 5DH9A 2G0NA 3TJZA 1IM2A 1P9WA 2GJSA 5CDFE 3MD0A 1SGWA 2P5TB 2FEMA 3OHMA 3E2IA 2IW3A 1IN7A 3KKOA 1G7SA 1OLOA 4DSUA 4NBSA 1R7RA 4KSCA 1D8TA 4V0NA 4MGYR 1FOEB 1FMLA 2WJYA 4OBEA 5AUPB 2C77A 4KODA 4LHZA 3KQHA 3FOZA 3AEZA 1D2MA 1KGDA 1R5OA 3T34A 1SXJE 2WSSA 5TB5A 1G7RA 4QRHA 4LHYA 3OEEA 3EX7C 1SVSA 1N3BA 2C5LA 3CM0A 4B35A 4URYR 4MDFA 1RRPA 2IYTA 2GXSA 4C0SA 2AXPA 4C0JA 4XH9B 1D2EA 4BZXA 2KB0A 4FCWA 3ZS8A 1YZGA 3PCRB 4A2QA 1P7CA 3D31A 4D4LA 2ZJAA 2P6RA 1GKYA 4FMDB 4QNMA 5H1YA 4TQAA 2Z4SA 3KTAA 1J99A 2RGDA 4DLZA 5CIWA 2ZRKA 1ZM9A 4GMXA 4C0LA 3HPRA 1E0AA 1AQUA 4CF7A 4IXMA 5FTKA 1P72A 4EUNA 2IXEA 2AFIE 1T8TA 4JYCA 5CITA 1HT1E 1GDDA 3VMFA 1EFRD 4S35A 4BFXA 4O25A 3GJ6A 2F1RA 3CR7A 1U90A 3IIKA 2GNOA 1OPXA 2V55B 1E9BA 2QAGC 1F2UB 3P4XA 4I99A 2IYSA 4RFVA 2H17A 1P2VA 2Z83A 1E4VA 1Q0UA 4WAUA 4XOIA 5DN6A 1G8HA 3BXZA 4X8OA 2YOFA 1E6CA 2F9LA 2GCOA 3C5HA 3KJGA 3MUFA 3CNOA 4Q00A 2ATVA 1GM5A 1ZC3A 4F38A 4BEBA 4IVQA 1J8MF 5FOUA 2FA9A 2GJ8A 2ZRIA 1JNYA 3BH0A 3LW8A 4M21A 4GZMA 3UMRA 1I2DA 5HE8A 1D5CA 1VKJA 4EPRA 4KFTA 5JLJA 2W0MA 2WWYA 5IHPA 3B82A 2KI5A 4JL8A 3GLFB 5FPHA 4QC2A 3GLFE 3LH5A 3ZQ6A 4YMUA 721PA 4B6FA 4HAVA 3UG7A 1XCMA 5EP3A 4A8JA 2D06A 3DKPA 5CB6A 2FPLA 3D6TB 3FMIA 3X1WA 1XX6A 1Z0FA 5CIQA 3X1YA 1Z22A 3B78A 2BEKA 1E32A 1T3LA 2GXAA 4MDEA 5JWRA 1NMXA 1L4UA 5EXSA 1NLZA 1JJ7A 4IDQA 3A8TA 2CK3D 4TYNA 3I1FA 3CUEF 3A36A 5JRZA 3TUJC 5C4GB 2R2AA 4NYMR 1DAGA 2QTVB 5A4JA 1VCOA 2BBWA 2WWXA 1JR3E 4Q1EA 4TYYA 2XTZA 2DWPA 3W6OA 1E79D 1KO5A 3ASZA 1JECA 1XNJA 2ERXA 4PX9A 5G41A 2V8OA 3LBHA 4XSGA 4A4DA 1XDBA 2G83A 4YLGA 5AWFC 4ESVA 3CRW1 3Q85A 2R8RA 5FOVA 4QBIA 2ODNA 1ZAKA 2IBMA 1G5RA 2ZS7A 4FN5A 4Q21A 2ZPTX 3KTAB 3PUVA 1G6HA 3MFYA 6Q21A 3C5CA 1AA9A 4URWR 4OI1A 2YWGA 1DS6A 3RRMA 1U8YA 4Q01A 2KE5A 4GFDA 2QEQA 4AYWA 1N6PA 4BFVA 2GBLA 4ZIRA 2OXCA 4YMVA 1G8GA 2J0SA 4OQNA 4ZCMA 2O8FB 4X8LA 5J4VA 1DAMA 2VHJA 1JR3A 3AF4A 4Z54A 2DB3A 2J9RA 2G88A 3HYTA 2GVZC 3PEUA 1XMSA 4Q7KA 4FWTA 4AKHA 3T5DA 1FQKA 2PCLA 621PA 1E2HA 5DLQC 2IS6A 1EESA 1LTQA 1OFUX 2VP4A 4KSBA 4B76A 3THWB 2F1IA 4IXNA 1ZCAA 4GMDA 1US8B 1W49A 2R65A 4CIDA 1M6NA 1AK2A 3AVTA 1T0HB 1IJEA 3VR5A 3EPLA 3X1XA 1ZNZA 3F5FA 5KU1A 2B7CA 3K0AB 2WJHA 3KKQA 3K1JA 4OQXA 3AKDA 2J0UB 4YMWA 3VX4A 2O8EB 8OHMA 2QMOA 4MGZR 5HR5A 1Z6XA 2PT7A 1S96A 1P2TA 3NBFA 4WXPA 4ZDJA 4F7WA 4DRZA 2WWGA 5GVRA 4RJLA 1N6RA 4FINA 5TARA 1K5GA 5EE3A 4KITB 5KHOC 3DOFA 1N6NA 1GILA 4P3YA 1R8SA 2PZFA 3CW2A 2EFGA 3F0TA 1TF7A 1KI1A 4BUJA 2FNAA 5D3MB 3BORA 1ETUA 4HZUA 4M53A 5EZ6B 3OAAA 3SDZA 3EWSA 1U9IC 4R9UC 1DO0A 1ZUNB 4K46A 1KAOA 2LKDA 3QBTA 5JJIA 1UBFA 4XWKA 2D7DA 3WMGA 4B2IA 4KBGA 3TVDA 3CRRA 4YQFA 1OKKA 2J0QA 3K70B 3GLGB 5GJWC 4NE2A 5IT5A 3UIEA 2ERYA 2ZYWX 3R8FA 1TX4B 2J59A 2ZR0A 1OXXK 4BRUA 2RGBA 4U02A 2NIPA 4L5BA 1G9XA 1VIAA 2IUTA 2J87A 3WMEA 1NSTA 2OG2A 3BFXA 1TPZA 1PZNA 1KNQA 2BKEA 2ZE6A 4RCYA 4R2HA 3VAAA 3P1JA 2W0SA 2W6JA 2FOLA 1G21E 5ANRB 1SXJB 1OH5A 4EFLA 2GEDA 1Z63A 4PAOA 2OBNA 1S0UA 3CO5A 4OK5A 5JI3E 2ZJZA 4LV6A 1DARA 4S2EA 1ZMXA 4IOMA 4PO8A 1GL6A 3T61A 4MA4A 5SZKB 1I4LD 2OCPA 2RHMA 3N5CA 2WICA 5FPKA 1I4TD 1VHLA 2BM0A 1TU3A 2QL6A 4QJ4A 4UXJA 2CK3A 1ZU5A 1EXMA 3W34A 3E70C 3QENA 2ZRBA 4PXAA 1NY5A 4JLDA 1TMKA 1BMFD 3VR3A 4ON9A 5LB2A 5JS8A 3RNLA 4P32A 1X8KA 1MV5A 3TW8B 1ZNXA 4L4UA 3GEHA 2HEIA 3UATA 4FMCB 2I3BA 5CJPA 4PSVA 4CEHA 3QG1A 4CT4B 5CB8A 1F3OA 5FPTA 3O47A 1RVDA 2G6BA 2RGCA 4LJ7A 3F3YA 4LPSA 1HUQA 4B71A 5EUMA 1T3HA 3V4FA 2O8BA 2R44A 2G1JA 5CK4A 4EJSB 1NMYA 2BJVA 3FMOB 5AUQA 4B73A 5AR1A 2PJRA 4ILEA 3EARA 4LWZA 1SVLA 4F92B 1NIJA 2C9CA 3SZRA 3GLFA 3QXCA 3U7EB 4WOPA
chains in the Genus database with same CATH superfamily
3R74A 4CL8A 4MLPA 1ZM4A 3O8LA 4LRTB 4N65A 4DS3A 1KTIA 2H52A 2WUVA 2EYQA 2JFWA 1Q92A 4ZOLA 3PITA 1HE4A 2IYQA 4M2LA 1KMQA 5KYNA 2XUQA 3H1PA 2B3DA 4NZ9A 2PR7A 2RHJA 5CW2A 3KB1A 3ZK9A 3N86A 4LFBB 4KQXA 2GSDA 5SV2A 4K2HA 1KU0A 2D3WA 1U1GA 3R3YA 2O6HA 2JL1A 1X7GA 2ZR7A 1FFCA 3CF4G 3G2IA 3OI7A 1OVMA 3GDFA 4Q0MA 5AOVA 4LHVA 4ZO6A 5JCOA 4YXFA 3FNRA 4MP8A 5H68A 1KFBB 4DANA 2HIAA 3A9CA 3P0JA 3F6PA 4E32A 3HYCA 4GEKA 4U0KA 2WG1A 2CB0A 3JYQA 3F1KA 3UV7A 2XLBA 4DQXA 3TFQA 3CLSD 4A5SA 5C1DA 2IA5A 2R68A 3QJYA 4ZKEA 3W8FA 4UE6A 3BD6A 4IFTA 4O29A 2DOKA 1T8YA 1YMUA 4LHSA 4ZODA 3U3RA 4ZI2A 4IIXA 3WL5A 3ANSA 4HEQA 3C16C 3H2ZA 3VR4A 3HZOA 4IDNA 5I9NA 4ZO9A 3T9DA 3DBLB 2XWQA 3KC2A 4IIVA 4LQCA 3RRFA 4FR5A 5I3ZA 1E4OA 3Q9LA 1ZMBA 4ENSA 2WTEA 1RQNA 2WI8A 1S2DA 2HF8A 2R1ZA 2ZJ6A 1Q1QA 1BFUA 1UJ5A 2X0NA 2VS1A 3CGGA 4ARVA 4DMFA 2DFDA 4O59O 3NBMA 2FHPA 2B21A 3VYUB 1EUCB 4QAQA 2YWFA 2OZKA 2BM9A 3SM9A 3ADOA 4XRRA 4Q93A 2WJZB 4CKBA 1PEYA 1RKQA 3KPVA 5EQFA 3E48A 3EE6A 1E2NA 4J16A 4IHJF 4KQWA 4TKLA 3IJRA 3LY5A 4NFLA 1L4HA 4A10A 4RTPA 4G9GA 2Q07A 3LFHA 2L18A 2P69A 2K2WA 2A7XA 2W6CX 1I94B 1LJ8A 2IH4A 1CUAA 1ZPDA 1B16A 1HKUA 3BSYA 3CLTD 3GJ7A 1V95A 3RS2A 3X1DA 1F6DA 2W5UA 4PIVA 1YQEA 1ZP6A 2CUTA 3DDNA 4RWEA 2VZ8A 5EXTA 3V8RA 1XRRA 4AJLA 4FHGA 5EE9A 1WUHS 4PC2A 5K2MA 2JJ8A 5ABPA 4KXVA 1C8BA 2Y1LA 3OE5A 2VJBA 4MEAA 3EZ7A 4BC0A 2QVZX 4N82A 4PG6A 5KOJB 2K5UA 4LHEA 3OPYA 3AMVA 4R7ZA 1MO2A 2BKAA 3R7AA 3P9RA 5B55A 1O4WA 3GA5A 1U3FA 2PY6A 3IVMA 3D6NB 3NNSA 4MKGA 4LDAA 2AZMA 3M82A 4US0R 4RV4A 1H4TA 1TC1A 2CMGA 2ZWPA 3H1FA 4IFEA 4LJ6A 4YJGB 2GCIA 5U9CA 5B6PA 3VNQA 3D6UA 2ZRDA 4CV1A 4KR7A 1R0SA 5AK4A 1K68A 1Q44A 4WV3A 5DN9A 1DQZA 1SZPA 4ZFNA 3EAGA 3ESZA 4LTNA 1PGPA 4NJEB 4CR6A 1XZIA 2EZ8A 2BR4A 2P9CA 1NF3A 1X13A 2QGNA 2RB4A 1E3WB 4LQ4A 2REXB 4RD6A 3UOWA 3T4XA 4JVMA 2YZ2A 3UAWA 1EFPB 3MZ0A 1AHHA 2BCJQ 3FVTA 3H5LA 1ZBDA 2ORVA 2RH8A 2X8WA 4W1RA 4I5DA 3HXKA 4WY2A 1S9HA 1JPVA 2JFPA 3FFAA 3I32A 5A5GA 3KOOA 3U4IA 5BUSA 1HG1A 4RC9A 1DHTA 1VJ0A 3PDIB 3VZQA 3C1TA 4BN4A 3UVEA 1LRJA 1HORA 2CYAA 1I4WA 2BMJA 2BPOA 2PGIA 1MNAA 3P26A 2EZUA 3EZ6A 1KIFA 1SBZA 2WF7A 3HBMA 3R5HA 4FFWA 4G1VA 1KMHB 4LJ5A 3CRQA 1BEZA 2YIMA 2AG6A 3NTUA 5CXQA 1SHZA 2GNAA 3K8OE 3EDRA 3OVMA 2IHNA 4FFNA 4HXYA 4G8DA 1EG2A 4CM4B 1BDIA 3TDNA 4CIWA 2V4UA 1LI5A 3R41A 3W5UA 2JHCA 2NU7A 1QYXA 2AFHE 1EXDA 2HK9A 5KYYB 2PLAA 4UXHA 2P2YA 1H1DA 3UY4A 3KLPX 4RZIA 3STHA 1BWPA 2Y1EA 3V6LA 4D9EA 1T9AA 2RBKA 2WYHA 5CH8A 1EFKA 3LWNA 2A0KA 1JBEA 2P35A 5BUZA 2R6JA 3KB2A 5EHQA 3E9CA 5DNCA 1N2XA 3WQBA 2CLSA 2PTGA 2I2WA 1YL7A 2JZOA 3WKCA 4DNFA 5BWNA 3LBIA 1GG9A 1G3IA 3EFEA 3F4LA 1QRRA 4PNZA 1LGYA 1E2IA 1S3SA 1W4BA 2ZT7A 3HHEA 4I5IA 4JOSA 1OE0A 2PX6A 5LQUA 1ONBA 1NBMD 1TGVA 4EBFA 2O20A 1O6CA 2GJ4A 1V16B 4RSMA 3LUAA 3ZX5A 3G6KA 3L6EA 2HGSA 5F1KA 3RG2A 1HT3A 4D8WA 4IIFA 1ID8A 1CUDA 1CY0A 2B4RO 2Q21A 5DM2A 5AW8A 5B4VA 4O08A 1X7DA 3WICA 1M5UA 3OA2A 3FDFA 3WK6A 1CB7A 1G3RA 3O2JA 1UZMA 4P9NA 2O3QA 1G21A 5KNLA 3OTOB 3OHSX 4C4ZA 1TRKA 2M1XA 2CB9A 3NALA 3KT0A 4HUQB 4O8ZA 5AI4A 5KS2A 4TQ9A 3I73A 4BN5A 2ZJ7A 3L7KA 3HWX1 4R69A 3TL3A 4F0JA 3RC1A 4C0XA 3TW0A 1OX4A 2QN9A 3KZVA 1O96A 3OLQA 2FLVA 1EA5A 1U3DA 5DE3A 1SUAA 1OH6A 1DCTA 3WYDA 2VHZA 4QO7A 2OC9A 4MV1A 1UFRA 3DNFA 5AOAA 4WT7A 3TR5A 3UJ7A 4PAMA 2NZVG 1C7QA 3U2QA 5AM4A 4BEVA 4C4SA 2A5GA 4YVFA 1MZVA 3ISVA 2JLSA 3EGCA 1OU0A 3PWSA 5JISA 2OCBA 3SSNA 3VUFA 2JLZA 1EVKA 1IHXA 2BM1A 3E4DA 2F3PA 3HNPA 2IT1A 1XOIA 4A0QA 4N5HX 1E9CA 1V5EA 5BVGA 1UCFA 1G42A 1HE3A 1ZEMA 1ZIPA 3BCRA 4L5JA 1E94E 3WE7A 1M6EX 1OFTA 1QHYA 1CBUA 1F4PA 1NURA 1S3IA 2HUPA 3GQBA 4HADA 3L43A 4M88A 4I6JA 1LJUA 3ZGXA 4OHOA 3FVQA 1YUBA 3CUWA 1Z4NA 1L8OA 4MVYA 4QRDA 3ENNA 1MU0A 2L19A 1A9YA 2XCUA 3LQRA 2D62A 2LDXA 3KZKA 5DX1A 4F3TA 4BKRA 4QODA 2QI9F 3H0KA 3QLUA 4YQZA 2LCQA 3D2LA 2CNWA 2QVXX 5FEUA 3KQPA 1IFXA 2N47A 2QJRA 4GGMX 1QO9A 1QVWA 1EGVB 3GCXA 3RANA 3RTAA 2C8VA 2WC1A 2PT6A 2JIMA 4LRWA 1R4NA 3WNVA 4NHOA 4NOLA 4JL5A 4R8MA 2QI9C 1RT9A 2OHOA 4LOJA 4A03A 1U9JA 1WXEA 4KK4A 3TBHA 2A6PA 2ID7A 3LUHA 1JHMA 2GZ2A 2IUUA 3W3AD 1SBYA 2WJJA 1B41A 4MUAA 3NYRA 4ZAYA 3SE7A 2BJHA 3V32A 1H2ZA 3GLTA 3IODA 3PRHA 2PIAA 3HSSA 1PLJA 4N9QA 4YO8A 4J6EA 4JLNA 3P9QA 3BX1A 4QJIA 4CQLA 2VK8A 1TJYA 3CCFA 2OHHA 4LNHA 4P6VF 3REGA 4G86A 3TR0A 4QTUB 1O7JA 2J8ZA 5C53B 1B14A 2BUBA 1XT6A 1DJPA 5TQ2A 1NM5C 2AYZA 3ZC3A 5BY2A 1RJGA 6ADHA 4OSOA 2A14A 2GK7A 3FMGA 1F7VA 4LE0A 2ZVDA 4N7MA 4FR0A 4O5AA 2ZVPX 2A9VA 3MMNA 4M1ZA 2QVCA 3Q3HA 3KVVA 1Z6GA 3G8DA 5JMOA 2ZOSA 5MFPA 2Z5GA 1THGA 2ZIFA 4JBWA 2WMNB 2JJQA 1T3ZA 3AJRA 3MOIA 4KN9S 5JECA 2GXUA 2WOOA 1EUZA 2X19A 4XCXA 3I23A 5GM1A 2YRXA 4PLCA 1OV4A 1PVOA 3BGOS 4BX3A 2YY6A 3HVHA 5T3YA 1RE0A 3ZXXA 2QM3A 4MVJG 4WJKB 1E3EA 4X41A 4WBNA 4Y7CA 5AKIA 1DKNA 1I9GA 1P4GA 3DZKA 1XEWX 1Z5VA 1I36A 4G0UA 4C05A 4P93A 2DPXA 3PQ6A 2ACEA 2ATCA 4ZP1A 1Y9ZA 5FL7A 1U81A 2CVOA 4C5AA 1SEVA 1G7CA 4EM6A 2NV6A 2VP3A 5BNWA 4ZVTA 2G6TA 3AYXB 4FFBA 4QIHA 1XK6A 1G2OA 3KRTA 3CNNA 4BB6A 1LBHA 4Q3DA 1NVEA 4X44A 1T2DA 1PW5A 3WB2A 2K7FA 3PQEA 1GGMA 1WDMA 2WU1A 4IRUB 2CVFA 3K94A 4DLLA 3ZLVA 5L3VA 1EP2B 3LPLA 1SXJD 1LS1A 4P3PA 4DLRA 2P7HA 5K7SA 5K6TA 1VHTA 1MG5A 3PG5A 2I4NA 4CKCA 3D3KA 4I5EA 2AMJA 2XD9A 1Y6FA 2ZIVB 3CRVA 3VYSB 4BB0A 2CF5A 4WDQA 2CDRA 1Z7WA 1NNLA 1H0SA 3A2LA 2JVKA 3CX3A 5GONB 2IU6A 3SZMA 4M9QA 2RG7A 3C1OA 1KBQA 1KAQA 4DHWA 4AY6A 2VCEA 5DM4A 3JW8A 4E5MA 4DQ0A 2JI6A 5EE5B 4MKHA 3QWBA 3ZDAA 1E2BA 3RUHA 4AYTA 3NAQA 4RPKA 2NZWA 3PNQA 3DKKA 5FHQA 1A96A 3ZZTA 3T3DA 3K1AB 5AQEA 1M2WA 4BO4A 1L3IA 4OFBA 4UEWA 4ZREA 5TRTA 4CVNA 1IQPA 3RVOA 2Z2KA 2NW6A 3SVZA 1O6BA 1XDUA 2W2OA 3NOQA 4RF5A 3X1ZA 4E70A 5CDTA 4PZAA 1LDGA 4AECA 5KMGA 5T4FA 5J4HA 1HQCA 3O21A 4KCGA 3RFCA 1GPKA 3PNKA 1TXGA 2Q6OA 3DT9A 3Q9SA 5CEJA 3AZOA 1DAIA 3FPKA 4XCVA 2GWRA 2NU8B 3SQMA 4MV7A 2I66A 3DZCA 5COAA 2WILA 4ZZ1A 5DXJA 2R6AA 5HQJA 2IXFA 4I36A 1OWMA 5H0IA 2ZSHA 1U3GA 3MT7A 2EWWA 3GAAA 2G1AA 2PDAA 4FDTA 1N2ZA 4PO1A 2WZBA 4YT5A 5A5FA 4K40A 4MVJM 2JF0A 4ZMSA 1R5NA 3BWYA 2QTCA 4BP3A 3I0ZA 4FONA 1BG6A 1JQKA 4JC0A 4ND2A 5D3ZA 1I4OA 1U9IA 4E4RA 3OZAA 2JFGA 3H5IA 2P9GA 1JGTA 2VDRB 2DMRA 4DILA 4KFUA 3VC1A 3AZQA 3DAHA 1L5FA 4HNQA 2AV6A 1DZ3A 1TO1E 2OCDA 3NAMA 4B5LA 3LHDA 4F4UA 5CFLA 1LPPA 1VG1A 4JIGA 4WUVA 3U7HB 1YU9A 2FI1A 2EDCA 2YBDA 3HY6A 3M3DA 5IUJC 1KOLA 3MHPA 3ZWDA 1S02A 4U00A 3LQ2A 4KXFB 4N8SA 1KVUA 3HKDB 2F3RA 1Z2AA 4JJKA 4BVLA 1PLLA 1Q7BA 2WBLC 2EGUA 3OQHA 4MUYA 3GHYA 4IDDA 1P62B 2VEOA 3E1GA 3DDCA 4QSHA 2WYIA 2OV8A 2FX3A 5E0KB 2FN9A 1UMBB 4EI9A 3LDGA 4MK4A 3PLNA 4HBZA 2VF2A 4JQZA 1IRXA 2VC2B 3E27A 4DMHA 1ZZGA 2QG4A 5KNBD 2FWMX 3CU5A 3GUYA 1RRVA 4MRPA 3T7IA 5KWSA 1YF3A 1EQUA 4GT1A 1E62A 1CV2A 4QTXA 1POXA 1GPAA 3NW9A 4U7PB 3WLNA 2P4SA 4URHA 1PV1A 4BS9A 5B1EA 3UCEA 5CA0F 3UPUA 5JNVA 5D85A 4N18A 1H22A 2FMIA 2ZVQX 1V9SA 2JFXA 3EGDA 3JQ7A 3ZWQA 2HK8A 1MJNA 1T35A 2JVIA 2OY0A 3WXMA 3IBFA 1Y3HA 4FZ5A 1OROA 1Y7PA 2FMFA 3FLAA 4PAWA 3SPXA 1AS2A 1IM5A 1D0IA 3UANA 2ZYSA 3G5LA 3CONA 4PY2A 1MFZA 4ZOAA 3LCCA 3TQIA 4AQYB 4IO0A 2H57A 2NSDA 3GFRA 4C88A 2ZJ4A 4Q4JB 4AP9A 2O14A 1II8A 1RWKA 3MTQA 5DFAA 2X5OA 1W30A 2Y9MB 2E89A 3ZZUA 5JY6A 4CFYA 3BERA 4IQGA 2D0PB 2FRXA 1GNTA 2OBXA 4FM9A 1WU7A 1Y0BA 2XMDA 4DJAA 4KXLA 1B23P 1Y1KE 3CH6A 2WF9A 1V1RB 3PQ7A 4QFDA 2NLOA 4TGLA 4YJHA 1YJQA 5ALHA 3BA1A 1F0KA 1RPJA 1EDDA 4JBIA 3U60B 3DAGA 5AW1A 3ENZA 1D2GA 4JJ4A 4ZO4A 5CYFA 1TLTA 4N01A 3UFXA 1P0PA 4DAOA 2KMLA 3COYA 4Q18A 2RI6A 1WZNA 1ECGA 2QAJA 3FF4A 5AKHA 1LBTA 3V3KA 4KFRA 2DKOA 1USIA 4DVJA 3RVBA 2ZM5A 1HT0A 4FNAA 4ZV7A 3RRJA 1UEIA 2H5LA 5TQ0A 4XIFA 1YA8A 4ZT2A 1YFJA 3PUIA 1ZU4A 4BNKA 1TQ4A 2JAWA 1W25A 2ZIEA 4K9MA 1E5DA 1BVUA 2HMVA 2JD2A 1TAGA 1LV8A 2B7BA 2RJ3A 3PYXA 1Z6ZA 4A8HA 2W71A 1JN0A 3EZ2A 4QGHA 2D5AA 3OMXA 4D80A 3AK4A 4GI3A 3AF1A 3OQIA 1RHJA 1P44A 4NU6A 4Y2QA 5IM5A 5E9AA 1ZI8A 4X95A 2PTHA 2Q5OA 4R6XA 2P2GA 4G4SP 2GB4A 2WSBA 3C6ZA 4HRAA 4OQMA 1FDIA 2DHCA 3OUUA 3E8SA 4M9XA 4MH0R 1PI3A 1BE1A 5HF5A 3NI2A 3MJEA 2JBHA 4FT2A 1VKHA 2XB9A 1ICIA 2ID9A 1FXWF 1GUFA 1OWPA 2DBYA 5I5GA 2GZRA 4PLYA 2IYZA 3TIVA 2B5OA 1G20E 2OMEA 4R6WA 1ID1A 1T24A 1O95A 1RM0A 3CMMA 1XHLA 4MYRA 1EDEA 1OLXA 5E9JA 4KV7A 3THWA 1UJ2A 2ZBRA 1KE1A 4CXMA 3H4IA 4CDRA 2WEKA 1AIPA 4LHWA 4GSYA 1CJBA 3E3NA 1KZYC 2FPGA 3WX0A 3QKRB 3PE4A 2Y92A 2F7SA 2P9JA 2EW2A 3O8CA 7GPBA 3B3FA 3HBNA 3RNOA 2YWCA 4M7WA 4TRMA 3BE4A 4EHHA 4PQRA 5J4LA 4PPNA 2UZ3A 4QUEA 2N9UA 2QX4A 1Z2OX 1RC8A 5LDGA 5L51A 1M34E 1Z0JA 4O2AB 4Q7JB 1YONA 2JFBA 4HC4A 5E2BA 1WCYA 5KQMA 1D9ZA 4FI3C 3AHGA 5E95A 4A6PA 3NEJA 5EZYF 2YNMC 2E85A 2HMSA 1ZGJA 2AOUA 2C2XA 3TGWA 3UPTA 1P91A 2IUSA 3CLUC 4TWJA 1HBJA 1KY3A 2GZHA 1CHNA 3OBIA 4RK1A 2VPIA 4P4LA 4B48A 2AQHA 3IL2A 3DZ8A 4RJ2A 4TXNA 1ZI9A 3ONNA 2W2KA 2JGLA 2FRVA 1UBMS 2P30A 2QTFA 3KTDA 1JPJA 3PGKA 4J7CA 4DCSA 4RLSA 4BJ6A 3O2SB 5HDQA 3C0KA 2ECPA 5INTA 3VPCA 1J6UA 3THSA 3FAKA 3KXIA 4WFKA 4JOQA 4D4IA 3ZCXA 2XVYA 4GQAA 3WB1A 2FPMA 3SVTA 1WF3A 5AFSA 2BGTA 4KG7A 5CFOA 5HGXA 3G89A 3SHFA 4WXRA 3PYLA 1BJKA 2A9JA 4CDNA 1MO5A 1UPXA 2F67A 3CJRA 4B7UA 4K2AA 3NM4A 3HN7A 1N1EA 4EW6A 1DKPA 2I0FA 4HGPA 3WMRA 2EGGA 2C83A 1YR6A 4M87A 1M34A 1SO8A 2PA0A 4LF9B 3AVYA 1MRNA 2EP7A 4DMUB 4TLCA 3BFKA 3VR4D 1GRNA 1CRZA 1JKXA 4IIEA 3M5WA 4PR0A 2F3SA 4MYDA 4RKEA 5IYZF 3E5HA 2RAPA 5B1SA 1EZ4A 4YDRA 2VP6A 1QRTA 1AGNA 2VHYA 2H00A 2ZSDA 1TE2A 1OUMA 3BA6A 3WYCA 1TAHA 4KR0A 3U4GA 4M0UA 5HFNA 2DE0X 4EQ6B 3FZNA 2ZROA 4F3KA 2J6BA 4GX2A 2Z43A 4P7GA 3HR4A 1Z26A 2X41A 3I2KA 3MLEA 2OO3A 2B4AA 2HTFA 2C2WA 2Q5JA 3VI4B 3PEWA 1T0IA 4YHBA 4IRMA 2QZSA 3R7BA 3GP8A 2J46A 4BZQA 4DV7B 2QVBA 5HOEA 3W5CA 3DDOA 1TEVA 5AHKA 2CUZA 2POCA 4UHFA 1KZGB 3BXHA 3D8NA 3LA8A 3IJ5A 5LXTF 3ZU4A 3Q5EA 1EYZA 1VPLA 4DLTA 1NBME 4UHDA 4E33A 1OI2A 2J7PD 3K2IA 4CEHB 1A50B 1SBIA 1VRWA 5FBHA 1PZEA 3F96A 1E1MA 3DLCA 5K3FB 5JS6A 3LT4A 4BVAA 3NVKI 5LKAA 2WFMA 3NT5A 3H5TA 5EE0A 3PCTA 2FUKA 5IAJA 2HHJA 3WL4A 1BE8A 5ALFA 4LK3A 1EXVA 1A76A 4G0XA 1JPUA 3MJTA 4TTTS 1Q77A 1JKJA 1VC2A 5BW6B 2GASA 4UJ5A 2O0JA 1CQWA 3H0CA 2BR5A 2JIZA 1N0VC 2QTGA 3HCEA 3E7DA 2ZSFA 4D1YA 4AXXA 1YE8A 5C1BA 2FUNB 1RZRD 2BHTA 4F2PA 4QDOA 1IXKA 1P5RA 2FETA 1QJ4A 3HB0A 2SBTA 1O97D 2K6GA 2PPVA 4MWGA 4WNCA 5E7IA 3OCVA 4LMRA 1ZRMA 4J1TC 1EK1A 4E1VA 2I8LA 1FF9A 1V2HE 3FCEA 3G6WA 2PNJA 4EFMA 2HHAA 2CUNA 3AJ9A 4ZQHA 3KKZA 1DC8A 2AMLA 3DEYX 2QMEA 1B8OA 2XEXA 3DFFA 3F49S 3A58B 4E5KA 4V1CB 1FJHA 4OYRA 1NXSA 3TQRA 1DKRA 2QY9A 1T29A 4HH0A 3GVXA 3PFIA 1BEUB 3CF6R 4XKJA 2H2FA 1WTCA 1LC0A 3C3WA 2VH1A 1DQYA 3DEFA 5KNBH 3CW8X 3JQ9C 1KDVA 1AHIA 1AUVA 2C2KA 2EGHA 3VOBA 3CSDA 4D8XA 1M5RA 3MINA 4OK3A 2XMRA 5LJLA 2UKDA 1N5RA 3QFTA 3Q5GA 5DYGA 3RYFA 4LFCB 5EIAA 1VIVA 1M1NA 5TXGA 1VYTA 2LGJA 1TF2A 1NU8A 3DOJA 1R8XA 3DVAA 4LSMA 2H51A 5DHAA 4K6CA 2DKFA 1TKAA 4RL4A 3DZGA 4O4LA 3OEED 1QH1A 1CQZA 1WRBA 4KAFA 4OUKX 3MJDA 5IEJA 1LDNA 1WETA 2GCNA 4KWTA 4QFBA 1NVMB 2ZRFA 4HN2A 3H1TA 1UWLA 5J2UA 3DJFA 1JEEA 1IBSA 3W7BA 2ECOA 3EXIA 2IQ5A 3IKJA 3M4XA 1Z25A 1PR6A 2EEZA 3EEFA 5SZHB 3FN4A 1USKA 2Y1DA 4LYDA 3K0FA 4REMA 1KI2A 3NWBA 2Z6VA 3A6JA 3BB3A 1K8RA 1SIBE 1V0JA 5JSZA 4EW2A 3L0BA 2ATEA 3GJ8A 5TEWA 1TTHA 4C2AA 4RYDA 1L4NA 5F2OA 1FDSA 3SBOA 1LNSA 1DP4A 3COJA 2HYIC 3UJPA 1Y9AA 3CT6A 3G2MA 1B8PA 3LUJA 3QTTA 3ZW9A 5GIOE 1EM6A 1XALA 1WEHA 4IJVA 3ZCUA 4CW7A 5C3MA 1PV2A 3DZHA 3TXYA 1UQUA 1MR3F 4R84A 1GG2A 2AR7A 3AKYA 4QXMA 2ZULA 3Q5DA 2XY4A 4RA6B 1JLHA 1KEVA 1BC5A 1ZSVA 2C3MA 2HMTA 3BE8A 2GPAA 2DGDA 3I2GA 1M2OA 1GLVA 4K3VA 4RE5A 3OG9A 5U4QA 3U0BA 4AF8A 4CIAA 2ODWA 3IMKA 2N0SA 3GLQA 4LJ9A 3UMSA 3VR6D 4UCQA 1UAGA 1W5SA 3FPGA 5IN4A 1Z5PA 4XQ0A 3EZFA 2P40A 2H7YA 2WM9B 5D2CA 2H1CA 1PUIA 3T54A 4C6TB 1O3YA 1RXIA 3ZWWA 5AOCA 1KEUA 1PS0A 4UMFA 1V11A 2CL0X 1IXRC 4EO4A 2JFYA 3FHLA 3RAFC 1U8CB 3W5DA 1NI3A 5D3MA 4XD2A 1EZ1A 1NHGA 3SKVA 3OJFA 1ECBA 4WFIA 1OYWA 2I3DA 2ZQ5A 4JX9A 2H5EA 2GPTA 1PSZA 2DYKA 4Y9RA 1LTKA 3N6RA 3OLWA 2XKKA 4DHEA 4IYJA 1UMBA 4GWKA 3SDBA 4AKTA 3GGCA 1OFIA 4YV7A 4MZDA 3AUYA 4NS4A 4B87A 5BSVA 2ZYDA 1F20A 1DIGA 2AW5A 3VU9B 5K0EA 2A30A 4CMCA 1EXNA 4J0FA 2M6LA 3TDMA 4W5TA 4D92A 1Y34E 3GEPA 4P86A 3UZUA 3X44A 4HAYA 2G36A 4N3AA 1B00A 2VBCA 1A8SA 1K86A 2AZ4A 1PN3A 3FVWA 2WV9A 3JQAD 1K5PA 3JQ6A 1X86B 4XAQA 5EJIA 2FZ5A 3OPYB 2Q9AA 5FUYA 4Y6PA 3M4ZA 3VKFA 3IQIX 3WIVA 2ZSIA 1H2HA 3CUYA 3NG1A 4NCXA 3U80A 4D6PA 1NVXQ 1WB6A 1K7SN 1VKNA 2EV9A 3GVCA 1KOFA 1TA9A 1SCBA 3MYRA 1J42A 4HAXA 1AB5A 3PX3A 3AVVA 1UKBA 4C6HA 1JWAB 2P2NA 3HP1A 4PZPA 2PGXA 4EDFA 5BNIA 5IYZB 1JJBA 4URZR 4IH1A 4YRLA 2YS7A 4FDAA 1IWPB 1JE1A 4FFLA 2DHRA 1OFHA 5DTJA 1D6SA 1XJWA 3IVRA 2BIFA 1V96A 3QPWA 4BTEA 3QQ5A 4L4RA 4NESA 4Q19A 3H2BA 3AL2A 3QVLA 4J0IA 3L6OO 4CLOB 3GIDA 1QGAA 2NOAA 2PZKA 1CJTC 2YY5A 4WL0A 4Q1AA 1JJVA 3ZLUA 2G7ZA 3I34X 3O93A 1E9EA 1YVEI 3LLSA 4EAQA 3ME5A 3BH7A 5DK6A 2XT9A 4OYLA 3E53A 1DBIA 1T13A 3RLFA 1Z47A 3RTEA 3ZXUB 5K0LA 1E5VA 3C7TA 4LGMA 2PZBA 1PYGA 1EE1A 4LFAB 2J7KA 5KX5A 4MUXA 3S99A 1MJ5A 4AZ0B 3PPIA 2ZZMA 3DBLA 3EZGA 5FBLB 1QQAA 5L8VA 4LISA 5EJ7A 1QPGA 1XMIA 2C92A 1YIAA 1FDWA 1N5IA 2VDOB 4XUGB 5I7RA 2H9YA 4H3SA 2V3VA 2OLEA 1Z0DA 2V0CA 3FNGA 5ELLA 4J75A 4FVTA 3K2QA 2P9FA 4R8RA 5TC4A 1AGXA 1ZDMA 1I24A 1WXHA 4L8YA 4ZAVA 1I2CA 1HYHA 4NEHB 5KTNA 1ZAYA 4EO9A 3DD1A 4FHFA 4KTVE 1ISSA 4CMIB 1R0KA 2D5CA 1ZXXA 2I2XB 2RGNA 3NRCA 3OZSA 5KNCA 1M67A 3BTOA 3USCS 1RAIA 3DQZA 3WRXA 1GKKA 2HWWA 3N3BC 1EDZA 1Y9DA 2FWJA 1H2FA 2ISQA 3QLTA 2P1ZA 1N8TA 3PD1A 2CFIA 2X0DA 1M6VB 4NPHA 1NOKA 1JIIA 1WZEA 3H5VA 3QYJA 4E15A 1OXKB 5ALUA 1MRSA 2PUAA 1LLCA 1W85A 4U9UA 2H7XA 2P9HA 1QLWA 4M36A 3B1ZA 1LI4A 1UM8A 2UYOA 4R81A 4R9RA 3WGLA 1C7IA 1GCOA 3GOHA 4OMDA 2PGAA 5HTKA 1NPTO 5CLJA 5C31A 2ZUFA 3EGOA 4B09A 2ASEA 2I91A 1MQSA 2GRUA 3KYBA 2X6RA 3WFZA 3R9WA 2BF4A 3II6X 5EFZA 1KAGA 2IRWA 1QVVA 1WBDA 5IKPA 1K98A 4L75A 2HU5A 1Q1GA 1FBTA 2O7QA 1UPCA 3VTZA 1XDDA 3W9SA 4EMSA 2V6IA 2VHQA 1MJGA 3M70A 2CBZA 1LRKA 3IVAA 5E6UA 1XMQB 3ZYZA 2JGDB 4FSHA 2C7BA 5EMKA 2GKOA 3ZWVA 4D3SA 4PS1A 1HZZA 3TKLA 4JB8A 4BPRA 1A0OA 3EIXA 3EVZA 2Q1UA 3GBVA 1CEQA 3HYNA 2PQ0A 4Y1RB 1QF9A 2FSSA 3T3HA 3L79A 1R2QA 1NRWA 3JTMA 4CLRB 2JCGA 3IX7A 4KLAA 4Y2VA 2BHRA 5D5HA 5EKUA 1B76A 1JJIA 2WTXA 2N46A 5HQ3A 2C2ZA 1CY4A 4BWVA 4EQ6A 3PIIA 4QDTA 1WXDA 5E6RA 3SX2A 1EHCA 2LTAA 1SCQA 4AZTA 1SMKA 3RI3A 1K4MA 2XOKD 1XVVA 1V3QE 1YS1X 5T8KA 1HNXB 4EGCB 4Z4CA 4MYCA 3ICEA 4MWTA 1U2EA 2VK4A 3BWDD 1JA1A 1T3TA 2OM2A 1NW4A 1UM9A 1E9SA 1XQ6A 3BFPA 3GZJA 2XDWA 3E58A 1DOHA 1L5ZA 2WPNA 1ZXLA 3USZA 5B6IA 3QHQA 1EFHA 2ZT6A 1DV2A 1CKEA 1KIAA 1R6VA 2LDBA 2L0XA 4RVHA 3SKYA 4OQEA 1MA3A 2XGJA 5F51A 4TROA 1E4YA 1H93A 2QUJA 4UTVA 1A1SA 1CQJA 2AHOA 2XBMA 2E5FA 3ZV3A 3E3MA 2WNHA 4FIDA 1SC9A 3ROEA 2QYHA 3MOSA 4OFWA 3AUSA 4IV5A 4QULA 3WV5A 4S05A 3RAGA 2DWUA 3TF5A 1M0SA 1KVRA 3EQ8A 2YHAA 2KSQA 1DIOB 1SM4A 3VJLA 4RY0A 5AVKA 5T64A 3WIDA 2W4IA 5BNZA 3W04A 3ZVMA 1S3FA 3HJHA 3NTXA 4PBRA 3ZGVA 4E2XA 2QLTA 3GJ5A 4Q9NA 4U8HA 1GTJ1 2X5KO 2YUIA 4ZC1A 5CAEB 3IIIA 3N8KA 2PAFA 3N39C 1Q0ZA 3AF3A 5KNCH 1WW3A 1Z5UA 5LYJB 1E3SA 3IAFA 3UPDA 1QTRA 2QXTA 1A2QA 4DPMA 2PJDA 4ENWA 1XRMA 3DMGA 4KLRA 5K6AC 4R7GA 1UZNA 4KNYA 1V1MA 2R5FA 1FW8A 1W73A 3IOCA 2C84A 1VHJA 3N8DA 3BL8A 2P2SA 4PEVA 3VU9A 4OGGA 3KQQA 1B8UA 5KREA 2IYVA 1H05A 4AUMA 1OT3A 3GLHE 3TEJA 3BQNB 3RV4A 5JCJA 4F3RA 2B94A 2D3TA 2V5AA 4A2CA 3VR6H 3DL4A 2WQZA 3UA3A 3LD9A 2P9BA 3EF1A 5G1NA 3WGZA 4YS6A 1JSCA 4BMOB 3GPLA 3TO5A 2POQX 3UM9A 4EB6B 1O5OA 1X8XA 3EULA 2ANCA 4QYIB 3B6ZA 4XQ9A 4E31A 5BSFA 2H06A 4MO9A 2BR3A 2NZJA 2WFLB 3OIDA 1TADA 2FQYA 4P4SB 2G7MC 2R8ZA 4E5YA 1JDBC 3D6VA 1CUJA 1ETHA 2G0TA 2WHPB 1Z17A 2HRCA 1GZ6A 2BBOA 1VG9B 2VYVA 5BSUA 3SYRA 1BKDR 2H1WA 4F9GA 1NUUA 1WMBA 4NDAA 2IHTA 2WF8A 4C14A 4OHCA 5K0NA 1W48A 2I2BA 5C35A 1KAEA 3ILXA 4S2UA 4JBLA 3NHJA 2H4JA 5E7JA 1AN0A 4QNRA 3TFWA 4Z4IA 3RFXA 3QRWA 1IDOA 3MCZA 3LVQE 3S0JA 1UJBA 2WPDA 3I2YX 3PKZA 4ARZB 5JW6A 3DM5A 1N0HA 4W9MC 2I7XA 1UC8A 1N6OA 2YS6A 3O90A 5AQ1A 4PPQA 1FSGA 3WWOA 4CN8A 2O5CA 1C9DB 2AEEA 3LRXA 1T5SA 2UVQA 4UUBA 1XPRA 1EIZA 2DP4E 1PQUA 3QWIA 4IWNA 3GBSA 3DDZX 5HJ5A 1X1DA 3BN3A 3L8CA 4L07A 2FZGA 3EDMA 1ULAA 1JIJA 3GP3A 2A7QA 3O3OB 1GN8A 2O7SA 3RVKA 1DRUA 1YQXA 5EWMB 2RGUA 4OQDA 5HKKD 3K1YA 3ICPA 4CCYB 2V65A 2Y1OA 5K09A 1DAHA 3GLHA 1CNFA 1U8TA 1UXGA 4IVNA 3IE2A 2FUG6 3FMFA 4K6OA 3ETHA 4P83A 5I6DA 3QVGA 1Q1EA 2REBA 2BZSA 1WBBA 1N2OA 3FDJA 4GOJA 1NX6A 2X9NA 5T4HA 4TV9B 3C8DA 3W5IA 3RVJA 1J24A 4AF7A 4RHUA 4UC0A 2F8SA 3LWZA 4DQKA 5I9MA 3TX2A 1ADCA 3QXHA 4NH0A 1AKMA 2MWMA 3FPJA 5FORA 4CMEC 2DT5A 3PJFA 3V80A 1YTLA 2I71A 3NC1C 3LQQA 4MO2A 5CEFA 2FRDC 2RGRA 3BD9A 4TXMA 1NKVA 2I7DA 2JIQA 1FUEA 2WJ4A 3DSRA 3JWPA 3QKTA 3IRVA 1PYDA 2OCGA 4HO1X 3PL1A 4KRXA 5THXA 3OOYA 3UMBA 5EJ2A 3ST7A 2OORA 1KR2A 1MOQA 3D4BA 3GFOA 1LB1B 2OD2A 3VH1A 3IDSA 2GZMA 4QWWA 1UBJS 2W2PA 4E5UA 1IYZA 2AQIA 4QM6A 2TMGA 4QBKA 1P4JA 5DHPA 2H7VA 4C7VA 1YDGA 4GKKB 3CPJB 1X1AA 4HH1A 1QGED 2DR2A 3RE1A 2X6TA 3WDKA 4O5OA 1SH7A 2AEJA 2ES4A 1T10A 5AESA 4BXOB 2D6FA 2PKCA 3NAGA 3MRVA 1YK1A 2HCJB 3DCJA 4PHGA 6PFKA 3FMVA 3L04A 4C2UA 4RY9A 1IMOA 2A67A 3OT5A 3U7JA 2HA5A 3LSYA 4C0BA 3T41A 3EC2A 3IULA 4NENB 1VKOA 4RIGA 4AI6A 1KSHA 3QV1A 5CD9A 5MDHA 4TZ6A 4MPDA 2VBFA 1GV0A 3NWPA 3LX5A 2I6QA 1ZLXA 4KXWA 5HJ7A 1PGQA 2JH3A 3DEHA 3LNCA 1R0WA 2R97A 3B60A 1DCFA 4Z9XA 4ASUD 4E5VA 2QZPA 3UEOA 3WL6A 3TIFA 2Q50A 3V4ZA 1HFWA 1UOQA 4GXTA 4F96A 1PX0A 4M0KA 4HYTA 1D1QA 3OTHA 1DNPA 3IAM1 3WGKA 3W6ZA 5KHAA 1DKLA 3H8JA 3K9FC 1E1CB 4IS3A 3ZHXA 3T3OA 1WB4A 3GYGA 1EGHA 4DSZA 1J22A 3PENA 3FLEA 1LSOA 1ZVJA 2DPLA 1RPAA 3CZRA 4A2WA 2CV2A 8MHTA 3WRYC 3K0SA 2SHKA 2YVUA 4TKMA 3OZCA 1YIOA 5GZ1A 4FD2A 2FSHA 4F06A 4EELA 1C0LA 2WAYA 3T99A 1MVLA 3S81A 1H4QA 4M1EA 4D8UA 2H16A 2FQ1A 3PGXA 3ITNA 1IN1A 1P1HA 3IAUA 3TINA 4OJKA 3WRWA 2P90A 1F2TB 1VLLA 4EY8A 2W70A 1SG9A 5DBOA 3V5NA 3QLEA 1UJ6A 3R6GA 1SU6A 4COOA 3A2KA 2I1QA 5DEOA 4OGLA 2D2VA 4G4JA 2C9ZA 4EGSA 1Q84A 1MD9A